COMBINATION THERAPIES FOR INNER EAR SENSORY HAIR CELL REGENERATION/REPLACEMENT
20170348346 · 2017-12-07
Assignee
Inventors
Cpc classification
A61K45/06
HUMAN NECESSITIES
A61K9/0009
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
A61K41/00
HUMAN NECESSITIES
A61P43/00
HUMAN NECESSITIES
A61K31/713
HUMAN NECESSITIES
C12N2320/32
CHEMISTRY; METALLURGY
A61K31/7105
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
International classification
A61K31/7105
HUMAN NECESSITIES
A61K9/16
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
A61K41/00
HUMAN NECESSITIES
Abstract
The present disclosure relates to compositions and methods for the regeneration and/or restoration of hair cells utilizing a composition or an agent that decreases expression of a gene in a tissue of the inner ear and a second agent.
Claims
1. A method of treating hearing loss or balance dysfunction in a subject comprising: applying to the inner ear of a subject in need thereof a therapeutically effective amount of a GSK-3 inhibitor, and applying to the inner ear of said subject an amount of a composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear.
2. The method of claim 1, wherein the GSK-3 inhibitor is selected from 6-bromoindirubin-3′-oxime (BIO) and tideglusib (TIDE).
3. The method of claim 1, wherein the composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear comprises an siRNA molecule.
4. The method of claim 3, wherein the siRNA molecule comprises one or more of SEQ ID NOs. 1-14.
5. The method of claims 1, wherein the composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear comprises a nanoparticle comprising an agent that decreases expression of a Hes 1 gene in a tissue of the inner ear.
6. The method of claim 5, wherein the agent that decreases expression of a Hes 1 gene in the tissue of the inner ear is an siRNA molecule.
7. The method of claim 5, wherein the nanoparticle further comprises a biodegradable polymer.
8. The method of claim 7, wherein the biodegradable polymer is poly(lactic-co-glycolic acid) (PLGA) or pegylated PLGA (PEG-PLGA).
9. The method of claim 4, wherein the nanoparticle further comprises a magnetically responsive particle.
10. The method of claim 9, wherein the magnetically responsive particle is superpararmagnetic iron oxide (SPION).
11. The method of claim 9, further comprising using magnetic force to transport the nanoparticles across the round or oval window membrane.
12. The method of claim 1, further comprising applying to the inner ear of a subject in need thereof a therapeutically effective amount of FGF2.
13. The method of claim 1, wherein one or more of the applying steps comprise transtympanic administration, intracochlear injection, intracochlear infusion, or using ear drops.
14. The method of claims 1, wherein the GSK-3 inhibitor is applied before applying the composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear.
15. The method of claims 1, wherein the GSK-3 inhibitor is applied after applying the composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear.
16. The method of claim 1, wherein both the GSK-3 inhibitor and the composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear are applied simultaneously.
17. A method of replacing, regenerating, and/or protecting hair cells in the inner ear of a subject comprising: applying to the inner ear of a subject in need thereof a therapeutically effective amount of a priming composition, and applying to the inner ear of said subject an amount of a composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear wherein the priming composition exhibits one or more functions selected from the group consisting of stabilizing f3 catenin, increasing the number of pluripotent cells in the inner ear, increasing plasticity of pre-existing pluripotent cells in the inner ear, or signaling differentiation in cells of the inner ear.
18. The method of claim 17, wherein the priming composition comprises a GSK-3 inhibitor.
19. The method of claim 18, wherein the GSK-3 inhibitor is selected from 6-bromoindirubin-3′-oxime (BIO) and tideglusib (TIDE).
20. The method of claims 18, wherein the priming composition further comprises FGF2.
21. The method of claim 17, wherein the composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear comprises an siRNA molecule.
22. The method of claim 21, wherein the siRNA molecule comprises one or more of SEQ ID NOs. 1-14.
23. The method of claim 17, wherein the composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear comprises a nanoparticle comprising an agent that decreases expression of a Hes1 gene in a tissue of the inner ear.
24. The method of claim 23, wherein the agent that decreases expression of a Hes1 gene in the tissue of the inner ear is an siRNA molecule.
25. The method of claim 23, wherein the nanoparticle further comprises a biodegradable polymer.
26. The method of claim 25, wherein the biodegradable polymer is poly(lactic-co-glycolic acid) (PLGA) or pegylated PLGA (PEG-PLGA).
27. The method of claim 23, wherein the nanoparticle further comprises a magnetically responsive particle.
28. The method of claim 27, wherein the magnetically responsive particle is superpararmagnetic iron oxide (SPION).
29. The method of claims 27, further comprising using magnetic force to transport the nanoparticles across the round or oval window membrane.
30. The method of claim 17, wherein either or both applying steps comprise transtympanic administration, intracochlear injection, intracochlear infusion, or using ear drops.
31. The method of claim 17, wherein the GSK-3 inhibitor is applied before applying the composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear.
32. The method of claim 17, wherein the GSK-3 inhibitor is applied after applying the composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear.
33. The method of claim 17, wherein both the GSK-3 inhibitor and the composition sufficient to decrease the expression of a Hes1 gene in a tissue of the inner ear are applied simultaneously.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
DETAILED DESCRIPTION
1. Definitions
[0061] As used herein, the term “an amount sufficient to” refers to amount that enables the achievement of the intended effect, for example, to decrease the expression of a gene in a tissue of the inner ear. Such an amount may be determined through various assays known in the art based on the intended effect.
[0062] As used herein, the terms “applying” or “administering” refer to all means of introducing the specified agent, composition, or force to the specified region or subject. “Administration” or “application” can be effected in one dose, continuously or intermittently throughout the course of treatment. Methods of determining the most effective means and dosage of administration are known to those of skill in the art and will vary with the composition used for therapy, the purpose of the therapy, the target cell being treated, and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician. Suitable dosage formulations and methods of administering the agents are known in the art. Route of administration can also be determined and method of determining the most effective route of administration are known to those of skill in the art and will vary with the composition used for treatment, the purpose of the treatment, the health condition or disease stage of the subject being treated, and target cell or tissue. Non-limiting examples of route of administration include oral administration, nasal administration, inhalation, injection, and topical application. Administration can be for use in industrial as well as therapeutic applications.
[0063] As used herein, the term “biodegradable” is used herein to describe substances, such as polymers, compositions, and formulations, intended to degrade during use. Biodegradable substances may also be “biocompatible,” i.e. not harmful to living tissue. Non-limiting exemplary biodegradable substances include poly(lactic acid) (PLA) and poly(lactic-co-glycolic) acid (PLGA), optionally pegylated.
[0064] As used herein, the term “BIO” or “6-bromoindirubin-3′-oxime” refers to a compound with the structure depicted below and pharmaceutically acceptable salts thereof:
##STR00001##
[0065] As used herein, the term “cell” refers to a eukaryotic cell. The term “hair cells” refer to sensory epithelial cells characterized by having long cilia (e.g. stereocilia and/or kinocilia) which appear as fine hairs under microscopy; as used herein, hair cells (HCs) may be identified by their location—e.g. inner ear hair cells (IHCs) or outer ear hair cells (OHCs). Such hair cells are known to be present in at least the cochlear organ of Corti, maculae, and cristae of the ear.
[0066] As used herein, the term “differentiation” refers to the specific conditions that cause cells to develop into cells of a mature/specialized cell type (e.g. hair cells) that produce specific gene products which coincide with and/or promote/sustain the traits of the specified mature/specialized cell type.
[0067] As used herein, the term “expression” refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins. The expression level of a gene may be determined by measuring the amount of mRNA or protein in a cell or tissue sample; further, the expression level of multiple genes can be determined to establish an expression profile for a particular sample. When used in context of expression, the term “increase” refers to one or more actions that would serve to increase the amount of transcription and/or translation. Similarly, the term “decrease” refers to one or more actions that would serve to decrease the amount of transcription and/or translation.
[0068] As used herein, the term “gene” as used herein is meant to broadly include any nucleic acid sequence transcribed into an RNA molecule, whether the RNA is coding (e.g., mRNA) or non-coding (e.g., ncRNA).
[0069] As used herein, the term “GSK-3” refers to the protein associated with this name, namely a serine/threonine protein kinase that mediates the addition of phosphate molecules onto serine and threonine amino acid residues.
[0070] As used herein, the term “Hes1” (also known as Hes Family BHLH Transcription Factor 1, Class B Basic Helix-Loop-Helix Protein 39, Hairy-Like Protein, Hairy Homolog, BHLHb39, HHL, HRY, Hairy And Enhancer Of Split 1, (Drosophila), Hairy And Enhancer Of Split 1, Hairy Homolog (Drosophila), HES-1, or HL) refers to the gene and resulting protein product associated with this name and/or GCID: GC03P194136, HGNC: 5192, Entrez Gene: 3280, Ensembl: ENSG00000114315, OMIM: 139605, UniProtKB: Q14469 (each of which is incorporated by reference in its entirety herein), as well as homologs or orthologs thereof in a particular species—including, but not limited to, humans, mice, rats, guinea pigs, and chinchillas. A non-limiting exemplary amino acid sequence of human Hes1 is provided herein below (SEQ ID NO: 25):
TABLE-US-00001 MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARI NESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAAL STDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQI NAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGG APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTS NSGTSVGPNAVSPSSGPSLTADSMWRPWRN
[0071] As used herein, the term “Hes5” (also known as Hes Family BHLH Transcription Factor 5, Class B Basic Helix-Loop-Helix Protein 38, Hairy And Enhancer Of Split 5, BHLHb38, Hairy And Enhancer Of Split 5 (Drosophila)) refers to the gene and resulting protein product associated with this name and/or GCID:GC01M002528, HGNC: 19764, Entrez Gene: 388585, Ensembl: ENSG00000197921, OMIM: 607348, UniProtKB: Q5TA89 (each of which is incorporated by reference in its entirety herein), as well as homologs or orthologs thereof in a particular species—including, but not limited to, humans, mice, rats, guinea pigs, and chinchillas. A non-limiting exemplary amino acid sequence of human Hes5 is provided herein below (SEQ ID NO: 26):
TABLE-US-00002 MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARH QPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAV QFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATA AAAAAHQPACGLWRPW
[0072] As used herein, the term “inhibitor” refers to a composition or agent that represses or prevents a molecule (e.g. a protein, nucleic acid, or other biological molecule) from engaging in a particular reaction. For example, a GSK-3 inhibitor may be used to refer a composition or agent that prevents GSK-3 in engaging in one or more of its biological functions. Non-limiting exemplary GSK-3 inhibitors include BIO, TIDE, Chiron compounds, lithium chloride, and SB-216763.
[0073] As used herein, the term “MAPK1” (also known as Mitogen-Activated Protein Kinase 1, Extracellular Signal-Regulated Kinase 2, Mitogen-Activated Protein Kinase 2, MAP Kinase Isoform P42, MAP Kinase 1, MAP Kinase 2, EC 2.7.11.24, P42-MAPK, MAPK 2, PRKM1, PRKM2, ERK-2, ERK2, ERT1, Protein Tyrosine Kinase ERK2, EC 2.7.11, P42MAPK, P41mapk, MAPK 1, MAPK2, P40, P38, ERK, P41) refers to the gene and resulting protein product associated with this name and/or GCID: GC22M021754, HGNC: 6871, Entrez Gene: 5594, Ensembl: ENSG00000100030, OMIM: 176948, UniProtKB: P28482 (each of which is incorporated by reference in its entirety herein), as well as homologs or orthologs thereof in a particular species—including, but not limited to, humans, mice, rats, guinea pigs, and chinchillas. A non-limiting exemplary amino acid sequence of human MAPK1 (isoform 1) is provided herein below (SEQ ID NO: 27):
TABLE-US-00003 MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVR VAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKD VYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDL KPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIML NSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQE DLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEE TARFQPGYRS
[0074] As used herein, the term “magnetically responsive” refers to the capacity of a particle or agent to respond to an attractive or repellant force resulting from the physical phenomena known as magnetism. In some embodiments, being magnetically responsive permits controlled movement or transport of a particle or agent by application of a magnetic gradient. A non-limiting example of a “magnetically responsive” agent is iron oxide; certain iron oxide particles may be superparamagnetic. Such superparamagnetic iron oxide particles may be macro-scale, micro-scale, or nano-scale. Nano-scale superparamagnetic iron oxide particles are referred to by the shorthand SPION.
[0075] As used herein, the term “microspheres” includes substantially spherical colloidal structures, e.g., formed from biocompatible polymers such as subject compositions, having a size ranging from about one to about 1000 microns. In general, “microcapsules” may be distinguished from microspheres, because microcapsules are generally covered by a substance of some type, such as a polymeric formulation. The term “microparticles” is microspheres and microcapsules, as well as structures that may not be readily placed into either of the above two categories, all with dimensions on average of less than about 1000 microns. If the structures are less than about one micron in diameter, then the corresponding art-recognized terms “nanosphere,” “nanocapsule,” and “nanoparticle” may be utilized.
[0076] The term “pharmaceutically acceptable carrier” (or “pharmaceutically acceptable excipient”) refers to any diluents, excipients, or carriers that may be used in the compositions disclosed herein. Pharmaceutically acceptable carriers include ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances, such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol, microspheres, microparticles, or nanoparticles (comprising e.g., biodegradable polymers such as Poly(Lactic Acid-co-Glycolic Acid)), and wool fat. Suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences, Mack Publishing Company, a standard reference text in this field. They may be selected with respect to the intended form of administration, that is, oral tablets, capsules, elixirs, syrups and the like, and consistent with conventional pharmaceutical practices.
[0077] As used herein, the term “plasticity” refers to the ability of one cell (e.g. stem cell) to take on characteristics of another cell and is generally used in context of differentiation. The term “pluripotent” refers to the ability of a cell to give rise to several different cell types.
[0078] As used herein, the term “polymer” refers to a molecule composed of repeating subunits. Generally, polymers have a tendency to have larger molecular mass relative to those molecules classified as “small molecule compounds.”
[0079] As used herein the terms “replacing” or “regenerating” refer to the renewal, regrowth, or restoration of hair cells. The term “protecting” intends the prevention or mitigation of hair cell loss.
[0080] As used herein, the term “subject” of diagnosis or treatment is a cell or an animal such as a mammal, or a human. Non-human animals subject to diagnosis or treatment and are those subject to a named disease or condition (e.g. hearing loss) or animal models thereof, for example, simians, murines, such as, rats, mice, chinchilla, canine, such as dogs, leporids, such as rabbits, livestock, sport animals, and pets
[0081] As used herein, the term “siRNA” intends a double-stranded RNA molecule that interferes with the expression of a specific gene or genes post-transcription. In some embodiments, the siRNA functions to interfere with or inhibit gene expression using the RNA interference pathway. Similar interfering or inhibiting effects may be achieved with one or more of short hairpin RNA (shRNA), microRNA (mRNA) and/or nucleic acids (such as siRNA, shRNA, or miRNA) comprising one or more modified nucleic acid residue—e.g. peptide nucleic acids (PNA), locked nucleic acids (LNA), unlocked nucleic acids (UNA), or triazole-linked DNA.
[0082] As used herein, the term “TIDE” or “tideglusib” refers to a compound with the structure depicted below and pharmaceutically acceptable salts and derivatives thereof:
##STR00002##
[0083] Non-limiting examples of the derivatives contemplated include those disclosed in US 2014/005195, which is incorporated by reference in its entirety herein. Such TIDE derivatives may have the same function as TIDE but be modified for improved stability, solubility, or pharmacokinetics. Further non-limiting examples of derivatives contemplated herein include those disclosed in Morales-Garcia et al. (2012) ACS Chem. Nuerosci. 3:963-917, which is incorporated by reference in its entirety herein. GSK3 inhibitors and derivatives thereof related to TIDE include the TDZD family of GSK3 inhibitor analogs.
[0084] As used herein, the term “tissue” refers to tissue of a living or deceased organism or any tissue derived from or designed to mimic a living or deceased organism
[0085] As used herein, the term “therapeutically effective amount” refers to a quantity sufficient to achieve a desired effect. In the context of therapeutic applications, the effective amount will depend on the type and severity of the condition at issue and the characteristics of the individual subject, such as general health, age, sex, body weight, and tolerance to pharmaceutical compositions. In the context of an immunogenic composition, in some embodiments the effective amount is the amount sufficient to result in breaking down a biofilm. In other embodiments, the effective amount of an immunogenic composition is the amount sufficient to result in antibody generation against the antigen. In some embodiments, the effective amount is the amount required to confer passive immunity on a subject in need thereof. With respect to immunogenic compositions, in some embodiments the effective amount will depend on the intended use, the degree of immunogenicity of a particular antigenic compound, and the health/responsiveness of the subject's immune system, in addition to the factors described above. The skilled artisan will be able to determine appropriate amounts depending on these and other factors. In the case of an in vitro application, in some embodiments the effective amount will depend on the size and nature of the application in question. It will also depend on the nature and sensitivity of the in vitro target and the methods in use. The skilled artisan will be able to determine the effective amount based on these and other considerations. The effective amount may comprise one or more administrations of a composition depending on the embodiment.
[0086] As used herein, the term “treating” or “treatment” includes preventing a disease, disorder or condition from occurring in a subject predisposed to or having a disease, disorder and/or condition; inhibiting the disease, disorder or condition, e.g., impeding its progress; and relieving or reversing the disease, disorder, or condition, e.g., causing regression of the disease, disorder and/or condition. Treating a disease or condition may also include ameliorating at least one symptom of the particular disease or condition. The term “hearing loss” refers to impairment in the ability to apprehend sound; thus, treatment thereof implies any one of the above listed effects on the ability to apprehend sound. The term “sensorineural hearing loss” refers to a specific type of hearing loss where there is damage to the inner ear or to the nerve pathways from the inner ear to the brain.
2. Modes of Carrying Out the Disclosure
[0087] Aspects of the disclosure relate to methods of treating hearing loss, optionally sensorineural hearing loss, and/or replacing, regenerating, or protecting hair cells through the application of one or more agents or compositions to a specified tissue or area of the ear.
[0088] Areas of the ear that may be treated based on the methods disclosed herein include but are not limited to the outer, middle, or inner ear regions thereof which are labeled in
Compositions
[0089] Aspects of the disclosure relate to a composition or an agent that decreases expression of a gene in a tissue of the inner ear and a second agent.
[0090] In some embodiments, the composition or agent that decreases expression of a gene in a tissue of the inner ear is an interfering nucleic acid, such as siRNA, shRNA, miRNA, antisense oligonucleotides (ASOs), and/or a nucleic acid comprising one or more modified nucleic acid residues. In some embodiments, the interfering nucleic acid is optimized (based on sequence) or chemically modified to minimize degradation prior to and/or upon delivery to the tissue of interest. Commercially available sources for these interfering nucleic acids include, but are not limited to, Thermo-Fisher Scientific/Ambion, Origene, Qiagen, Dharmacon, and Santa Cruz Biotechnology. In some embodiments, such optimizations and/or modifications may be made to assure that sufficient payload of the interfering nucleic acid is delivered to the tissue of interest. Other embodiments include the use of small molecules, aptamers, or oligonucleotides designed to decrease the expression of a gene by either binding to a gene's DNA to limit expression, e.g. antigene olignonucleotides, or impose post-transcriptional gene silencing (PTGS) through mechanisms that include, but are not limited to, binding directly to the targeted transcript or gene product or one or more other proteins in such a way that said gene's expression is reduced; or the use of other small molecule decoys that reduce the specific gene's expression. In some embodiments, the composition or agent that decreases expression of a gene in a tissue of the inner ear may include an inhibitor of the pathway by which the gene is regulated, e.g. a Notch signaling pathway inhibitor such as gamma secretase inhibitor (since transcription of, for example, Hes1 is mediated by Notch signaling).
[0091] In some embodiments, the gene is Hes1, Hes5, or MAPK1. Non-limiting exemplary sequences of these genes and siRNA sequences against them are provided in, for example, U.S. Pat. No. 9,101,647, the entirety of which is incorporated herein by reference in its entirety. Further non-limiting exemplary siRNA sequences are provided herein below, as SEQ ID NOs: 1-24 (the lower case letters in these sequences being optional; SEQ ID NO: 1-14, directed to Hes1; SEQ ID NO: 15-20, directed to Hes5; SEQ ID NO: 21-24, directed to MAPK1). Additional sequences may be determined according to methods known in the art, e.g. Fakhr et al. (2016) Cancer Gene Ther. 23 (4):73 -82.
TABLE-US-00004 Passenger Guide Location (nt #) strand strand RNAi Target Sequences for Murine Hes1 mRNA (accession # NM_008235.2; ORF: 235-1083) Molecule 1* 239-257 5′ CAGCUGAUAUA 3′ ttGUCGACUAU (within ORF) AUGGAGAAtt 3′ AUUACCUCUU 5′ (amino acids 2-8) Molecule 2 371-389 5′ GAAGGGCAAGA 3′ ttCUUCCCGUU (within ORF) AUAAAUGAtt 3′ CUUAUUUACU 5′ (amino acids 46-52) Molecule 3* 1363-1381 5′ GAUGCCAAAGA 3′ ttCUACGGUUU (3′ UTR) UGUUUGAAtt 3′ CUACAAACUU 5′ RNAi Target Sequences for Human Hes1 mRNA (accession # NM_005524.3, ORF: 240-1082) Molecule 4 302-320 5′ CAACACGACAC 3′ ttGUUGUGCUG (within ORF) CGGAUAAAtt 3′ UGGCCUAUUU 5′ (amino acids 21-27) Molecule 5* 1299-1317 5′ GGAUUGCGCCU 3′ ttCCUAACGCG (3′ UTR) UUGUAUUAtt 3′ GAAACAUAAU 5′ Molecule 6 1323-1341 5′ GCUCAGAUGAC 3′ ttCGAGUCUAC (3′ UTR) AUUUCGUUtt 3′ UGUAAAGCAA 5′ Molecule 7* 673-691 5′ ACUGCAUGACC 3′ ttGACGUACUG (within ORF) CAGAUCAA 3′ GGUCUAGUU 5′ (amino acids 145-151) RNAi Target Sequences for Murine Hes5 mRNA (accession # NM_010419.4, ORF: 74-577) Molecule 8 165-183 5′ GCAUCAACAGC 3′ ttCGUAGUUGU (within ORF) AGCAUAGAtt 3′ CGUCGUAUCU 5′ (amino acids 31-37) Molecule 9 726-744 5′ GGUCAUUCUUA 3′ ttCCAGUAAGA (3′ UTR) GAGAAUGUtt 3′ AUCUCUUACA 5′ Molecule 10 1141-1159 5′ CGAUGAUCCUU 3′ ttGCUACUAGG (3′ UTR) AAAGGAUUtt 3′ AAUUUCCUAA 5′ RNAi Target Sequences for Murine MAPK1 mRNA (accession # NM_011949.3, ORF: 246-1322) Molecule 11* 1082-1100 5′ UGCUGACUCCA 3′ ttACGACUGAG (within ORF) AAGCUCUGtt 3′ GUUUCGAGAC 5′ (amino acids 279-285) Molecule 12 962-980 5′ GGGUAUUCUUG 3′ GACCCAUAAGA (within ORF) GAUCUCCAtt 3′ ACCUAGAGGU 5′ (amino acids 239-245) *Molecules 1 and 3 have guide sequences that are complementary to conserved target sequences in mouse/human transcripts; the mRNA target sequence for Molecule 1 is conserved in mouse, rat, human, and guinea pig Hes1 transcripts. *Molecules 5 and 7 have guide sequences that are complementary to conserved target sequences in mouse/human transcripts; the mRNA target sequences for Molecules 5 and 7 are conserved in mouse, rat, human, and guinea pig HES1 transcripts. *Molecule 11 has guide sequences that are complementary to conserved target sequences in mouse/human transcripts; the mRNA target sequence for Molecule 11 is conserved in mouse, human, and guinea pig MAPK1 transcripts. Amino acid positions correspond to codons that are either partially or fully incorporated within mRNA locus bound by guide strand.
[0092] In some embodiments, the second agent is a priming composition. In some embodiments, the priming composition exhibits one or more functions selected from the group consisting of stabilizing β catenin, increasing the number of pluripotent cells in the inner ear, increasing plasticity of pre-existing pluripotent cells in the inner ear, or signaling differentiation in cells of the inner ear. In some embodiments, this second agent is a GSK-3 inhibitor. In further embodiments, the GSK-3 inhibitor is either 6-bromoindirubin-3′-oxime (BIO) or tideglusib (TIDE). In some embodiments, the second agent may comprise one or more ingredients, such as, but not limited to, the GSK-3 inhibitor and/or one or more factors involved in developmental signaling (e.g. basic fibroblast growth factor (FGF2 and/or FGF mimetics); non-limiting examples of this family are provided in, for example Katoh and Katoh (2006) Cancer Biol. Therapy 5(9):1059-1064, which is incorporated by reference in its entirety herein.
Formulations
[0093] In some embodiments, the composition that decreases expression of a gene in a tissue of the inner ear may include a formulation and/or particles, which in turn may comprise an agent that decreases expression of a gene in a tissue of the inner ear.
[0094] Non-limiting examples of such formulations and/or particles include a nanoparticle, lipofection, gel or hydrogel (e.g. Kechai et al. (2016) J Control Release. 226:248-57), nanoemulsion (e.g. U.S. Publication No. 2005/0288292), microparticle (e.g. Yang et al. (2012) Electrophoresis. 33(21):3173-80), colloidal suspension (e.g. Ariana et al. (2016) Otolaryngol Head Neck Surg. 154(5):917-9), sterile suspension (e.g. Ciprodex at http://www.ciprodex.com/), solution (e.g. Parra et al. (2002) Antimicrob Agents Chemother. 46(3):859-62.), aerosol (e.g. Li et al. (2013) IEEE Trans. Biomed. Eng. 60(9):2450-2460), powder (e.g. http://fauquierent.blogspot. com/2009/10/treatment-of-chronic-draining-ear.html#ixzz459wcRKOr), eardrop (e.g. Winterstein et al. (2013) Otolaryngol Head Neck Surg. 148(2):277-83), nanofiber (e.g. Akiyama et al. (2013) Int J Nanomedicine. 8: 2629-2640), or cream (e.g. Quadiderm® cream). All references cited herein above are incorporated by reference in their entirety.
[0095] In some embodiments, the formulations and/or particles are specifically adapted for delivery to the inner ear. For example, a gel formulation such as a thermo-reversible hydrogel (e.g. Pluronic F-127) allows for drugs to be maintained in the middle ear, in-contact with the round window membrane, such that the drug could diffuse or be transported into the inner ear. A colloidal suspension could likewise be formulated specifically for injection directly into the inner ear or across the tympanic membrane for diffusion or other means of transport through the round window membrane. Likewise, a nanoparticle or formulation comprising a plurality of nanoparticles can be formulated for controlled delivery, by way, for example, of magnetic force. Such a method can be generalized to microparticles and/or alternate nanoscale structures.
[0096] In some embodiments, the second agent may be comprised in the same or different formulation and/or particle from the agent that decreases expression of a gene in a tissue of the inner ear. In some embodiments, the second agent is in the same or different formulation and/or to facilitate the timing of its application to the target tissue—simultaneous or sequential relative to the particle the agent that decreases expression of a gene in the tissue of the inner ear. For example, for simultaneous delivery but sequential release, the second agent may be comprised in a solution that is administered along with a sustained release formulation and/or particle comprising the agent that decreases expression of a gene in the tissue of the inner ear. A similar effect may be achieved through the use of a single formulation and/or particle comprising both agents formulated for different release profiles for the different agents.
[0097] In some embodiments, a nanoparticle comprises or encapsulates an agent that decreases expression of a gene in a tissue of the inner ear. In some embodiments, the nanoparticle comprises a biodegradable polymer. In further embodiments, the biodegradable polymer is poly(lactic-co-glycolic acid) (PLGA) or pegylated PLGA (PEG-PLGA). In some embodiments, the nanoparticles may include further additives, including but not limited to polyvinyl alcohol (PVA) or other known nanoparticle stabilizers. In some embodiments, the nanoparticle is magnetically responsive or includes a magnetically responsive particle. In some embodiments, the magnetically responsive particle is iron oxide, optionally superpararmagnetic iron oxide (SPION). In some embodiments, the nanoparticle may be further comprised in a solution, suspension, gel, or other formulation suitable for its delivery.
[0098] In further embodiments, the same or a different nanoparticle may comprise or encapsulate the second agent. The nanoparticles disclosed herein above can be formed through water-in-oil emulsion or any other technique known in the art. Thus, a variety of options are available for generating nanoparticles comprising more than one agent, such as, but not limited to, dual core/shell loading (e.g. Narayan et al. (2014) Acta Biomaterialia. 2112-2124), co-encapsulation (e.g. Song et al. (2008) Eur J Pharm Biopharm. 69(2):445-53.), and layer by layer deposition (e.g. Deng et al. (2013) ACS Nano. 7(11):9571-9584). All references cited herein above are incorporated by reference in their entirety.
[0099] The nanoparticles may be formulated to facilitate timing of release, for example, a poorly water soluble second agent (e.g. TIDE) could be encapsulated in the organic shell of a nanoparticle loaded with the hydrophilic agent that decreases expression of a gene in the tissue of the inner ear (e.g. siHes1). As the second agent will be more accessible to water, it will be released first, followed by the sustained release of the agent that decreases expression of a gene in the tissue of the inner ear.
Modes of Administration
[0100] The above disclosed agents, compositions, formulations, and/or particles can be administered simultaneously or sequentially—with the second agent being administered before or after the agent that decreases expression of a gene in the tissue of the inner ear.
[0101] Dosing may be readily determined through methods known in the art. For example, an effective in vitro dose, e.g. between about 0.5 to 10 μM of the second agent (e.g. TIDE) and between about 20 to 320 nM of the agent that decreases expression of a gene in the tissue of the inner ear (e.g. siHes1), may be scaled up to the appropriate in vivo dose. A non-limiting exemplary in vivo dose of an agent that decreases expression of a gene in the tissue of the inner ear is between about 100 to 300 nM siHes1. In some embodiments, appropriate in vivo doses may be an amount between about 5 nM to 5 mM of the second agent (e.g. TIDE) and between about 1 nM to 5 mM of the agent that decreases expression of a gene in the tissue of the inner ear (e.g. siHes1). It is contemplated that an appropriate dose regiment may require one or more doses at appropriate intervals for each agent; these intervals may vary by agent or indication. Appropriate dosing intervals may be about one day, two days, three days, four days, five days, six days, one week, two weeks, three weeks, four weeks, five weeks, one month, two months, three months, or more.
[0102] In some embodiments, application and/or administration may be, for example, direct application, injection, or infusion of a specified agent or composition. In some embodiments, the specified agent or composition can be administered by direct injection through the round window membrane (RWM) or by infusion through a temporary or permanent cannula placed through the RWM. In some embodiments, the infusion or injection can be assisted through an attached microinfusion pump, dialysis apparatus, or fluid exchange system. In similar embodiments, injection or infusion technology could also be applied to the oval window, and/or the oval window ligament or annulus. The injections or infusion could further be accomplished through a cochleostomy or other opening into the boney labyrinth, such as one of the semicircular canals. Alternatively, the cortical bone could be removed over the labyrinth, and the specified agent or composition could be applied over the decorticated bone for intraosseous delivery. In some embodiments, the composition or agent is delivered systemically through intravenous or intraarterial administration.
[0103] The above listed routes of administration are by no means exhaustive. In general, there are a variety of means of delivery to the inner ear-that fall into two general categories: through an ostomy into the inner ear (where necessary, opened by drill, knife, or laser) and through diffusion through the RWM, the ligament of the stapes footplate or through an area of cochlear, or vestibular structure (typically where a region of bone was thinned to a thickness so that there is only the very thinnest of bone remaining separating the middle ear space form the inner ear endosteal lining and fluid).
[0104] In some embodiments, where an ostomy is used, the ostomy is conducted by machine or by hand. In some embodiments, the ostomy is through the footplate of the stapes, through an opening drilled into the cochlea, through an opening drilled into the semicircular canal, through the vestibular aqueduct, through a cochleostomy, through a direct opening into the RWM. In some embodiments, the ostomy is made for the insertion of an implant electrode; thus, one or more of the disclosed formulations, and/or particles may be bonded to the electrode surface to elute the one or more agents or compositions into the environment. In some embodiments, one or more openings subject to ostomy may be accessible for between about one day to about one week, two weeks, three weeks, four weeks, or a month, e.g. between about 1 to 30 days. In some embodiments, the ostomy is suited for a single injection or continuous infusion over the duration that the opening is accessible.
[0105] In some embodiments, where diffusion is employed, the agents, compositions, formulations, and/or particles allow diffusion across a particular membranous structure into the inner ear fluids. Non-limiting exemplary formulations include solution, gel, emulsion, or suspension. For example, a gel or pellet may be suited for the delivery of one or more agents, compositions, and/or particles disclosed herein above. A gel, for instance, may be placed transtympanically over the stapes and over the RWM and over the area of thinned bone to enhance delivery by increasing the surface area for delivery. Similarly, a solid or semi-solid pellet may be placed onto the stapes footplate, RWM or area of thinned bone as a means of enhancing drug contact with said membranes and keeping the drug from being removed from the middle ear space.
[0106] Not to be bound by theory, one of the challenges of a less invasive diffusion approach to delivering drugs to the inner ear fluids may be the small surface area of the RWM and the even smaller surface area of the ligament of the stapes footplate. In some embodiments, a procedure known in the art as “blue-lining” may resolve this issue. By “blue-lining,” the drilled-out area is extremely thinned out and just barely covers the endosteal membrane on the inner surface of the inner ear. This may greatly increase the surface area for absorption and may be less invasive than making an actual opening into the cochlea or other region of the inner ear. A skilled ear surgeon should be able to perform this procedure safely.
[0107] In some embodiments, delivery may be achieved in single or multiple injections across the tympanic membrane. In some embodiments, delivery may be achieved through single or multiple injections through a plastic tube inserted into the tympanic membrane. In some embodiments, delivery may be achieved through continuous infusion through a catheter, wherein its tip is placed directly on the area where diffusion is to occur.
Kits
[0108] Kits containing the agents and instructions necessary to perform the in vitro and in vivo methods as described herein also are claimed. Accordingly, the disclosure provides kits for performing these methods, which may include one or more agents, compositions, formulations, and/or particles disclosed herein as well as instructions for carrying out the methods disclosed herein, such as collecting tissue and/or performing the screen, and/or analyzing the results, and/or administration of an effective amount of an interfering agent as defined herein. These can be used alone or in combination with other suitable therapeutic agents.
Indications
[0109] In some embodiments, the formulations, compositions, methods, modes of administration, and kits disclosed herein may be used in the treatment of one or more indications. Non-limiting exemplary indications contemplated herein include sensorineural hearing loss resulting in loss of cochlear sensory hair cells resulting from loud noise, acoustic trauma, explosive blast, toxins, viral or bacterial infection, aging, genetic hearing loss involving the loss of sensory hair cells and metabolic conditions such as diabetes mellitus or hypothyroidism. Further non-limiting exemplary indications include balance disorders due to the loss or damage of sensory hair cells in the peripheral vestibular organ (cristae or maculae) due to toxins, trauma, viral or bacterial infection, aging, genetically induced balance sensory hair cell loss or metabolic conditions such as diabetes mellitus or hypothyroidism.
3. EXAMPLES
[0110] The following examples are non-limiting and illustrative of procedures which can be used in various instances in carrying the disclosure into effect. Additionally, all reference disclosed herein below are incorporated by reference in their entirety.
Example 1
Generation of siHes1 Nanoparticles and Assessment Thereof
[0111] Generation of Loaded Nanoparticles
[0112] The siRNA-loaded PLGA nanoparticles prepared for this study were formulated by the water-in-oil-in-water (w1/o/w2) double emulsion solvent evaporation method as previously reported (Cun et al. (2010) Intl. J. Pharmaceutics 390:70-75; Du et al. (2013) Hear. Res. 304C:91-110). Briefly, siRNA was dissolved in 50 μL of TE buffer (10 mM Tris—HCl and 1 mM EDTA in MilliQ water, pH 7.5) and was mixed with 100 mL dichloromethane (DCM) containing 100 mg of PLGA, and the mixture was emulsified by sonication into a primary w1/o emulsion. Four milliliters of 5% (w/v) polyvinyl alcohol (PVA) in MilliQ water was poured directly into the primary emulsion prior to further emulsification by sonication for 30 sec×3 to form a w1/o/w2 double emulsion. The resulting emulsion was diluted with 50 mL of 0.3% (w/v) PVA in MilliQ water and stirred magnetically for 2 h at room temperature to evaporate the DCM. The PLGA nanoparticles were collected by ultracentrifugation at 13,000× g for 20 min at 4° C., washed thrice with MilliQ water, resuspended in 5 mL of MilliQ water, and freeze-dried (at −100° C. and under 40 mTorr). The optimum formula of siRNA-loaded NPs was made from 15 nmol of siRNA, 100 mg of PLGA, and 5% PVA. The resulting NPs were characterized for particle mean diameter (PMD), polydispersity index (PDI), percent drug encapsulation efficiency (EE %), and morphology, using dynamic light scattering (Zetasizer Nano ZS, Malvern, Instruments Ltd, Worcestershire, UK), UV-Vis Spectrophotometer (nanoDrop 2000, Thermo Scientific, Waltham, MA), and scanning electron microscopy (Zeiss Supra 55, VP, FE-SEM, Oberkochen, Germany), respectively. The synthesized NPs are generally stored at −80° C. until time of use.
[0113] In Vitro Nanoparticle Studies
[0114] Neonatal (P3) murine organs of Corti (OCs) were exposed to the ototoxin, 4-hydroxyl-2-nonenal (4-HNE, 450 μM) for 24 h and then either left untreated or were treated with either non-targeting scrambled RNA NPs (scRNANP) or Hes1 siRNA-loaded PLGA NPs (Hes1 siRNANP), and after 7 days, tissues were fixed and labeled with fluorophore-conjugated phalloidin (
[0115] Alternatively, the experiment was conducted in the same manner as above, using the ototoxic aminoglycoside, neomycin (NEO, 0.75 mM), with subsequent therapeutic application of Hes1 siRNA-loaded PLGA NPs, tissue fixation, and affinity labeled with both an antibody against the hair cell marker, myosin VIIa (Myo7a) and fluorophore-conjugated phalloidin to facilitate immunofluorescence-mediated quantification of HCs along the length of the cochlear spiral (
[0116] In Vivo Nanoparticle Studies
[0117] Adult pigmented guinea pigs (250 g, 4-wk-old) were exposed to an acoustic overexposure centered at 4 kHz at 130 dB SPL for two hours. Seventy-two (72) hours after the injury (i.e. a delayed treatment), mini-osmotic pumps loaded with 800 μg/mL of either non-targeting scrambled RNA NPs or siHES1 NPs were surgically implanted into the basal turn of the cochlea (cochleostomy), and the sham or therapeutic treatments were unilaterally-infused into the cochleae over the course of seven days, after which the pumps were surgically removed. Auditory brainstem response (ABR) measurements at 2, 4, 8, and 16 kHz were conducted prior to the acoustic injury and at 24 hours, 2 weeks, 4 weeks, 8 weeks, and 10 weeks post-injury. After the terminal 10-week ABR recording session, animals were euthanized and cochlear tissues were fixed, micro-dissected, and immunolabeled with markers for visualization and quantification of HCs. Cochleae from siHES1 NP-treated, noise-exposed guinea pigs exhibited a marked restoration of both inner and outer HC numbers relative to cochleae from noise-exposed guinea pigs treated with non-targeting scRNA NPs (
[0118] Mature C57BL/6 mice (4-wk-old) were exposed to an acoustic overexposure (8-16 kHz octave band noise, 116 dB SPL) for two hours. Seventy-two hours after the injury, mini-osmotic pumps loaded with 800 μg/mL of siHES1 NPs were surgically implanted into posterior semicircular canal, and the therapeutic treatment was unilaterally-infused over the course of seven days, after which the pumps were surgically removed. Eight-weeks post-treatment, animals were euthanized and cochlear tissues were fixed, micro-dissected, and immunolabeled with anti-Myo7a for visualization and quantification of HCs. Cochleae from siHES1 NP-treated, noise-exposed mice exhibited a marked restoration of both inner and outer HC numbers (in architecturally-correct positions) relative to cochleae from noise-exposed controls (
[0119] In Vitro Drug Release Studies
[0120] In vitro drug release study from Hes1 siRNA-loaded PLGA NPs was performed in triplicate using a dialysis method adapted from Wangemann P, Schacht J, Dallos P, Popper A N, Fay R R (Eds.), The Cochlea, Springer, New York, 1996, pp. 130-185. Specifically, 1 mg of powdered PLGA NPs containing Hes1 siRNA or encapsulated (free) Hes1 siRNA were suspended in an inner dialysis bag (Spectra/Por Float-A-Lyzer G2, MWCO 20 kDa, Spectrum Laboratories Inc., Rancho Dominguez, CA) containing 1 mL of simulated perilymph media (SPM) without protein. The bag containing the colloidal suspension was placed in 3 ml of simulated endolymph media (SEM). The system was placed in a horizontal water bath (VWR Scientific Water Bath Model 1211, Sheldon Manufactuing Inc., Cornelius, OR) at 37° C. Three 10 μL aliquots of SEM were withdrawn at specified time intervals and replaced with 304, of fresh SEM to maintain sink conditions. The average percent drug release (% ±Standard Deviation) was calculated at each time point interval (1-10 days).
TABLE-US-00005 Loading efficiency of Inoculum siRNA (pmo/mg NP) (pmol of siRNA) Free siHES1 — 150 siHES1-NPs#1 35 35 siHES1-NPs#2 150 150
[0121] Release kinetics of siRNA from PGLA nanoparticles can be determined using the following equations known in the art:
[0122] Zero Order:
Q.sub.t=Q.sub.0+K.sub.0t
[0123] (the drug release rate is independent of its concentration of the dissolved substance.)
[0124] First Order:
Log Q.sub.t=Log Q.sub.0+Kt/2.303
[0125] (the drug release rate depends on its concentration)
[0126] Hixson-Crowell:
3√{square root over (Q.sub.0)}−3√{square root over (Q.sub.t)}=K.sub.HC×t
[0127] (the drug is released by dissolution)
[0128] Higuchi:
Q.sub.t=K.sub.Ht.sup.1/2
[0129] (the drug is released by diffusion)
[0130] Korsmeyer-Peppas:
F=(M.sub.t/M)=K.sub.mt.sup.n
[0131] (n=0.50 indicates fickian diffusion 0.5<n<0.89 indicates anomalous diffusion or non-Fickian diffusion: combination of both diffusion and erosion controlled rate release.
[0132] If n≧0.89 indicates case-2 relaxation or super case transport-2: erosion of the polymeric chain.)
TABLE-US-00006 zero order First order Hixson-Crowell Higuchi Korsmeyer-Peppas k.sub.0 R.sup.2 K R.sup.2 K.sub.HC R.sup.2 K.sub.H R.sup.2 n R.sup.2 Free siRNA 0.077 0.97 −0.062 0.40 0.015 0.91 5.068 0.99 0.50 0.99 Free HES1 siRNA is released by diffusion, not dependent on its dissolved concentration NP1 0.103 0.92 −0.005 0.97 0.006 0.95 3.436 0.89 0.94 0.96 HES1 siRNA in NPs is released by dissolution and polymer erosion, release is concentration-dependent NP2 0.089 0.94 −0.007 0.99 0.008 0.99 3.903 0.91 0.97 0.94 HES1 siRNA in NPs is released by dissolution and polymer erosion, release is concentration-dependent
[0133] The release profile of the free Hes1 siRNA fit well with the zero order model (R.sup.2=0.97) (
[0134] In contrast to the free Hes1 siRNA, the release profile of Hes1 siRNA encapsulated within PLGA NPs revealed a sustained release profile fit with first order (R.sup.2=0.97), Hixson-Crowell (R.sup.2=0.95) and Korsmeyer-Peppas (R.sup.2=0.96, n=0.94) equations (See Figure). This diffusion pattern indicated that the release was mainly governed by dissolution of Hes1 siRNA through the delayed hydrolytic degradation of the polymeric shell (PLGA) of the NPs. Moreover, the dissolution of Hes1 siRNA was accompanied with the erosion of the polymeric chain of PLGA.
[0135] Pairwise comparison of the release profile of siRNA from NP suspension 1 (NP1) and NP suspension 2 (NP2) indicated that the release rate was increased with increased siRNA loading in the NP (percent release rate: 5.9 vs 6.3%/day, respectively). This indicated that the drug release rate was dependent on the amount of the soluble siRNA in the external SEM. The low initial burst release of Hes1 siRNA (˜5%, 1 day) for both NP formulations is interpreted to be due to the presence of siRNA adsorbed on the surface of the NPs.
[0136] For free siRNA, it required 4.2 days to release 50% of the initial loading in this drug release model system. For NP1 it required 7.8 days to release 50% of the initial loading. For NP2 it required 6.2 days to release 50% of the initial loading.
Example 2
BIO and Hes1 siRNA
[0137] Undamaged OCs
[0138] Organotypic cultures from murine cochleae were cultured and then harvested on postnatal day 3 (P3) from CD1 mice. These explants were then cultured in appropriate media for twenty-four hours. On the equivalent of P4 (i.e. 24 h ex vivo), cultured organs of Corti (OCs, i.e. cochlear sensory epithelia) were bathed in fresh culture media containing either DMSO (vehicle) or the GSK3 inhibitor, 6-bromoindirubin-3′-oxime (BIO), and the OCs were cultured accordingly for 72 h. On the equivalent of P7 (i.e. 96 h ex vivo), a subset of cultures from both treatment groups are transfected (jetSI 10 mM, PolyPlus Transfection, Illkirch, France) with 20 nM Hes1 siRNA for 24 h. For examining the effects of sequential application, siHes1 was transfected in media without BIO. For examining the effects of simultaneous application, siHes1 was transfected in media containing BIO. Following the 24 h transfection incubation period, cultures designated for the examination of sequential treatment of the two agents were cultured in media without BIO, whereas cultures designated for simultaneous application were cultured in the presence of BIO for an additional 48 h. All cultures were maintained in media without either of the test agents for a final 24 h, after which tissues were fixed in 4% paraformaldehyde solution and subjected to immunolabeling with an antibody against the hair cell marker, myosin VIIa (Myo7a), and an appropriate secondary antibody for subsequent immunofluorescence-mediated quantification of HCs along the length of the cochlear spiral (
[0139] NEO Damaged Utricles
[0140] Organotypic cultures from murine utricular maculae (balance organ sensory epithelia) were cultured and then harvested on postnatal day 3 (P3) from CD1 mice. These explants were then cultured in appropriate media for twenty-four hours. On the equivalent of P4 (i.e. 24 h ex vivo), cultured utricles were bathed in fresh culture media containing the ototoxic aminoglycoside neomycin (NEO) for 24 h to induce HC loss and then administered the either DMSO (vehicle) or the GSK3 inhibitor, 6-bromoindirubin-3′-oxime (BIO, 2.5 μM) on P5. The utricles were cultured accordingly for 72 h. On the equivalent of P8 (i.e. 120 h ex vivo), cultures were replaced with fresh media without therapeutics and a subset of cultures from both treatment groups were transfected (jetSI 10 mM, PolyPlus Transfection, Illkirch, France) with 20 nM Hes1 siRNA or incubated in the presence of 5 μM of the Notch Pathway inhibitor, LY411575, and cultured for an additional 72 h. All cultures were then maintained in media without either of the test agents for a final 24 h, after which tissues were fixed in 4% paraformaldehyde solution and subjected to immunolabeling with an antibody against the hair cell marker, myosin VIIa (Myo7a), and an appropriate secondary antibody for subsequent immunofluorescence-mediated quantification of HCs along the length of the cochlear spiral (
[0141] In all cases, BIO/siHes1 generates greater numbers of de novo HCs than either agent alone and sequential treatment will induce a more robust response than simultaneous treatment. These results are consistent with sequential application resulting in a greater transdifferentiative response (i.e. more de novo hair cells), particularly in the mid-basal turn of the OC and extrastriolar regions of the utricule, regions that are typically recalcitrant to new HC production in postnatal cochleae and utricular maculae (
Example 3
TIDE and Hes1 siRNA
[0142] Analysis of Tideglusib
[0143] Tideglusib was procured from Cayman Chemical Company and performed a dose curve analysis under serum starvation conditions with Madin-Darby Canine Kidney (MDCK) cells in parallel with a series of commercially-available GSK3 inhibitors to ascertain its relative proliferative potential under mitotically-suppressed conditions in this well-established mammalian epithelial cell line. In these experiments, MDCK cells were cultured under serum starvation conditions for 24 hours prior to culturing cells for 48 hours in the presence of GSK3 inhibitors and 10 μM EdU (5-ethynyl-2′-deoxyuridine), a nucleoside analog that permanently marks cells that have undergone DNA replication.
[0144] An example of this type of analysis is depicted in
[0145] Formal quantification of EdU-positive nuclei in each of the treatment groups from this screen is depicted in
[0146] A targeted pilot experiment was conducted in which postnatal OCs were cultured continuously for 72 hours in the presence of EdU and either tideglusib or vehicle alone to assess whether the GSK3 inhibitor was capable of inducing a mitotic response in the sensory epithelial region of the OC. As shown in
[0147] Undamaged and NEO Damaged OCs
[0148] The protocol described above for BIO is used, substituting the addition of BIO for 10.0 μM Tideglusib (TIDE). A third treatment group is added, where Tideglusib is included in the culture medium after siHes1 , parallel to the other protocols: on P4 or P5 (depending on whether there was an ototoxic insult to simulate hair cell loss) the control media is added with or without the inclusion of 10.0 μM TIDE; on P7 siHes1 is added in the presence of absence of TIDE; and on P9 10.0 μM Tideglusib is included in the media for a subset of cultures. On P11, all media is replaced with fresh media without any therapeutics. On P12, the tissues are fixed for immunolabeling. An example of comparative analyses from this treatment paradigm, following an exposure to the ototoxic aminoglycoside, NEO, is depicted in
TABLE-US-00007 Hair Cell Counts ± SEM Experimental Group Mid-apical turn Middle Turn Normal Control 57.0 ± 2.2 52.9 ± 1.6 NEO alone 5.1 ± 1.1 2.5 ± 0.8 NEO + TIDE 9.1 ± 1.6 2.8 ± 0.8 NEO + siHES1 13.0 ± 1.7 13.9 ± 1.1 NEO + TIDE then siHES1 37.5 ± 2.5 24.9 ± 3.4 NEO + TIDE and siHES1 26.0 ± 5.4 13.4 ± 2.5 NEO + siHES1 then TIDE 21.6 ± 2.2 13.0 ± 1.7
[0149] The experiment was repeated using the staged application of TIDE and siHES1 described above, the results from which underscore the significant enhancement of siHES1 efficacy for restoring HC numbers following pre-application of TIDE in a manner that indicates synergism between the agents (
[0150] This experimental paradigm was again repeated adding additional treatment groups where FGF-2 was optionally included in the culture medium at 2 ng/mL at P5, P7, and P9 for a subset of cultures. Greater HC numbers were observed in both the mid-apical and middle turns of the OC in cultures treated with a staged combination of TIDE and siHES1, while the addition of FGF-2 (which did not elicit a therapeutic response on its own at this concentration) to the growth media potentiated the therapeutic effects of TIDE/siHES1 treatment through the mid-basal turn of the OC, an area that is typically more recalcitrant to HC regeneration in the postnatal mammalian cochlea (
Example 4
Further Nanoparticle Experiments
[0151] A subset of Experiments 2 and/or 3 are repeated using siHes1 loaded nanoparticles—sustained release formulations—and TIDE at various doses, as well as using nanoparticles comprising both siHes1 and TIDE.
[0152] In some replications of the protocol, co-application of a sustained release siHes1 nanoparticle and TIDE is conducted in a manner designed to mimic staged application of TIDE and siHes1 lipofection complexes. Mimicry is achieved using the neomycin protocol described in Experiments 2 and 3 adding TIDE (in some replications at escalating doses between 0.5 and 20 p.m) and sustained release siHes1 nanoparticles applied simultaneously.
[0153] Further, all the above referenced experiments are repeated with siHes5 and siMAPK1.
[0154] An Exemplary Protocol Follows
[0155] Applicants hypothesized that the delayed, yet sustained, release of siHes1 from biocompatible PLGA NPs would recapitulate the therapeutic attributes of staged application of a GSK3 inhibitor and siRNA against Hes1 when the two drugs were co-administered. To test this hypothesis, a sub-maximal efficacious dose (60 nM) of siHes1 NPs with escalating doses (0.5, 2, and 10 μM) of the GSK3I, tideglusib, in order to have sufficient experimental margin were used to assess a regenerative dose-response profile in organotypic cultures of neomycin (NEO)-exposed organs of Corti (OCs). Using this paradigm, NEO-ablated OCs were subsequently cultured with siHes1 NPs alone or in combination with Tideglusib over the course of six days prior to fixation and immunohistological analyses.
[0156] As shown in
[0157] Quantification of HCs numbers among these treatment groups revealed that the clinically-relevant GSK3 inhibitor, Tideglusib, promoted statistically-significant increases (relative to siHes1 NPs alone) in siHes1 NP regenerative efficacy at a concentration of 10 μM in the middle turn and at concentrations of 2 and 10 μM in the basal turn of the OC. In the mid-apical region, where the siHes1 NP regenerative response was consistently highest, no statistically-significant differences between the treatment groups could be assigned. Due to the lack of a regenerative response induced by Tideglusib alone, the enhanced therapeutic effect induced by this combinatorial treatment strategy can be described as synergistic with respect to therapeutic increases in HC numbers.
Example 5
Additional Nanoparticle Experiments
[0158] siHes1(Molecule #1)-loaded poly(lactic-co-glycolic acid) (PLGA) or polyethylene glycol-PLGA nanoparticles (PEG-PLGA NPs) were prepared by the water-in-oil-in-water (w/o/w) double emulsion solvent evaporation method with a slight modification, as previously reported. McCall and Sirianni (2013) J Vis Exp. 82: 51015; doi: 10.3791/51015.
[0159] Briefly, a volume of siHes1 aqueous solution (100 μL) was dropped in 1,000 μL of dichloromethane (DCM) containing 100 mg of PLGA for PLGA NPs or 50 mg of PLGA and 50 mg of PEG-PLGA for PEG-PLGA NPs (Table 1).
[0160] The mixture was emulsified by sonication (10 sec, 25W) (Microson ultrasonic cell disruptor XL Misonix Inc., Farmingdale, N.Y.) into a primary w.sub.1/o emulsion. For PLGA NPs, the primary emulsion was diluted in 4 ml aqueous 5% PVA. The resulting secondary emulsion was diluted in 50 mL of 0.3% (w/v) (PLGA NPs) or 0.125% PVA (w/v) (PEG-PLGA NPs) in MilliQ water (Millipore Co., Billerica, Mass.) and magnetically stirred for two hours at room temperature (RO 10, IKA-Werke Gmbh & Co, Staufen, Germany) to evaporate the DCM. PEG-PLGA NPs were collected by ultracentrifugation at 13,000 g for 20 min at 10° C. (TOMY MX-201 Highspeed Refrigerated Microcentrifuge), washed thrice with MilliQ water to remove the excess of solvent (DCM) and residual PVA, then resuspended in 5 mL of MilliQ water in a sterile glass container, and freeze-dried at −100° C. under 40 mTorr (Virtis Benchtop freeze-dryer, Gardiner, N.Y.) for three consecutive days.
[0161] The obtained powdered NPs were sterilized under UV for 20-30 min and stored at −80° C. until further use.
TABLE-US-00008 TABLE 1 Formulation parameters of siHes1-loaded nanoparticles. PLGA (mg) PEG-PLGA (mg) PVA (%) siHes1-PLGA NPs 100 0 5 siHes1-PEG-PLGA NPs 50 50 0.125
[0162] siHes1-loaded PEGylated PLGA NPs (Table 2) were smaller (i.e. reduced particle mean diameters [PMD]) and less negatively charged (i.e. increased zeta potentials [ZP]) than the standard PLGA formulation. The amount of siHes1 (pmol/mg) loaded into the PEG-PLGA nanoparticle formulation was proportionally reduced with the decreased size of the nanocarrier relative to the PLGA formulation.
TABLE-US-00009 TABLE 2 Comparative physicochemical properties of representative formulations of Hes1 siRNA-loaded PLGA and PEG- PLGA NPs synthesized in parallel. siHes1 Loading Formulation PMD (nm) ZP (mV) (pmol/mg) siHes1-PLGA NPs 325.4 ± 8.3 −31.9 ± 3.5 143.9 ± 1.1 siHes1-PEG-PLGA NPs 182.5 ± 19.2 −13.6 ± 3.3 82.02 ± 0.7
[0163] Based on their size and physicochemical properties, we hypothesized that siRNA-loaded PEG-PLGA NPs would be readily endocytosed by inner ear cells. In order to evaluate this hypothesis and compare uptake of siRNA-loaded PEG-PLGA NPs relative to PLGA NPs in inner ear cells, fluorescein (FAM)-conjugated non-targeting siRNA mimetics (scrambled RNA, scRNA) duplexes were encapsulated within AlexFluor 555-conjugated PEG-PLGA and PLGA NP formulations, using the same synthesis methodology as that employed for synthesizing siHes1 NPs. Prior to synthesis, the conjugation of Alexa Fluor 555 (AF555, MW: 1.25 kDa, Thermofisher, Rockford, Ill.) with PLGA (MW: 15 kDa) (Polymers Material Inc., Montréal, Canada) was performed using carbodiimide coupling reaction Chan et al. (2010) Methods Mol Biol. 624:163-75. Equimolar amounts of PLGA and AF555 were mixed and stirred overnight at room temperature. The unreacted components were removed by dialysis (Spectra/por Float-A-Lyzer G2, MWCO 3.5-5 kDa Spectrum Laboratories Inc. Rancho Dominguez, Calif.) against deionized water (Direct-Q 3 UV system, Millipore SAS, Molsheim, France), at room temperature for 3h. The purified suspension containing PLGA conjugated AF555 was recovered in purified water and centrifugated at 15,000 rpm for 30 min at 8° C. Post-synthesis, the resultant FAM-scRNA-loaded AlexaFluor555 PLGA or PEG-PLGA NPs (henceforth referred to as Dual Fluor NPS) were comparable in size, charge, and residual PVA content, as siHes1-loaded NPs, indicating that they were competent for serving as viable surrogates for the siHes1 nanocarrier formulations (Table 3).
TABLE-US-00010 TABLE 3 Comparative physicochemical properties of representative formulations of dual fluorophore-labeled non-targeting siRNA- loaded PLGA and PEG-PLGA NPs synthesized in parallel. Formulation PMD (nm) Zeta potential (mV) Dual Fluor-PLGA NPs 267.37 ± 14.8 −36.6 Dual Fluor-PEG-PLGA NPs 184.88 ± 7.4 −11.7
[0164] The cellular uptake of Dual Fluor PLGA and PEG-PLGA NPs were examined in the IMO-2b1 murine inner ear cell following a 24 h incubation at 33° C., 5% CO.sub.2, using a combination of ultraviolet spectrometry-spectrometry (UV-spec) and confocal microscopy.
[0165] For UV-spec, cells were seeded in 96-well plates and cultured in a complete growth medium to reach 70% confluence. After 24 h, cells were incubated with 200, 400, 800 μg/mL at 33° C., 5% CO.sub.2 for 24 h. After three-step washing with PBS solution, the extracellular fluorescence was quenched with 50 μl of 0.2%Trypan Blue for 1-5 min (Gibco, BRL, Grand Island, N.Y.) (Hed J. Methods for distinguishing ingested from adhering particles. Methods Enzymol. 1986;132:198-204). Internalized fluorescent intensity was determined using a microplate reader (Beckman Coulter DTX 880 Multimode Detector, Brea, Calif.) at emission wavelength of 485±20 nm and excitation of 525±25 nm for FAM scRNA and at emission wavelength of 555±20 nm and excitation of 572±25 nm for AF555 PLGA. Positive control (PC) wells in which the unwashed fluorescence of the incubated NP suspensions prior to media evacuation were used to establish the 100% fluorescence for each reference standard. Normal control (NC) wells of cells that were not incubated with Dual Fluor NP formulations were used as the background control. Microplate reader evaluations of NP uptake demonstrated that, at doses of 400 and 800 μg/mL, the PEG-PLGA NPs exhibited superior internalization relative to PLGA NPs (
[0166] Confocal microscopy of IMO-2b1 fixed cells following a 24 h incubation with fluorophore-labeled NPs confirmed both formulations were internalized within cells in a dose-dependent manner (
[0167] To evaluate potential cytotoxic effects of the siHes/-loaded PEG-PLGA NP formulation, IMO-2b1 cells were incubated with either PLGA or PEG-PLGA formulations for 48 h prior to conducting a 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay to assess cell viability. The MTT assay is a colorimetric method for objectively quantitating cell metabolic capacity by measuring NAD(P)H-dependent cellular oxidoreductase activity via reduction of a yellow tetrazolium dye, MTT, into its insoluble purple product, formazan. As such, the relative cytotoxic effects of a drug under evaluation can be discerned by comparing the amount of total formazan product formed in the test wells with the corresponding amount formed in control wells of untreated cells. Using this method, dose escalations up to 800 μg/mL (˜66 nM siRNA equivalents) of siHes1-loaded PEG-PLGA NPs were well-tolerated by IMO-2b1 cells following a 48 h exposure (
[0168] To test the relative silencing efficiency of the siHes1 biomolecule (Molecule #1) encapsulated within PEG-PLGA NPs, dose escalations of either siRNA-loaded PLGA and PEG-PLGA NPs were cultured with sub-confluent wells of IMO-2B1 cells, such that pair-wise dosing controlled for total siRNA in each well (28.8, 57.6, 115.2 nM siRNA equivalents). Seventy-two hours after initiation of NP treatment, total RNA was isolated and subjected to RT-qPCR analyses, using primers against Hes1 and the house keeping gene GAPDH. Relative Hes1 levels were determined by the 2.sup.−ΔΔCT method. See Livak and Schmittgen (2001)Methods 25(4):402-8.
[0169] Consistent with its apparent enhanced uptake efficiency and functionally-optimal perinuclear accumulation pattern, PEG-PLGA NPs loaded with siHes1 (Molecule #1) elicited a more pronounced silencing effect on Hes1 expression at low-dose equivalents than did PLGA NPs (
[0170] Targeted comparisons of siHes1 KD efficiency in IMO-2b1 at the protein level (96 h post-exposure) mirrored the results obtained from measurements of Hes1 at the transcript level (72 h post-exposure) (
Example 6
Duration of Administration Experiments
[0171] Duration of therapeutic dosing of siHes1 NPs was tested in follow-up experimentation by limiting administration to only one day (24 h), initiated 72 h post-deafening. As seen in
[0172] Similar experiments are repeated with the combination therapies described herein.