HIGH CONCENTRATION ANTI-Abeta PROTOFIBRIL ANTIBODY FORMULATIONS AND METHODS OF USE THEREOF
20230183328 · 2023-06-15
Inventors
- Nobuo YOSHIDA (Tokyo, JP)
- Naomi SAKURAMOTO (Gifu, JP)
- Takahisa SAKAGUCHI (Gifu, JP)
- Hirokazu KITO (Gifu, JP)
- Takahiro OZAWA (Gifu, JP)
- Anjali JOSHI (Cary, NC, US)
- Yung Yueh HSU (Carlisle, MA, US)
- Pierre SOUILLAC (Winchester, MA, US)
Cpc classification
A61K9/0019
HUMAN NECESSITIES
A61P25/28
HUMAN NECESSITIES
International classification
Abstract
Provided herein are aqueous pharmaceutical formulations comprising high concentrations of anisolated anti-Aβ protofibril antibody or a fragment thereof that binds to human Aβ protofibrils, such as BAN2401, arginine, polysorbate 80, and a pharmaceutically acceptable buffer.
Claims
1. An aqueous pharmaceutical formulation comprising: (a) an isolated anti-Aβ protofibril antibody or fragment thereof that binds to human Aβ protofibrils, at a concentration of 80 mg/mL to 300 mg/mL, (b) 100 mM to 400 mM arginine, (c) 0.01% w/v to 0.1% w/v polysorbate 80, and (d) a pharmaceutically acceptable buffer, wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5, wherein the isolated anti-Aβ protofibril antibody or fragment thereof comprises: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, and wherein the arginine is arginine, arginine hydrochloride, or a combination thereof.
2. The pharmaceutical formulation according to claim 1, wherein the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 100 mg/mL to 200 mg/mL.
3. The pharmaceutical formulation according to claim 1, wherein the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 100 mg/mL.
4. The pharmaceutical formulation according to claim 1, wherein the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 200 mg/mL.
5. The pharmaceutical formulation according to claim 1, further comprising methionine.
6. The pharmaceutical formulation according to claim 1, wherein the pharmaceutically acceptable buffer is citrate buffer or histidine buffer.
7. The pharmaceutical formulation according to claim 1, comprising 10 to 100 mM citrate buffer or 10 to 100 mM histidine buffer.
8. The pharmaceutical formulation according to claim 1, comprising 125 to 350 mM arginine.
9. The pharmaceutical formulation according to claim 1, comprising 200 mM arginine, wherein the arginine is arginine hydrochloride.
10. The pharmaceutical formulation according to claim 1, comprising 200 mM arginine, wherein the arginine is arginine hydrochloride, and 25 mM histidine buffer.
11. An aqueous pharmaceutical formulation comprising: (a) 80 mg/mL to 240 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, (b) 140 mM to 260 mM arginine hydrochloride, (c) 0.02% w/v to 0.08% w/v polysorbate 80, and (d) 15 mM to 35 mM histidine buffer, wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
12. An aqueous pharmaceutical formulation comprising: (a) 80 mg/mL to 120 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, (b) 240 mM to 360 mM arginine, (c) 0.02% w/v to 0.08% w/v polysorbate 80, and (d) 30 mM to 50 mM citrate buffer, wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5, and wherein the arginine is arginine, arginine hydrochloride, or a combination thereof.
13. A method of reducing aggregate formation of an isolated anti-Aβ protofibril antibody or fragment thereof, comprising: providing an aqueous pharmaceutical formulation comprising an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2 at a concentration of 80 mg/ml to 300 mg/ml, and adding arginine, arginine hydrochloride, or a combination thereof to said aqueous pharmaceutical formulation, wherein the pH of the pharmaceutical formulation ranges from 4.5 to 5.5.
14. The method according to claim 13, wherein the arginine, arginine hydrochloride, or combination thereof is present in a concentration of 150 to 250 mM.
15. The method according to claim 14, wherein the arginine, arginine hydrochloride, or combination thereof is present in a concentration of 200 mM.
16. The method according to claim 13, wherein the pharmaceutical formulation further comprises a pharmaceutically acceptable buffer.
17. The method according to claim 16, wherein the pharmaceutically acceptable buffer is histidine buffer or citrate buffer.
18. A method of reducing fragmentation of an isolated anti-Aβ protofibril antibody or fragment thereof, comprising: providing an aqueous pharmaceutical formulation comprising an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2 at a concentration of 80 mg/ml to 300 mg/ml, and adding histidine buffer to said aqueous pharmaceutical composition, wherein the pH of the pharmaceutical formulation ranges from 4.5 to 5.5.
19. The method according to claim 18, comprising 15 to 35 mM histidine buffer.
20. The method according to claim 13, wherein the pharmaceutical formulation further comprises 0.01% w/v to 0.1% w/v polysorbate 80.
21. The method according to claim 18, wherein the pharmaceutical formulation further comprises 0.01% w/v to 0.1% w/v polysorbate 80.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
DEFINITIONS
[0062] The following are definitions of terms used in the present application.
[0063] As used herein, the singular terms “a,” “an,” and “the” include the plural reference unless the context clearly indicates otherwise.
[0064] The phrase “and/or,” as used herein, means “either or both” of the elements so conjoined, i.e., elements that are conjunctively present in some cases and disjunctively present in other cases. Thus, as a non-limiting example, “A and/or B,” when used in conjunction with open-ended language such as “comprising” can refer, in some embodiments, to A only (optionally including elements other than B); in other embodiments, to B only (optionally including elements other than A); in yet other embodiments, to both A and B (optionally including other elements); etc.
[0065] As used herein, “at least one” means one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements. This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase “at least one” refers, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, “at least one of A and B” (or, equivalently, “at least one of A or B,” or, equivalently “at least one of A and/or B”) can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
[0066] When a number is recited, either alone or as part of a numerical range, it should be understood that the numerical value can vary above and below the stated value by a variance that is reasonable for the value described, as recognized by one of skill in the art.
[0067] As used herein, a “fragment” of an antibody comprises a portion of the antibody, for example comprising an antigen-binding or a variable region thereof. Non-limiting examples of fragments include Fab fragments, Fab′ fragments, F(ab′)2 fragments, Fv fragments, diabodies, linear antibodies, and single-chain antibody molecules.
[0068] As used herein, “fragmentation” or “fragment formation” refers to degradation of an antibody or fragment thereof when it is in or added to a formulation. A fragment generated by the fragmentation or the fragment formation may or may not be capable of binding to the antigen to which the antibody or fragment thereof binds.
[0069] As used herein “histidine buffer” may comprise histidine, histidine hydrochloride, or a combination thereof, wherein histidine hydrochloride may be histidine hydrochloride monohydrate.
[0070] As used herein “citrate buffer” may comprise citric acid, its salts, or a combination thereof, wherein citric acid may be citric acid monohydrate or anhydrous citric acid.
NON-LIMITING EMBODIMENTS OF THE DISCLOSURE
[0071] Certain embodiments of the present disclosure relate to aqueous pharmaceutical formulations.
[0072] In some embodiments, an aqueous pharmaceutical formulation is provided comprising: [0073] (a) an isolated anti-Aβ protofibril antibody or fragment thereof comprising (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) and a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, at a concentration of 80-300 mg/ml; and [0074] (b) 100 mM to 400 mM arginine, wherein the arginine is arginine, arginine hydrochloride, or a combination thereof, optionally comprising any one or more of the following: [0075] a. 0.01% w/v to 0.1% w/v polysorbate 80; [0076] b. a pharmaceutically acceptable buffer, optionally wherein the buffer is a histidine buffer or citrate buffer; and [0077] c. a pH of 4.5 to 5.5.
[0078] In some embodiments, an aqueous pharmaceutical formulation is provided comprising: [0079] (a) an isolated anti-Aβ protofibril antibody or fragment thereof comprising (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) and a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, at a concentration of 80-300 mg/ml; and [0080] (b) a pharmaceutically acceptable buffer, wherein the buffer is a histidine buffer, optionally wherein the histidine buffer is at a concentration of about 25 mM, optionally comprising any one or more of the following: [0081] a. 0.01% w/v to 0.1% w/v polysorbate 80; [0082] b. 100 mM to 400 mM arginine, arginine hydrochloride, or a combination thereof; and [0083] c. a pH of 4.5 to 5.5.
[0084] Some embodiments relate to an aqueous pharmaceutical formulation comprising: [0085] (a) an isolated anti-Aβ protofibril antibody or fragment thereof that binds to human Aβ protofibrils, at a concentration of 80 mg/mL to 300 mg/mL, [0086] (b) 100 mM to 400 mM arginine, [0087] (c) 0.01% w/v to 0.1% w/v polysorbate 80, and [0088] (d) a pharmaceutically acceptable buffer, [0089] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5, and [0090] wherein the antibody or fragment thereof comprises: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) and a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, and wherein arginine is arginine, arginine hydrochloride, or a combination thereof.
[0091] Concentration of Antibody
[0092] For any of the aqueous pharmaceutical formulations described herein, the antibody may be present in the following concentrations.
[0093] In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 100 mg/mL or more. In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 100 mg/mL.
[0094] In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 200 mg/mL or more. In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 200 mg/mL.
[0095] In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration ranging from 80 mg/mL to 300 mg/mL. In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration ranging from 80 mg/mL to 240 mg/mL.
[0096] In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration ranging from 100 mg/mL to 200 mg/mL.
[0097] In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration ranging from 80 mg/mL to 300 mg/mL, 85 mg/mL to 275 mg/mL, 90 mg/mL to 250 mg/mL, 95 mg/mL to 225 mg/mL, 100 to 200 mg/mL. In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration ranging from 90 mg/mL to 220 mg/mL, 100 mg/mL to 210 mg/mL, or 110 mg/mL to 200 mg/mL.
[0098] In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 80 mg/mL, 90 mg/mL, 100 mg/mL, 110 mg/mL, 120 mg/mL, 180 mg/mL, 190 mg/mL, 200 mg/mL, 210 mg/mL, 220 mg/mL, 230 mg/mL, 240 mg/mL, 250 mg/mL, 260 mg/mL, 270 mg/mL, 280 mg/mL, 290 mg/mL, or 300 mg/mL.
[0099] In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 100 mg/mL.
[0100] In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 200 mg/mL.
[0101] In some embodiments of the pharmaceutical formulation, the isolated anti-Aβ protofibril antibody or fragment thereof is BAN2401.
[0102] Arginine
[0103] For any of the aqueous pharmaceutical formulations described herein, the formulation may comprise arginine as follows.
[0104] In some embodiments, the pharmaceutical formulation comprises arginine. In some embodiments, the arginine is arginine, arginine hydrochloride, or a combination thereof.
[0105] In some embodiments of the pharmaceutical formulation, the concentration of arginine ranges from about 100 mM to about 400 mM.
[0106] In some embodiments of the pharmaceutical formulation, the concentration of arginine ranges from 100 mM to 400 mM, 110 mM to 380 mM, 120 mM to 360 mM, 125 mM to 350 mM, 100 mM to 200 mM, 125 mM to 200 mM or 150 mM to 200 mM. In some embodiments of the pharmaceutical formulation, the concentration of arginine ranges from 150 mM to 250 mM, 160 mM to 240 mM, 170 mM to 230 mM, 180 mM to 220 mM, 190 mM to 210 mM arginine, arginine hydrochloride, or a combination thereof
[0107] In some embodiments of the pharmaceutical formulation, the concentration of arginine is 125 mM.
[0108] In some embodiments of the pharmaceutical formulation, the concentration of arginine is 200 mM.
[0109] In some embodiments of the pharmaceutical formulation, the concentration of arginine ranges from 200 mM to 400 mM, 210 mM to 390 mM, 220 mM to 380 mM, 230 mM to 370 mM, 240 mM to 360 mM, 240 mM to 350 mM or 250 mM to 350 mM.
[0110] In some embodiments of the pharmaceutical formulation, the concentration of arginine is 350 mM.
[0111] Polysorbate 80 (PS80)
[0112] For any of the aqueous pharmaceutical formulations described herein, the formulation may comprise polysorbate 80 as follows.
[0113] In some embodiments of the pharmaceutical formulation, the concentration of polysorbate 80 ranges from about 0.01% w/v to 0.1% w/v, 0.01% w/v to 0.08% w/v, 0.02% w/v to 0.08% w/v, 0.03% w/v to 0.07% w/v, or 0.04% w/v to 0.06% w/v.
[0114] In some embodiments of the pharmaceutical formulation, the polysorbate 80 is present in a concentration of 0.01% w/v, 0.02% w/v, 0.03% w/v, 0.04% w/v, 0.05% w/v, 0.06% w/v, 0.07% w/v, or 0.08% w/v.
[0115] In some embodiments of the pharmaceutical formulation, the polysorbate 80 is present in a concentration of 0.02% w/v.
[0116] In some embodiments of the pharmaceutical formulation, the polysorbate 80 is present in a concentration of 0.05% w/v.
[0117] Buffer
[0118] For any of the aqueous pharmaceutical formulations described herein, the formulation may comprise a pharmaceutically acceptable buffer as follows.
[0119] In some embodiments of the pharmaceutical formulation, the pharmaceutically acceptable buffer is citrate buffer.
[0120] In some embodiments of the pharmaceutical formulation, the citrate buffer is present in a concentration of about 10 mM to about 100 mM.
[0121] In some embodiments of the pharmaceutical formulation, the concentration of the citrate buffer ranges from 10 mM to 100 mM, 10 mM to 90 mM, 15 mM to 85 mM, 20 mM to 80 mM, 25 mM to 75 mM, 30 mM to 70 mM, 30 mM to 60 mM, or 30 mM to 50 mM.
[0122] In some embodiments of the pharmaceutical formulation, the citrate buffer is present in a concentration of 50 mM.
[0123] In some embodiments of the pharmaceutical formulation, the pharmaceutically acceptable buffer is a histidine buffer.
[0124] In some embodiments of the pharmaceutical formulation, the histidine buffer is present in a concentration of about 10 mM to about 100 mM.
[0125] In some embodiments of the pharmaceutical formulation, the concentration of the histidine buffer ranges from 10 mM to 100 mM, 12 mM to 80 mM, 14 mM to 60 mM, or 15 mM to 55 mM, 15 mM to 35 mM, or 15 mM to 25 mM.
[0126] In some embodiments of the pharmaceutical formulation, the histidine buffer is present in a concentration of 25 mM.
[0127] In some embodiments of the pharmaceutical formulation, the histidine buffer is present in a concentration of 50 mM.
[0128] In some embodiments of the pharmaceutical formulation, the histidine buffer comprises histidine and histidine hydrochloride monohydrate. In some embodiments of the pharmaceutical formulation, the histidine buffer comprises histidine and histidine hydrochloride monohydrate, wherein the histidine is in a concentration of about 0.1 to 0.3 mg/mL, and the histidine hydrochloride monohydrate is in a concentration of about 4 to 6 mg/mL. In some embodiments of the pharmaceutical formulation, the histidine buffer comprises histidine and histidine hydrochloride monohydrate, wherein the histidine is in a concentration of about 0.26 mg/mL, and the histidine hydrochloride monohydrate is in a concentration of about 4.89 mg/mL. In some embodiments of the pharmaceutical formulation, the histidine buffer comprises histidine and histidine hydrochloride monohydrate, wherein the histidine comprises 0.2-0.3 mg/mL histidine and 4.4 to 4.9 mg/mL histidine hydrochloride, optionally where the histidine hydrochloride is monohydrate.
[0129] pH
[0130] For any of the aqueous pharmaceutical formulations described herein, the formulation may comprise a pH as follows.
[0131] In some embodiments of the pharmaceutical formulation, the pH is in the range of 4.0 to 6.0, 4.2 to 5.8, 4.3 to 5.7, 4.4 to 5.6 or 4.5 to 5.5.
[0132] In some embodiments of the pharmaceutical formulation, the pH is 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4 or 5.5.
[0133] In some embodiments of the pharmaceutical formulation, the pH is 4.5 to 5.5.
[0134] In some embodiments of the pharmaceutical formulation, the pH is 5.0.
[0135] In some embodiments of the pharmaceutical formulation, the pharmaceutical formulation is suitable for intravenous injection.
[0136] In some embodiments of the pharmaceutical formulation, the pharmaceutical formulation is suitable for subcutaneous injection.
[0137] In some embodiments of the aqueous pharmaceutical formulation, the pharmaceutical formulation comprises methionine.
[0138] In some embodiments, disclosed is an aqueous pharmaceutical formulation comprising: [0139] (a) 80 mg/mL to 240 mg/mL BAN2401, [0140] (b) 140 mM to 260 mM arginine hydrochloride, [0141] (c) 0.01% w/v to 0.1% w/v polysorbate 80, and [0142] (d) 15 mM to 35 mM histidine buffer, [0143] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
[0144] In some embodiments, disclosed is an aqueous pharmaceutical formulation comprising: [0145] (a) 80 mg/mL to 240 mg/mL of an isolated anti-A protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, [0146] (b) 140 mM to 260 mM arginine hydrochloride, [0147] (c) 0.01% w/v to 0.1% w/v polysorbate 80, and [0148] (d) 15 mM to 35 mM histidine buffer, [0149] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
[0150] In some embodiments, disclosed is an aqueous pharmaceutical formulation comprising: [0151] (a) 80 mg/mL to 240 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain comprising the amino acid sequence of SEQ ID NO:11, and (ii) a light chain comprising the amino acid sequence of SEQ ID NO:12, [0152] (b) 140 mM to 260 mM arginine hydrochloride, [0153] (c) 0.01% w/v to 0.1% w/v polysorbate 80, and [0154] (d) 15 mM to 35 mM histidine buffer, [0155] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
[0156] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0157] (a) 80 mg/mL to 120 mg/mL BAN2401, [0158] (b) 240 mM to 360 mM arginine, [0159] (c) 0.03% w/v to 0.08% w/v polysorbate 80, and [0160] (d) 30 mM to 70 mM citrate buffer, [0161] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5, and wherein arginine is arginine, arginine hydrochloride, or a combination thereof.
[0162] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0163] (a) 80 mg/mL to 120 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, [0164] (b) 240 mM to 360 mM arginine, [0165] (c) 0.03% w/v to 0.08% w/v polysorbate 80, and [0166] (d) 30 mM to 70 mM citrate buffer, [0167] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5, and wherein arginine is arginine, arginine hydrochloride, or a combination thereof.
[0168] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0169] (a) 80 mg/mL to 120 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain comprising the amino acid sequence of SEQ ID NO: 11, and (ii) a light chain comprising the amino acid sequence of SEQ ID NO:12, [0170] (b) 240 mM to 360 mM arginine, [0171] (c) 0.03% w/v to 0.08% w/v polysorbate 80, and [0172] (d) 30 mM to 70 mM citrate buffer, [0173] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5, and wherein arginine is arginine, arginine hydrochloride, or a combination thereof.
[0174] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0175] (a) 100 mg/mL BAN2401, [0176] (b) 200 mM arginine hydrochloride, [0177] (c) 0.05% w/v polysorbate 80, and [0178] (d) 25 mM histidine buffer, [0179] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
[0180] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0181] (a) 100 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, [0182] (b) 200 mM arginine hydrochloride, [0183] (c) 0.05% w/v polysorbate 80, and [0184] (d) 25 mM histidine buffer, [0185] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
[0186] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0187] (a) 100 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain comprising the amino acid sequence of SEQ ID NO:11, and (ii) a light chain comprising the amino acid sequence of SEQ ID NO:12, [0188] (b) 200 mM arginine hydrochloride, [0189] (c) 0.05% w/v polysorbate 80, and [0190] (d) 25 mM histidine buffer, [0191] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
[0192] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0193] (a) 200 mg/mL BAN2401, [0194] (b) 200 mM arginine hydrochloride, [0195] (c) 0.05% w/v polysorbate 80, and [0196] (d) 25 mM histidine buffer, [0197] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
[0198] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0199] (a) 200 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, [0200] (b) 200 mM arginine hydrochloride, [0201] (c) 0.05% w/v polysorbate 80, and [0202] (d) 25 mM histidine buffer, [0203] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
[0204] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0205] (a) 200 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain comprising the amino acid sequence of SEQ ID NO:11, and (ii) a light chain comprising the amino acid sequence of SEQ ID NO:12, [0206] (b) 200 mM arginine hydrochloride, [0207] (c) 0.05% w/v polysorbate 80, and [0208] (d) 25 mM histidine buffer, [0209] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
[0210] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0211] (a) 100 mg/mL BAN2401, [0212] (b) 350 mM arginine, [0213] (c) 0.05% w/v polysorbate 80, and [0214] (d) 50 mM citrate buffer, [0215] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5, and wherein arginine is arginine, arginine hydrochloride, or a combination thereof.
[0216] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0217] (a) 100 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, [0218] (b) 350 mM arginine, [0219] (c) 0.05% w/v polysorbate 80, and [0220] (d) 50 mM citrate buffer, [0221] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5, and wherein arginine is arginine, arginine hydrochloride, or a combination thereof.
[0222] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0223] (a) 100 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain comprising the amino acid sequence of SEQ ID NO: 11, and (ii) a light chain comprising the amino acid sequence of SEQ ID NO:12, [0224] (b) 350 mM arginine, [0225] (c) 0.05% w/v polysorbate 80, and [0226] (d) 50 mM citrate buffer, [0227] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5, and wherein arginine is arginine, arginine hydrochloride, or a combination thereof.
[0228] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0229] (a) 150 mg/mL to 250 mg/mL BAN2401, [0230] (b) 100 mM to 150 mM arginine hydrochloride, [0231] (c) 0.01% w/v to 0.05% w/v polysorbate 80, and [0232] (d) 35 mM to 65 mM histidine buffer,
[0233] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5. In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0234] (a) 150 mg/mL to 250 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, [0235] (b) 100 mM to 150 mM arginine hydrochloride, [0236] (c) 0.01% w/v to 0.05% w/v polysorbate 80, and [0237] (d) 35 mM to 65 mM histidine buffer,
[0238] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
[0239] In some embodiments, disclosed herein is an aqueous pharmaceutical formulation comprising: [0240] (a) 150 mg/mL to 250 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain comprising the amino acid sequence of SEQ ID NO:11, and (ii) a light chain comprising the amino acid sequence of SEQ ID NO:12, [0241] (b) 100 mM to 150 mM arginine hydrochloride, [0242] (c) 0.01% w/v to 0.05% w/v polysorbate 80, and [0243] (d) 35 mM to 65 mM histidine buffer, [0244] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5.
[0245] In some embodiments, the aqueous pharmaceutical formulation has pH 5.0.
Method of Reducing Aggregate Formation
[0246] In some embodiments, disclosed herein is a method of reducing aggregate formation of an isolated anti-Aβ protofibril antibody or fragment thereof, comprising: [0247] (a) providing a pharmaceutical formulation comprising an isolated anti-Aβ protofibril antibody or fragment thereof that binds to human Aβ protofibrils, at a concentration of 50 mg/ml or more, optionally wherein the concentration is 80 mg/mL to 300 mg/mL, optionally wherein the concentration is 100 mg/mL to 200 mg/mL, and [0248] (b) adding arginine, arginine hydrochloride, or combination thereof, and optionally providing a pharmaceutically acceptable buffer, wherein the buffer is optionally histidine buffer, wherein the isolated anti-Aβ protofibril antibody or fragment thereof comprises (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2.
[0249] In some embodiments of the method of reducing aggregate formation, the pH of the pharmaceutical formulation is in the range of 4.5 to 5.5. In some embodiments of the method, the pH of the pharmaceutical formulation is 5.0.
[0250] In some embodiments of the method of reducing aggregate formation, the arginine, arginine hydrochloride, or combination thereof is present in a concentration of 150 mM to 250 mM.
[0251] In some embodiments, disclosed herein is a method of reducing fragmentation of isolated anti-Aβ protofibril antibody or fragment thereof, comprising: [0252] (a) providing a pharmaceutical formulation comprising an isolated anti-Aβ protofibril antibody or fragment thereof that binds to human Aβ protofibrils, at a concentration of 50 mg/ml or more, optionally wherein the concentration is 80 mg/mL to 300 mg/mL, optionally wherein the concentration is 100 mg/mL to 200 mg/mL, and [0253] (b) adding histidine buffer, and optionally further providing arginine, arginine hydrochloride, or combination thereof, wherein the isolated anti-Aβ protofibril antibody or fragment thereof comprises (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2.
[0254] In some embodiments of the method of reducing fragmentation, the pH of the pharmaceutical formulation is in the range of 4.5 to 5.5. In some embodiments of the method, the pH1 of the pharmaceutical formulation is 5.0.
[0255] In some embodiments of the method of reducing fragmentation, the arginine, arginine hydrochloride, or combination thereof is present in a concentration of 100 mM to 400 mM.
[0256] In some embodiments of the method of reducing fragmentation, the pharmaceutical formulation further comprises 0.01% w/v to 0.1% w/v polysorbate 80.
[0257] In some embodiments of the method of reducing fragmentation, the pharmaceutical formulation further comprises a pharmaceutically acceptable buffer, wherein the buffer is histidine buffer, optionally, wherein the histidine buffer ranges from 10 mM to 100 mM, 12 mM to 80 mM, 14 mM to 60 mM, or 15 mM to 55 mM, 15 mM to 35 mM, or 15 mM to 25 mM.
[0258] In some embodiments, disclosed herein is a method of reducing aggregate formation and/or fragmentation of an isolated anti-A protofibril antibody or fragment thereof, comprising: [0259] (a) providing a pharmaceutical formulation comprising an isolated anti-Aβ protofibril antibody or fragment thereof that binds to human Aβ protofibrils, at a concentration of 50 mg/ml or more, optionally wherein the concentration is 80 mg/mL to 300 mg/mL, optionally wherein the concentration is 100 mg/mL to 200 mg/mL, [0260] (b) adding arginine, arginine hydrochloride, or combination thereof, and [0261] (c) providing a pharmaceutically acceptable histidine buffer, wherein the isolated anti-Aβ protofibril antibody or fragment thereof comprises (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2.
[0262] In some embodiments, disclosed herein is a method of reducing aggregate formation and/or fragmentation of an isolated anti-Aβ protofibril antibody or fragment thereof, comprising: [0263] (a) providing a pharmaceutical formulation comprising an isolated anti-Aβ protofibril antibody or fragment thereof that binds to human Aβ protofibrils, at a concentration of 50 mg/ml or more, optionally wherein the concentration is 80 mg/mL to 300 mg/mL, optionally wherein the concentration is 100 mg/mL to 200 mg/mL, [0264] (b) providing histidine buffer, and [0265] (c) providing arginine, arginine hydrochloride, or combination thereof, wherein the formulation is at a pH of 4.5-5.5, wherein the isolated anti-Aβ protofibril antibody or fragment thereof comprises (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2.
[0266] Also provided herein are the following embodiments: [0267] [Embodiment 01] An aqueous pharmaceutical formulation comprising: [0268] a. an isolated anti-Aβ protofibril antibody or fragment thereof that binds to human Aβ protofibrils, at a concentration of 80 mg/mL to 300 mg/mL, [0269] b. 100 mM to 400 mM arginine, [0270] c. 0.01% w/v to 0.1% w/v polysorbate 80, and [0271] d. a pharmaceutically acceptable buffer, [0272] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5, [0273] wherein the isolated anti-Aβ protofibril antibody or fragment thereof comprises: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, and [0274] wherein the arginine is arginine, arginine hydrochloride, or a combination thereof. [0275] [Embodiment 02] The pharmaceutical formulation according to claim 1, wherein the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 100 mg/mL to 200 mg/mL. [0276] [Embodiment 03] The pharmaceutical formulation according to claim 1, wherein the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 100 mg/mL. [0277] [Embodiment 04] The pharmaceutical formulation according to claim 1, wherein the isolated anti-Aβ protofibril antibody or fragment thereof is present in a concentration of 200 mg/mL. [0278] [Embodiment 05] The pharmaceutical formulation according to any one of claims 1-4, further comprising methionine. [0279] [Embodiment 06] The pharmaceutical formulation according to any one of claims 1-5, wherein the pharmaceutically acceptable buffer is citrate buffer or histidine buffer. [0280] [Embodiment 07] The pharmaceutical formulation according to any one of claims 1-6, comprising 10 to 100 mM citrate buffer or 10 to 100 mM histidine buffer. [0281] [Embodiment 08] The pharmaceutical formulation according to any one of claims 1-7, comprising 125 to 350 mM arginine. [0282] [Embodiment 09] The pharmaceutical formulation according to any one of claims 1-8, comprising 200 mM arginine, wherein the arginine is arginine hydrochloride. [0283] [Embodiment 10] The pharmaceutical formulation according to any one of claims 1-9, comprising 200 mM arginine, wherein the arginine is arginine hydrochloride, and 25 mM histidine buffer. [0284] [Embodiment 11] An aqueous pharmaceutical formulation comprising: [0285] a. 80 mg/mL to 240 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, [0286] b. 140 mM to 260 mM arginine hydrochloride, [0287] c. 0.02% w/v to 0.08% w/v polysorbate 80, and [0288] d. 15 mM to 35 mM histidine buffer, [0289] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5. [0290] [Embodiment 12] An aqueous pharmaceutical formulation comprising: [0291] a. 80 mg/mL to 120 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, [0292] b. 240 mM to 360 mM arginine, [0293] c. 0.02% w/v to 0.08% w/v polysorbate 80, and [0294] d. 30 mM to 50 mM citrate buffer, [0295] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5, and wherein the arginine is arginine, arginine hydrochloride, or a combination thereof. [0296] [Embodiment 13] A method of reducing aggregate formation of an isolated anti-Aβ protofibril antibody or fragment thereof, comprising: [0297] providing an aqueous pharmaceutical formulation comprising an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2 at a concentration of 80 mg/ml to 300 mg/ml, and [0298] adding arginine, arginine hydrochloride, or a combination thereof to said aqueous pharmaceutical formulation, wherein the pH of the pharmaceutical formulation ranges from 4.5 to 5.5. [0299] [Embodiment 14] The method according to claim 13, wherein the arginine, arginine hydrochloride, or combination thereof is present in a concentration of 150 to 250 mM. [0300] [Embodiment 15] The method according to claim 14, wherein the arginine, arginine hydrochloride, or combination thereof is present in a concentration of 200 mM. [0301] [Embodiment 16] The method according to any one of claims 13 to 15, wherein the pharmaceutical formulation further comprises a pharmaceutically acceptable buffer. [0302] [Embodiment 17] The method according to claim 16, wherein the pharmaceutically acceptable buffer is histidine buffer or citrate buffer. [0303] [Embodiment 18] A method of reducing fragmentation of an isolated anti-Aβ protofibril antibody or fragment thereof, comprising: [0304] providing an aqueous pharmaceutical formulation comprising an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2 at a concentration of 80 mg/ml to 300 mg/ml, and [0305] adding histidine buffer to said aqueous pharmaceutical composition, wherein the pH of the pharmaceutical formulation ranges from 4.5 to 5.5. [0306] [Embodiment 19] The method according to claim 18, comprising 15 to 35 mM histidine buffer. [0307] [Embodiment 20] The method according to any one of claims 13-19, wherein the pharmaceutical formulation further comprises 0.01% w/v to 0.1% w/v polysorbate 80. [0308] [Embodiment 21] An aqueous pharmaceutical formulation comprising: [0309] a. 80 mg/mL to 240 mg/mL of an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2; [0310] b. 140 mM to 260 mM arginine, arginine hydrochloride, or a combination thereof; [0311] c. 0.01% w/v to 0.1% w/v polysorbate 80; and [0312] d. 15 mM to 35 mM histidine buffer or 30 mM to 50 mM citrate buffer, [0313] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5. [0314] [Embodiment 22] The pharmaceutical formulation according to embodiment 21, comprising 100 mg/mL of the antibody. [0315] [Embodiment 23] The pharmaceutical formulation according to embodiment 21, comprising 200 mg/mL of the antibody. [0316] [Embodiment 24] The pharmaceutical formulation according to embodiment 21, comprising from 90 mg/mL to 220 mg/mL, 100 mg/mL to 210 mg/mL, or 110 mg/mL to 200 mg/mL of the antibody. [0317] [Embodiment 25] The pharmaceutical formulation according to any one of embodiments 21-24, comprising histidine buffer, wherein the histidine buffer comprises 15 mM to 30 mM, 15 mM to 25 mM, or 20 mM to 30 mM histidine. [0318] [Embodiment 26] The pharmaceutical formulation according to any one of embodiments 21-25, comprising histidine buffer, wherein the histidine buffer comprises 0.2-0.3 mg/mL histidine and 4.4 to 4.9 mg/mL histidine hydrochloride, optionally where the histidine hydrochloride is monohydrate. [0319] [Embodiment 27] The pharmaceutical formulation according to any one of embodiments 21-26, comprising 150 mM to 250 mM, 160 mM to 240 mM, 170 mM to 230 mM, 180 mM to 220 mM, 190 mM to 210 mM arginine, arginine hydrochloride, or a combination thereof. [0320] [Embodiment 28] The pharmaceutical formulation according to any one of embodiments 21-27, comprising 0.02% w/v to 0.05%, or 0.04% w/v to 0.04% w/v polysorbate 80. [0321] [Embodiment 29] The pharmaceutical formulation according to any one of embodiments 21-28 comprising citrate buffer. [0322] [Embodiment 30] The pharmaceutical formulation according to any one of embodiments 21-29, comprising histidine buffer. [0323] [Embodiment 31] The pharmaceutical formulation according to any one of embodiments 21-30, further comprising methionine. [0324] [Embodiment 32] An aqueous pharmaceutical formulation comprising: [0325] a. 100 mg/ml to 200 mg/ml of an antibody comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2; [0326] b. 200 mM arginine hydrochloride; [0327] c. 0.05% w/v polysorbate 80; and [0328] d. 25 mM histidine buffer, [0329] wherein the pharmaceutical formulation has a pH ranging from 4.5 to 5.5. [0330] [Embodiment 33] The pharmaceutical formulation according to embodiment 32, comprising 100 mg/mL of the antibody. [0331] [Embodiment 34] The pharmaceutical formulation according to embodiment 32, comprising 200 mg/mL of the antibody. [0332] [Embodiment 35] A method of reducing aggregate formation and/or fragmentation of an antibody, comprising: [0333] a. providing an aqueous pharmaceutical formulation comprising an isolated anti-Aβ protofibril antibody or fragment thereof comprising: (i) a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:1, and (ii) a light chain variable domain comprising the amino acid sequence of SEQ ID NO:2, at a concentration of 80 mg/ml to 300 mg/mil, and [0334] b. adding 1) arginine, arginine hydrochloride, or a combination thereof, or 2) histidine buffer to said aqueous pharmaceutical composition. [0335] [Embodiment 36] The method of embodiment 35, wherein the pH of the pharmaceutical formulation ranges from 4.5 to 5.5. [0336] [Embodiment 37] The method of embodiment 35, wherein the arginine, arginine hydrochloride, or combination thereof is present in a concentration of 150-250 mM. [0337] [Embodiment 38] The method according to embodiment 37, wherein the arginine, arginine hydrochloride, or combination thereof is present in a concentration of 200 mM. [0338] [Embodiment 39] The method according to embodiment 38, comprising 15 to 25 mM histidine buffer. [0339] [Embodiment 40] The method according to any one of embodiments 35-39, wherein pharmaceutical formulation further comprises 0.01% w/v to 0.1% w/v polysorbate 80. [0340] [Embodiment 41] The method according to any one of embodiments 35-40, wherein the pharmaceutical formulation further comprises a pharmaceutically acceptable buffer. [0341] [Embodiment 42] The method according to embodiment 41, wherein the pharmaceutically acceptable buffer is histidine buffer or citrate buffer.
EXAMPLES
Example 1: Protein Concentration Study
[0342] Samples with three protein concentrations (10, 100, 200 mg/mL) were prepared and examined in the concentration study. The 10 mg/mL material was BAN2401 purified drug substance (PDS) and the 100 and 200 mg/mL materials were produced from BAN2401 PDS using Amicon Ultra-15 spin filters. The samples were all in the same formulation buffer (25 mM sodium citrate, 125 mM sodium chloride, pH 5.7), except that each had a different PS80 level. The PS80 percentages of the 10, 100, 200 mg/mL samples were 0.02%, 0.16%, and 0.32%, respectively. All samples were 0.2 gm filtered and aliquoted into sterile polypropylene (PP) tubes for stability testing. (Note: The PS80 removal process was not available at the time that the concentration study was conducted.)
[0343] Sample stability was evaluated at two temperatures (5 & 25° C.) for 3 months using native HPLC-SEC, pH, and DLS. Additional characterization assays, such as PS80 verification, were performed on the T=0 samples. Details of the sample testing are shown in Table 1.
TABLE-US-00001 TABLE 1 Testing Schedule (Concentration Study) Time Point T = 0 T = 1 mo T = 2 mo T = 3 mo Temperature N/A 5° C. 5° C. 5° C. 25° C. 25° C. 25° C. Number of 3 6 6 6 Samples Testing Native SEC Native SEC Native SEC Native SEC pH pH pH pH DLS DLS DLS DLS
[0344] pH was measured using a pH meter with a microprobe. Prior to measurements, a calibration was performed using pH 4.0 and 7.0 standards.
[0345] Aggregation and physical degradation of the concentrated BAN2401 was assessed by performing native HPLC-SEC on stability samples stored at 5 and 25° C.
[0346] HPLC-SEC (Native) analysis was performed utilizing a TSK G3000 SWXL column with 0.2 M sodium phosphate, pH 7.0 mobile phase at a flow rate of 1.0 mL/min. The sample injection volumes were 15, 1.5, or 0.8 pi, for protein concentrations of 10, 100, or 200 mg/mL, respectively. This ensures approximately 150 pg of protein is injected onto the column across the study. Results of relative peak areas (%) for monomer, aggregate and fragment are reported in
[0347] At both temperatures (5 and 25° C.), higher aggregate percentages and aggregation rates were seen with increased protein concentrations. For the 100 and 200 mg/mL samples, the starting aggregate percentages were nearly twice as much as that of the 10 mg/mL sample. This indicated the concentration process alone caused protein to aggregate. Additional aggregation occurred during the storage at 5 and 25° C. The average aggregation rate over 3 months at 5° C. was 0.17% per month for 100 mg/mL, and 0.20% per month for 200 mg/mL. For comparison, the 10 mg/mL sample exhibited only a 0.07% per month aggregation rate under the same condition. In summary, it appeared that BAN2401 at 100 mg/mL or greater was not physically stable in the formulation.
[0348] Protein concentration was evaluated by UV by measuring the absorbance at 280 and 320 mu on a Beckman DU-800 spectrophotometer. Samples were diluted 500-fold and were prepared in duplicate. Protein concentration was calculated using an extinction coefficient, ε, of 1.32 using the following formula:
Concentration=(A280−A320)/ε×Dilution Factor
[0349] Protein concentration was measured using a UV-Vis spectrophotometer. The results are listed in Table 2. Overall, the concentrations remained unchanged throughout the 3 months at both temperatures.
TABLE-US-00002 TABLE 2 Protein Concentration Results (Concentration Study) Protein Concentration (mg/ml) Sample T = 1 mo T = 2 mo T = 3 mo ID T = 0 5° C. 25° C. 5° C. 25° C. 5° C. 25° C. 10 mg/ml 10.6 9.93 9.93 9.9 10.0 10.11 10.15 100 mg/ml 110.3 110.1 114.1 103.4 104.2 106.6 106.4 200 mg/ml 210.8 197.2 224.5 207.4 205.4 205.3 205.8
Example 2: pH Screening Study
[0350] The stability of BAN2401 at 200 mg/mL was evaluated at five different pH values. To prepare the samples, PS80-removed BAN2401 PDS was concentrated and diafiltered into a buffer containing 50 mM sodium citrate, 100 mM sodium chloride, pH 4.5. The final concentration adjustment was performed via a dilution to achieve a concentration of 200 mg/mL, protein and 0.02% PS80. The resulting material was divided into 5 aliquots; four of the aliquots were titrated with a 10 N sodium hydroxide to produce samples at different pH (i.e., pH 5.0, 5.5, 6.0, and 6.5). The resulting samples were 0.2-μm filtered and sub-aliquoted into sterile polypropylene (PP) tubes for stability evaluation.
[0351] Stability of the samples was evaluated at two temperatures (5 & 25° C.) using native HPLC-SEC, pH, and DLS over 3 months. Additionally, an agitation study was conducted at the 1-month time point, where a subset of the 5° C. samples was agitated horizontally at 250 RPM for 3 days in a 25° C. incubator. Details of the sample testing are shown in Table 3.
TABLE-US-00003 TABLE 3 Testing Schedule (pH Study) Time Point T = 0 T = 1 month T = 2 months T = 3 months Temperature n/a 5° C. 5° C. 5° C. 25° C. 25° C. 25° C. Agitation na Agitation Not required Not required Number of 5 15 10 10 Samples Testing Native SEC Native SEC Native SEC Native SEC pH pH pH pH DLS DLS DLS DLS DSC
[0352] SEC-HPLC analysis was performed utilizing a TSK G3000 SWXL column with 0.2 M sodium phosphate, pH 7.0 mobile phase at a flow rate of 1.0 mL/min. The sample injection volumes were 15, 1.5, or 0.8 μL for protein concentrations of 10, 100, or 200 mg/mL, respectively. This ensures approximately 150 μg of protein is injected onto the column across the study. Results of relative peak areas (%) for monomer, aggregate and fragment were reported.
[0353] Aggregation and physical degradation of the concentrated BAN2401 was assessed by performing native HPLC-SEC on stability samples stored at 5 and 25° C. The results are shown in
Example 3: Excipient Screening Study
[0354] Twelve excipients were screened in this study. To prepare the samples with BAN2401 at 200 mg/mL, PS80—removed BAN2401 was concentrated via a TFF step, followed by a diafiltration step with the base buffer (50 mM citrate, 0.02% PS80, pH 6.0). The concentrated material was aliquoted into twenty-four fractions. Each fraction was spiked with a stock solution containing a specific excipient. For the majority of the excipients, two concentrations were examined, except sodium chloride and ascorbic acid for which samples with three and one concentration level respectively were prepared. A list of the excipients used and their concentrations is shown in Table 4.
TABLE-US-00004 TABLE 4 List of Excipients and Corresponding Concentrations Concentration Excipient (Formulation #) None Control sample (F0) contained the protein in the base buffer without any excipient added. Sucrose 1% (F1), 6% (F2) Trehalose 0.5% (F3), 3.5% (F4) Mannitol 0.5% (F5), 1.8% (F6) Proline 50 Mm (F9), 400 Mm (F10) Glycine 50 Mm (F11), 400 Mm (F12) Arginine 25 Mm (F13), 160 mM (F14) NaCl 50 mM (F16), 150 mM (F17), 500 mM (F18) PS80 0.05% v/v (F19), 0.1% v/v (F20) PEG400 1% (F21), 6% (F22) Dextran, LMW 1% (F23), 5% (F24) Ascorbic Acid 50 Mm (F15) Sorbitol 1% (F7), 6% (F8)
[0355] All samples, including the control (i.e., the sample in the base buffer without excipient), were 0.2-gm filtered and then filled into BD syringes aseptically using a hand stoppering tool. Control samples were also filled in glass vials. Vials and the BD syringes were placed at 5 and 25° C. Sample stability was evaluated for 2 months using native HPLC-SEC and pH.
[0356] The samples of the excipient screening study were prepared in a suboptimal buffer (50 mM citrate, 0.02% PS80, pH 6.0) condition in order to amplify positive effects from excipients in preventing aggregate formation. The stability profile (aggregation) of each formulation over 2 months at 25° C. was assessed by performing native HPLC-SEC.
[0357] As shown in
[0358] Additionally, formulations with arginine had the lowest starting aggregate percentages, indicating arginine was capable of suppressing aggregate formation during the protein concentration step. The fragmentation was slightly higher with the arginine formulation (F14) as compared to the control (F0). However, the difference could have been within the assay variability.
[0359] The second-best excipient in this study was the formulation with 400 mM proline (F10), although its effect in controlling aggregation was not as effective as the arginine formulation (F14).
[0360] The formulations with sodium chloride (F16-F18) showed no effect on the stability as compared to the control sample. The same observation was made for the formulations with PS80 (F19 and F20): no stability effect was observed by varying the PS80 content. The formulation with the ascorbic acid (F15) showed a dramatic effect an increasing aggregate and fragment percentages from the beginning of the study.
[0361] The pH of the two arginine formulations (F13 & F14) was measured to verify that the presence of arginine in the formulations had not caused the pH to drift over time. As shown in Table 4, no change in pH was observed. The osmolality of the two formulations was also measured. The samples were stored at −20° C. before they were thawed at the same time for measurements.
TABLE-US-00005 TABLE 5 pH and Osmolality of Arginine Formulations (F13 & F14) Arginine Formulation (F13 and F14; time point) pH mOsm/kg F13, T = 0 no sample no sample F14, T = 0 5.86 no sample F13, T = 1 month 5.97 231 F14, T = l month 5.88 477 F13, T = 2 months 5.97 230 F14, T = 2 months 5.89 459
Example 4: Arginine Concentration Study
[0362] The relation between concentration of arginine and aggregates in the formulation was studied by Design Expert® 7.0. The factors chosen for study, and the levels explored for each factor are shown in Table 6 below.
TABLE-US-00006 TABLE 6 Factors Investigated in Example 4 Factor Factor Range Factor Levels BAN2401 30 to 120 mg/mL 30, 53, 75, 98, 120 mg/mL pH 4.5 to 6.0 4.5, 4.9, 5.2, 5.6, and 6.0 Arginine 0 to 450 mM 0, 225, 338, and 450 mM Polysorbate 80 0 to 0.1% 0, 0.025, 0.05, 0.075, and 0.1%
[0363] A sample randomization was generated by D-optimal design in Design Expert® 7.0. The obtained sample set contained 25 data points including 4 replicates, as shown in Table 7. Each formulation was prepared and evaluated.
TABLE-US-00007 TABLE 7 Formulations prepared for Example 4 BAN2401 Arginine Polysorbate Entry (mg/mL) pH (mM) 80 (%) 1 30 5.2 0 0.000 2 30 6.0 0 0.050 3 30 4.5 0 0.100 4 30 4.5 0 0.100 5 30 6.0 225 0.000 6 30 4.5 450 0.000 7 30 4.5 450 0.000 8 30 6.0 450 0.100 9 30 6.0 450 0.100 10 53 5.6 225 0.025 11 53 4.9 338 0.075 12 75 4.5 0 0.000 13 75 4.5 0 0.000 14 75 6.0 0 0.100 15 75 5.2 225 0.000 16 75 6.0 450 0.000 17 75 6.0 450 0.000 18 98 4.5 450 0.100 19 98 5.6 225 0.025 20 120 4.9 338 0.075 21 120 6.0 0 0.000 22 120 4.5 0 0.100 23 120 5.2 225 0.050 24 120 4.5 450 0.000 25 120 6.0 450 0.100
[0364] The relation between arginine concentration and aggregate levels in 100 mg/mL. BAN2401 formulations at pH 5.0 containing 0.02% polysorbate 80 was estimated by Design Expert® 7.0. The result of the estimation was shown in
Example 5: PS80 Study
[0365] To evaluate the changes in drug product quality under stressed conditions, agitation and freeze-thaw studies were performed using a formulation buffer (pH 5.0, 350 mM arginine, 50 mM citric acid). In this experiment, formulations with varying polysorbate 80 concentration were investigated to confirm the effect of polysorbate 80 on sub-visible particle generation under such stressed conditions. The formulations investigated and applied stress conditions are shown in Table 8.
TABLE-US-00008 TABLE 8 Formulations Studied for Agitation and Freeze-Thaw Stress Studies Concentrations of Formulation Polysorbate 80 Stress Condition 100 mg/mL BAN2401 0% Shaking at 250 rpm for 3 days at 5° C. 50 mM citrate buffer 0.02% Shaking at 250 rpm for 3 days at 350 mM Arginine 0.05% ambient temperature pH 5.0 0.1% Three freeze-thaw cycles (−20° C. to ambient temperature)
[0366] The samples were prepared in the same manner as described in Example 4. A 10% PS80 solution was added to achieve the target PS80 concentration in the formulations and the final protein concentration adjustment was performed via dilution with the formulation buffer. The formulations were passed through 0.2 gm filters and filled into 2 mL vials with a 1.3 mL fill volume. The samples were placed on an orbital shaker in a horizontal orientation (vial laying on its side) which was then placed in a refrigerator or on the lab bench. The samples were shaken at 250 rpm for 3 days. Other samples were frozen by placing in a −20° C. chamber for 2 hours, then removed and left at room temperature for 2 hours to thaw. The freeze-thaw cycle was repeated three times. Samples from the agitation and freeze-thaw studies were evaluated for visual appearance, aggregate and fragment levels by SEC-HPLC, and sub-visible particles by Micro Flow Imaging (MFI).
[0367] The results of the agitation and freeze-thaw studies on BAN2401 formulations with varying levels of PS80 are summarized below.
[0368] SEC-HPLC Analysis
[0369] SEC-HPLC analysis was performed utilizing a TSK G3000 SWXL column with 0.2 M sodium phosphate, pH 7.0 mobile phase at a flow rate of 1.0 mL/min. The sample injection volumes were 5.0 μL or 2.5 μL for protein concentrations of 50 or 100 mg/ml, respectively. This ensures approximately 250 μg of protein is injected onto the column across the study. Results of relative peak areas (%) for monomer, aggregate and fragment were reported.
[0370] In the level of aggregates in pH 5 formulations stored at 25° C. for 3 months with varying polysorbate 80 concentrations, there was no significant difference in aggregate levels when the PS80 concentration was increased from 0% to 0.06%, at a formulation pH of 5.0. It is concluded that PS80 does not affect the formation of aggregates, i.e. dimer and trimer as measured by SEC-HPLC, during storage of BAN2401 formulations at 25° C.
[0371] In the effect of polysorbate 80 concentration on fragment levels in formulations at pH 5, polysorbate 80 concentration does not affect fragment levels in BAN2401.
[0372] In the appearance of formulations after shaking at 250 rpm for 3 days at ambient temperature, the sample without PS80 was cloudy with precipitated protein, while the other samples (0.02%, 0.05% and 0.1% polysorbate 80) were visibly clear, particle free solutions. All samples that were shaken at 250 rpm for 3 days at 5° C. were clear and free of precipitate. All samples subjected to freeze/thaw cycles were also clear and free of precipitate.
[0373] The aggregate and fragment levels in BAN2401 formulations subjected to agitation and freeze-thaw are shown in Table 9. The stress condition that caused the greatest instability was agitation under ambient conditions. Under these conditions, the sample without PS80 showed the greatest formation of High Molecular Weight species, and the greatest loss in monomer. This effect was nullified as the PS80 concentration increased.
TABLE-US-00009 TABLE 9 Results of Aggregates and Fragment Levels for the Agitation and Freeze-Thaw Studies Stress Polysorbate HPLC purity (% Area) Condition 80 (%) HMW1.sup.(a) HMW2.sup.(a) Monomer LMW.sup.(b) 5° C. 0 — 0.4 99.4 0.2 (control) 0.02 — 0.5 99.3 0.2 0.05 — 0.5 99.4 0.2 0.1 — 0.5 99.4 0.2 Shaking 0 0.5 0.6 98.7 0.2 at 5° C. 0.02 — 0.5 99.3 0.2 0.05 — 0.5 99.3 0.2 0.1 — 0.5 99.3 0.2 Shaking at 0.sup.(c) 1.5 1.2 97.1 0.2 ambient 0.02 4.0 0.8 95.1 0.2 temper- 0.05 0.1 0.5 99.2 0.2 ature 0.1 — 0.5 99.3 0.2 Three 0 — 0.4 99.4 0.2 freeze/thaw 0.02 — 0.5 99.4 0.2 cycles 0.05 — 0.4 99.4 0.2 0.1 — 0.5 99.4 0.2 .sup.(a)High Molecular Weight Species; .sup.(b)Low Molecular Weight Species; and .sup.(c)Sample was cloudy
[0374] Sub-Visible Particle Analysis
[0375] Sub-visible particle analysis was performed using a Micro Flow Imaging (DPA4100 Flow Microscope and BP-4100-FC-400-UN flow cell). Total sample volume was 0.9 mL and the results were reported for 2.25-100 μm, 5-100 μm, 10-100 μm range, and 25-100 μm range.
[0376] An increase in sub-visible particles (2 to 10 pm) was observed in the samples without PS80 that were subjected to shaking and freeze-thaw. The generation of sub-visible particles was increasingly suppressed as the PS80 concentration in the formulation was increased. This effect was observed in all the size ranges studied. There was no significant change in sub-visible particles in the formulations containing 0.05% and 0.1% polysorbate 80. Therefore, a PS80 concentration of 0.05% was chosen as optimal for the formulation.
[0377] The data would suggest that PS80 has no effect on the formation of BAN2401 aggregates (dimers and trimers) and fragments as measured by SEC-HPLC. Therefore, the PS80 concentration was selected based on the results of the agitation and freeze-thaw studies. A PS80 concentration of 0.05% was chosen to prevent potential precipitation during shipping and to minimize formation of sub-visible particles.
Example 6: Preparation of Intravenous (IV) Formulations of BAN2401
[0378] A. BAN2401 10 mg/mL Formulation
[0379] A BAN2401 10 mg/mL formulation for intravenous injection (“10 mg/mL Injection”) was manufactured by a conventional cGMP aseptic process for preparation of a sterile aqueous formulation. BAN2401 10 mg/mL Injection was produced from the corresponding BAN2401 drug substances formulation below without addition of any excipients and dilution. An exemplary IV formulation containing 10 mg/mL BAN2401 is shown in Table 10.
TABLE-US-00010 TABLE 10 Comparative 10 mg/mL IV formulation comprising BAN2401. component composition BAN2401 10 mg/mL Sodium citrate/Citric acid buffer 25 mM Sodium Chloride 125 mM Polysorbate 80 0.02% (w/v) Water for Injection QS pH 5.7
[0380] The filtered BAN2401 drug substance solution was aseptically filled into vials as illustrated in
[0381] The vials were analyzed using Method 1 (Light Obscuration) according to USP 788. Results are shown in Tables 11 and 12.
TABLE-US-00011 TABLE 11 Particle Size Distribution (particles/container) for 10 mg/mL Injection Vials Lot No. A1 A2 A3 A4 A5 A6 A7 A8 A9 A10 A11 A12 25 μm 1 1 1 0 1 1 1 1 1 1 5 5 2 1 1 10 μm 126 145 469 241 469 225 107 617 249 315 215 273 231 191 125 5 μm — — — 2922 — — — — — — — — — 2 μm — — — 16636 — — — — — — — — —
TABLE-US-00012 TABLE 12 Particle Size Distribution (particles/mL) for 10 mg/mL Injection Vials Lot No. A1 A2 A3 A4 A5 A6 A7 A8 A9 A10 A11 A12 25 μm 0.1 0.1 0.1 0 0.1 0.1 0.1 0.1 0.1 0.1 0.5 0.5 0.2 0.1 0.1 10 μm 12.6 14.5 46.9 24.1 46.9 22.5 10.7 61.7 24.9 31.5 21.5 27.3 23.1 19.1 12.5 5 μm — — — 292.2 — — — — — — — — — 2 μm — — — 1664 — — — — — — — — —
Example 7: Preparation of Intravenous (IV) and Subcutaneous (SC) Formulations of BAN2401
[0382] A. BAN2401 100 mg/mL Formulations
[0383] A BAN2401 100 mg/mL formulation (“100 mg/mL Injection”) was manufactured by a conventional cGMP aseptic process for preparation of a sterile aqueous formulation. BAN2401 100 mg/mL was produced from the corresponding BAN2401 drug substances without addition of any excipients and dilution (Table 13).
TABLE-US-00013 TABLE 13 Exemplary 100 mg/mL IV formulation comprising BAN2401. component composition BAN2401 100 mg/mL Citric acid buffer 50 mM Arginine 110 mM Arginine Hydrochloride 240 mM Polysorbate 80 0.05% (w/v) Water for Injection QS pH 5.0
[0384] The filtered BAN2401 drug substance (100 mg/mL Injection) solution was aseptically filled into vials as illustrated in
[0385] The vials were analyzed using Method 1 (Light Obscuration) according to USP 788. Results are shown in Tables 14 and 15.
TABLE-US-00014 TABLE 14 Particle Size Distribution (particles/vial) for 100 mg/mL Injection Vials Lot No. B1 B2 B3 B4 25 μm 0 0 1 0 10 μm 53 8 9 9 5 μm 631 72 51 60 2 μm 1954 321 249 267
TABLE-US-00015 TABLE 15 Particle Size Distribution (particles/mL) for 100 mg/mL Injection Vials Lot No. B1 B2 B3 B4 25 μm 0 0 0.2 0 10 μm 10.6 1.6 1.8 1.8 5 μm 126.2 14.4 10.2 12 2 μm 390.8 64.2 49.8 53.4
[0386] Another BAN2401 100 mg/mL Injection was manufactured. The following materials can be used in a second exemplary formulation containing 100 mg/mL BAN2401, as shown in Table 16.
TABLE-US-00016 TABLE 16 Another Exemplary 100 mg/mL IV Formulation comprising BAN2401. component composition BAN2401 100 mg/mL Histidine Total 25 mM Histidine HCl Arginine HCl 200 mM Polysorbate 80 0.05% (w/v) Water for infection QS pH 5.0 ± 0.4
B. BAN2401 200 mg/mL Formulation
[0387] The following materials can be used in an exemplary SC formulation containing 200 mg/mL BAN2401, as shown in Table 17. The stability of BAN2401 in these formulations (FSC1, FSC2 and FSC3) were evaluated in conjunction with an evaluation of the material stability in three container closures: [0388] i) Becton-Dickenson Hypak Biotech glass pre-filled syringe (PFS) and stopper [0389] ii) West Crystal Zenith plastic PFS and stopper [0390] iii) West 5 mL glass vial and stopper
TABLE-US-00017 TABLE 17 Exemplary 200 mg/mL SC formulations comprising BAN2401. component composition Sample ID FSC1a FSC1b FSC2 FSC3 FSC4 BAN2401 200 mg/mL 200 mg/mL 200 mg/mL 200 mg/mL 200 mg/mL Histidine Total 50 Total 50 Total 50 — Total 25 Histidine HCl mM .sup.1 mM .sup.1 mM .sup.1 mM .sup.1 Citric Acid — — — 50 mM — Arginine HCl 125 mM 125 mM 125 mM 125 mM 200 mM Polysorbate 80 0.02% (w/v) 0.02% (w/v) 0.02% (w/v) 0.02% (w/v) 0.05% (w/v) Methionine — 5 mM — — — Water for infection QS QS QS QS QS pH 5.0 ± 0.4 5.0 ± 0.4 5.5 ± 0.4 5.0 ± 0.4 5.0 ± 0.4 .sup.1 Total concentration as Histidine
[0391] BAN2401 at a target protein concentration of 200 mg/mL was prepared via TFF as summarized below. A separate TFF operation was performed to prepare BAN2401 material in each formulation buffer, except for FSC1a and FSC1 b. For two of the formulations, one TFF operation was performed, and the resulting concentrated material was split into two half-lots. A small quantity of sterile filtered material in each final formulation buffer was not filled at time zero, but was stored frozen at −20° C. to be filled into the appropriate container closures for syringe testing.
(a) BAN2401 Preparation
[0392] The process of protein concentration/diafiltration via TFF can be subdivided into 3 stages: [0393] 1. Concentration of the material to 100-150 mg/mL [0394] 2. Diafiltration (5×) against formulation buffer [0395] 3. Concentration to >200 mg/mL
[0396] The concentration/diafiltration step was performed using a Pall Centramate LV system installed with 0.02 m.sup.2 of membrane area. The BAN2401 material (pulled from GMP lot manufacture prior to PS80 addition) was charged into the TFF system and a 10-15 fold concentration (stage 1) was performed. The material was then diafiltered against up to 5 diavolumes of the formulation buffer (stage 2), with pH and conductivity checks of the permeate being done to monitor diafiltration. After diafiltration, the material was further concentrated to the target protein concentration of 210 to 250 mg/mL (stage 3). The retentate was collected and samples were taken for protein concentration determination.
[0397] In preparing this formulation, the target protein concentration of 210 to 250 mg/mL was not reached due to high pressure in the TFF system. Therefore, the target protein concentration was achieved by using Millipore centrifugal filter units (30,000 MWCO). To perform this concentration step, filter units were equilibrated with the BAN2401 formulation buffer, followed by centrifugation of the BAN2401 material at 3600 RPM (˜3000×g) for 30 minutes intervals at 20° C., until the protein concentration in the retentate was expected to be greater than 200 mg/mL. The retentate was recovered from the filter units and pooled. After thorough mixing, the pooled retentate was sampled for protein concentration measurements.
[0398] After the protein was concentrated, a sample was taken from the pool and diluted 500-fold with the appropriate formulation buffer. The absorbance of the diluted sample at 280 nm and 320 nm was measured against the buffer blank. The final protein concentration adjustment was performed via dilution with the appropriate formulation buffer. Lastly, 10% PS80 solution was added to the BAN2401 to achieve 0.02% PS80 in the final solution, and the protein solution was thoroughly mixed via end-over-end rotation.
[0399] Final BAN2401 formulated material was filtered using 0.2 μm syringe filters, and subsequently filled into vials or PFS. This step was performed aseptically in a biosafety cabinet. The resulting vials or PFS were placed in a freezer at −20° C. Vials were stored inverted, and PFS were stored horizontally in order to simulate worst case conditions.
C. Stability Experiments on Exemplary 200 mg/mL SC Formulations Comprising BAN2401.
[0400] Sample stability was evaluated at 5° C. (3M, 6M, 9M, 12M) and 25° C. (1M, 3M) using assay for pH (
[0401] Test results showed that 200 mg/ml BAN2401 in all FSC1a-FSC3 formulations had similar levels of aggregates and fragments after storage at 2-8° C. for 12 months. Stability for BAN2401 at 200 mg/mL in the three FSC1a-FSC3 formulations was evaluated. Overall, the stability of BAN2401 in each tested formulation appeared similar, and maintained greater than 98.2% monomer after storage at 5′C for 12 months regardless of the container closure tested. In addition, after storage at 5° C. for 12 months, the pH remained stable, there was no appreciable increase in yellowing by A405.
(a) Protein Concentration (T=0 Samples)
[0402] Protein concentration was measured using a UV-Vis spectrophotometer. The results are listed in Table 18.
TABLE-US-00018 TABLE 18 Protein Concentration Results Sample Protein Concentration ID (mg/ml) FSC1a 206 FSC1b 204 FSC2 201 FSC3 189
[0403] Protein concentration was evaluated by measuring the absorbance at 280 and 320 nm on a Beckman DU-800 spectrophotometer using a 1 cm quartz cuvette. Samples were diluted 500-fold and were prepared in triplicate. Protein concentration was calculated using an extinction coefficient, ε, of 1.32 using the following formula:
Concentration=(A280−A320)/ε×Dilution Factor
(b) Polysorbate 80 (T=0 Samples)
[0404] The PS80 content of samples was measured via quantitation of oleic acid. The results are shown in Table 19.
TABLE-US-00019 TABLE 19 Polysorbate 80 Results Sample ID Polysorbate 80 (%) FSC1a 0.016 FSC1b 0.022 FSC2 0.019 FSC3 0.019
[0405] The measurement was performed by quantitation of oleic acid, a hydrolysis product of PS80. Using base hydrolysis, PS80 releases oleic acid at a 1:1 molar ratio. The oleic acid can then be separated from other PS80 hydrolysis products and matrices using reversed phase HPLC. The oleic acid was monitored without derivatization using the absorbance at 195 nm. [J. Chromatography B, 878 (2010) 1865-1870]. Experimentally, samples were mixed with sodium hydroxide to release oleic acid, which was subsequently extracted with acetonitrile. The extract was diluted with a potassium phosphate solution, and a sample volume of 100 μL was injected into a Waters Symmetry C18 column. The separation was done using an isocratic elution containing 80% organic phase A (acetonitrile) and 20% aqueous phase B (20 mM Potassium Phosphate Monobasic, pH 2.8). The PS80 concentration in the sample was calculated from the peak area using a standard curve.
(c) Osmolality (T=0 Samples)
[0406] The osmolality of samples was determined using a freezing point osmometer. The results are shown in Table 20.
TABLE-US-00020 TABLE 20 Osmolality Results Sample Osmolality ID (mOsmol/kg H.sub.2O) FSC1a 294 FSC1b 309 FSC2 297 FSC3 327
[0407] Osmolality was measured using a Precision Systems Osmette III freezing point osmometer. Samples were diluted 3-fold with WFI, and diluted sample volumes of 10 μL were withdrawn and loaded to the instrument using the osmometer pipette. The resulting osmolality measurements were corrected for sample dilution.
(d) Subvisible Particles
[0408] Subvisible particle analysis was performed using a Fluid Technologies FlowCarn instrument. The T=O results are listed in Table 21. There appears to be an increase in the total particle concentration and number of particles greater than 10 μm over time when material is stored at 5° C. The degree of the increased change was small in the following order, FSC1a<FSC1b<FSC2<FSC3.
TABLE-US-00021 TABLE 21 Subvisible Particle Results Particles/ Particles/ Particles/ Sample mL mL mL ID Total ≥10 μm ≥25 μm FSC1a 1.2 × 10.sup.4 9 0 FSC1b 2.6 × 10.sup.4 0 0 FSC2 2.8 × 10.sup.4 18 0 FSC3 3.9 × 10.sup.4 63 0
[0409] Subvisible particle analysis was performed using a Fluid Imaging Technologies FlowCam with a 20× objective and a 50 um flow cell. Before running BAN2401 samples, the flow cell was flushed with dI H.sub.2O and a measurement was performed on the dI H.sub.2O to ensure the flow cell was clean. If the total number of panicles counted per 0.2 mL of dI H.sub.2O was ≤2, the flow cell was considered ready for use. Samples were equilibrated to room temperature, then diluted 20-fold with deionized water. Duplicate diluted samples were analyzed using a sample volume of 0.2 mL and a sample flowrate of 0.02 ml/min. The autoimage rate was 14, giving an efficiency of 19.6% and a run time of 10 min. The resulting particle concentrations were corrected for sample dilution.
(e) pH
[0410] The pH of each formulation was monitored throughout the stability testing. As shown in
(f) HPLC-SEC
[0411] High Performance Liquid Chromatography Size Exclusion Chromatography (HPLC-SEC) analysis was performed utilizing a TSK 03000 SWXL column with 0.2 M sodium phosphate, pH 7.0 mobile phase at a flow rate of 1.0 mL/min. The sample injection volume was 0.8 μL for a protein concentration of 200 mg/mL. This ensures approximately 150 μg of protein is injected onto the column across the study. Results of relative peak areas (%) for monomer, aggregate and fragment were reported, as shown in
[0412] Physical degradation of the BAN2401 was assessed by performing HPLC-SEC on the stability samples stored at 5 and 25° C. After storage at 5° C. for 12 months, the percent of aggregate was similar for the 3 formulations at approximately 1.1%. The percent fragment generated for all tested formulations was in the range of 0.4-0.5%. The monomer content after 12 months storage at 5° C. was in the range of 98.4-98.6% for all tested formulations and container closures. At the current rates of degradation, it is possible that BAN2401 in all tested formulations could have greater than 97% monomer after up to 24 months storage at 5° C.
[0413] After storage at 25° C. up to 3 months, fragment generation after 3 months was in the range of 0.4-0.8%. Monomer content was slightly greater than 98% for all formulations, except for FSC3, which had slightly less than 98% monomer after 3 months at 25° C.
Example 8: Selection of Protein, Arginine and Polysorbate 80 Concentrations
A. Sample Preparation
[0414] Each candidate formulation (F1-F12) was prepared as follows. Drug substance (DS) process intermediate—was concentrated and equilibrated with the corresponding formulation buffers (Table 22) by centrifugal filter units. After the concentration and equilibration, PS80 dissolved in the formulation buffer was added to achieve pre-determined concentrations, and protein concentrations were adjusted to the final concentration. Each candidate formulation was filled into vials with fill volume of 0.5 mL. Candidate formulations (F1-F12) are shown in Table 22. Formulation F0 was evaluated as a control.
TABLE-US-00022 TABLE 22 Formulation (F0) and candidate formulations F1-F12 Stabilizer Fill Form BAN2401 Buffer (Arginine) Polysorbate 80 volume No. mg/mL mmol/L mg/mL mmol/L mg/mL (w/v) % mg/mL pH mL F0 100 Citrate 50 9.6 350 61.0 0.05 0.5 5.0 5/0.5.sup.b F1 200 Histidine 25 3.9 150 26.1 0.05 0.5 5.0 0.5 F2.sup.a 200 Histidine 25 3.9 200 34.8 0.05 0.5 5.0 0.5 F3 200 Histidine 25 3.9 250 43.6 0.05 0.5 5.0 0.5 F4 200 Histidine 25 3.9 300 52.3 0.05 0.5 5.0 0.5 F5 200 Histidine 25 3.9 350 61.0 0.05 0.5 5.0 0.5 F6 250 Histidine 25 3.9 200 34.8 0.05 0.5 5.0 0.5 F7 300 Histidine 25 3.9 200 34.8 0.05 0.5 5.0 0.5 F8 200 Histidine 25 3.9 200 34.8 0 0 5.0 0.5 F9 200 Histidine 25 3.9 200 34.8 0.02 0.2 5.0 0.5 F10 200 Histidine 25 3.9 200 34.8 0.05 0.5 5.0 0.5 F11 200 Histidine 25 3.9 200 34.8 0.08 0.8 5.0 0.5 F12 200 Histidine 25 3.9 200 34.8 0.10 1.0 5.0 0.5 .sup.aF2 and F10 are the same formulations, prepared for different studies. .sup.bIn the selection of polysorbate 80 concentration, drug solution was withdrawn from drug product and was filled with 0.5 mL to align the fill volume and the container closure system.
B. Stability Protocol
[0415] Stability protocols are shown in Table 23, Table 24, and Table 25. Once removed from storage, the vials were stored at 5° C. until testing. Storage conditions were as follows: [0416] Long-term condition: stored at 5° C.±3° C. upright [0417] Accelerated condition: Stored at 25° C.±2° C., 60% RH±5% RH upright [0418] Stressed condition (Freeze-thaw): Frozen at −30° C. and thawed at room temperature, upright [0419] Stressed condition (Agitation): 5° C., laying down, horizontal, at 250 rpm on a reciprocating shaker with shaking amplitude of 50 mm
TABLE-US-00023 TABLE 23 Stability Protocol (Long-term and Accelerated Condition) Test Point 5° C. ± 3° C. 25° C. ± 2° C., 60% Upright RH ± 5% RH Upright Test item Initial 3M 1M 3M Appearance F0-F7 F0-F7 F0-F7 F0-F7 pH F0-F7 F0-F7 F0-F7 F0-F7 Size exclusion HPLC F0-F7 F0-F7 F0-F7 F0-F7 Ion exchange HPLC F0-F7 F0-F7 NA F0-F7 Polysorbate 80 F0-F7 F0-F7 F0-F7 F0-F7 N/A: Not applicable.
TABLE-US-00024 TABLE 24 Stability Protocol (Stressed Condition: F0-F7) Test Point Freeze-thaw (−30° C. ⇔ room temperature) Test item Initial 3 cycles Appearance F0-F7 F6-F7 pH F0-F7 F0-F7 Size exclusion HPLC F0-F7 F0-F7 Ion exchange HPLC F0-F7 F0-F7 Polysorbate 80 F0-F7 N/A Protein concentration F0-F7 N/A Viscosity F0-F7 N/A Osmolality F0-F7 N/A N/A: Not applicable.
TABLE-US-00025 TABLE 25 Stability Protocol (Stressed Condition: F0, F8-F12) Test Point Freeze-thaw Agitation (−30° C. ⇔ (5° C., lay down, room horizontal, temperature) 250 rpm) Test item Initial 3 cycles 3 days Appearance F0, F8-F12 F0, F8-F12 F0, F8-FF2 pH F0, F8-F12 F0, F8-F12 F0, F8-F12 Protein concentration F0, F8-F12 F0, F8-F12 F0, F8-F12 Foreign insoluble matter F0, F8-F12 F0, F8-F12 F0, F8-F12 Visible particles) Size exclusion HPLC F0, F8-F12 F0, F8-F12 F0, F8-F12 (SEC) Polysorbate 80 (PS80) F0, F9-F12 F0, P9-F12 F0, F9-F12 Micro-flow imaging (MFI) F0, F8-F12 F0, F8-F12 F0, F8-F12 N/A: Not applicable.
[0420] Since the viscosity of solution is known to increase exponentially at highly concentrated protein solutions, protein concentration of each candidate formulation (F1-F5) were adjusted to 200±10 mg/mL with formulation buffer containing 0.05 (w/v) % of PS80 for the analysis. Other formulations were not diluted before the measurement.
C. Results and Discussion
(a) Selection of Arginine Concentration
[0421] To select the target arginine concentration in the formulation, physical properties were evaluated and freeze-thaw, long-term, and accelerated stability studies were conducted for candidate formulations with different arginine concentration (150 to 350 mmol/L, F1 to F5) and compared to formulation F0 (see, Table 22). Physical properties and the results of freeze-thaw study were shown in Table 26. The results of long-term and accelerated stability study were shown in Table 27 and Table 28.
TABLE-US-00026 TABLE 26 Results of Physical Properties and Freeze-thaw Stability Study for BAN2401 Drug Product (F0-F5) Arg 150 Arg 200 Arg 250 Arg 300 Arg 350 (Control) mM mM mM mM mM Freeze- Freeze- Freeze- Freeze- Freeze- Freeze- Acceptance F0 thaw F1 thaw F2 thaw F3 thaw F4 thaw F5 thaw Test item Criterion Initial (3 cycle) Initial (3 cycle) Initial (3 cycle) Initial (3 cycle) Initial (3 cycle) Initial (3 cycle) Appearance Report result CSYL NS CSYL NS CSYL NS CSYL NS CSYL NS CSYL NS pH Report result 5.00 5.01 4.89 4.90 4.90 4.90 4.90 4.91 4.90 4.90 4.93 4.92 Size Report result 98.8% 98.8% 98.7% 98.7% 98.7% 98.7% 98.8% 98.7% 98.8% 98.8% 98.8% 98.8% exclusion Monomer HPLC Aggregate 0.9% 0.9% 1.0% 1.0% 1.0% 1.0% 1.0% 1.0% 1.0% 1.0% 1.0% 1.0% Fragment 0.3% 0.3% 0.3% 0.3% 0.3% 0.3% 0.3% 0.3% 0.3% 0.3% 0.2% 0.2% Ion Report result 67.2% 67.2% 67.1% 70.6% 70.4% 70.7% 67.6% 67.9% 70.1% 67.3% 70.7% 70.5% exchange Main peak HPLC Acidic peak 27.3% 27.1% 24.5% 23.3% 23.2% 23.1% 24.1% 24.2% 23.5% 24.6% 23.1% 23.5% Basic peak 5.4% 5.7% 8.4% 6.2% 6.4% 6.2% 8.3% 7.9% 6.3% 8.1% 6.3% 6.1% Polysorbate Report result 0.053% N/A 0.054% N/A 0.052% N/A 0.050% N/A 0.037% N/A 0.032% N/A 80 (w/v %) Protein Report result 103 N/A 224 N/A 222 N/A 213 N/A 207 N/A 217 N/A concen- (mg/mL) tration Viscosity.sup.a Report result 2.6 N/A 7.3 N/A 7.8 N/A 8.0 N/A 8.1 N/A 8.0 N/A (cP) Protein conc. N/A N/A 204 N/A 210 N/A 203 N/A 200 N/A 199 N/A (mg/mL) Osmolality Report result 506 N/A 367 N/A 455 N/A 533 N/A 615 N/A 691 N/A (mOsm/kg) mM: mmol/L, CSYL: Clear slightly yellow liquid. Arg: Arginine. NS: Not scheduled. .sup.aProtein concentration was adjusted before viscosity measurement (F1-F5).
TABLE-US-00027 TABLE 27 Results of Stability Study for BAN2401 Drug Product (F0-F7) Stored at 5 ± 3° C., Upright Position Acceptance F0 F1 F2 F3 Test item Criterion Initial 3M Initial 3M Initial 3M Initial 3M Appearance Report result CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL pH Report result 5.00 4.95 4.89 4.85 4.90 4.85 4.90 4.85 Size exclusion Report result 98.8% 98.6% 98.7% 98.4% 98.7% 98.4% 98.8% 98.4% HPLC Monomer Aggregate 0.9% 1.0% 1.0% 1.2% 1.0% 1.2% 1.0% 1.2% Fragment 0.3% 0.4% 0.3% 0.4% 0.3% 0.4% 0.3% 0.4% Ion exchange Report result 67.2% 66.0% 67.1% 69.0% 70.4% 69.4% 67.6% 69.0% HPLC Main peak Acidic peak 27.3% 26.7% 24.5% 23.6% 23.2% 23.9% 24.1% 24.2% Basic peak 5.4% 7.2% 8.4% 7.4% 6.4% 6.7% 8.3% 6.9% Polysorbate 80 Report result 0.053% 0.056% 0.054% 0.057% 0.052% 0.055% 0.050% 0.054% (w/v %) Acceptance F4 F5 F6 F7 Test item Criterion Initial 3M Initial 3M Initial 3M Initial 3M Appearance Report result CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL pH Report result 4.90 4.85 4.93 4.86 4.88 4.82 4.85 4.81 Size exclusion Report result 98.8% 98.4% 98.8% 98.4% 98.5% 98.3% 98.5% 98.2% HPLC Monomer Aggregate 1.0% 1.2% 1.0% 1.2% 1.1% 1.3% 1.2% 1.3% Fragment 0.3% 0.4% 0.2% 0.4% 0.4% 0.4% 0.4% 0.4% Ion exchange Report result 70.1% 69.9% 70.7% 71.0% 71.1% 69.5% 71.2% 70.1% HPLC Main peak Acidic peak 23.5% 23.2% 23.1% 22.5% 22.7% 23.6% 22.8% 23.1% Basic peak 6.3% 6.8% 6.3% 6.5% 6.2% 6.8% 6.0% 6.8% Polysorbate 80 Report result 0.037% 0.055% 0.052% 0.052% 0.056% 0.055% 0.051% 0.052% (w/v %) CSYL: Clear slightly yellow liquid.
TABLE-US-00028 TABLE 28 Results of Stability Study for BAN2401 Drug Product (F0-F7) Stored at 25 ± 2° C., 60% ± 5% RH, Upright Position Accept- Test ance F0 F1 F2 F3 item Criterion Ini 1M 3M Ini 1M 3M Ini 1M 3M Ini 1M 3M Appear- Report CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL ance result pH Report 5.00 4.97 4.96 4.89 4.86 4.85 4.90 4.85 4.84 4.90 4.86 4.85 result SEC Report 98.8% 98.6% 98.1% 98.7% 98.2% 97.5% 98.7% 98.2% 97.5% 98.8% 98.2% 97.6% result Monomer Aggregate 0.9% 0.9% 1.0% 1.0% 1.4% 1.7% 1.0% 1.4% 1.7% 1.0% 1.3% 1.6% Fragment 0.3% 0.5% 0.8% 0.3% 0.5% 0.8% 0.3% 0.5% 0.8% 0.3% 0.5% 0.8% IEX Report 67.2% NS 59.6% 67.1% NS 63.0% 70.4% NS 63.1% 67.6% NS 63.1% result Main Acidic 27.3% NS 33.8% 24.5% NS 29.4% 23.2% NS 29.6% 24.1% NS 29.1% Basic 5.4% NS 6.6% 8.4% NS 7.6% 6.4% NS 7.4% 8.3% NS 7.8% PS80 Report 0.053% 0.053% 0.052% 0.054% 0.052% 0.052% 0.052% 0.050% 0.050% 0.050% 0.050% 0.049% result (w/v %) Accept- Test ance F4 F5 F6 F7 item Criterion Ini 1M 3M Ini 1M 3M Ini 1M 3M Ini 1M 3M Appear- Report CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL ance result pH Report 4.90 4.86 4.85 4.93 4.87 4.86 4.88 4.84 4.82 4.85 4.83 4.81 result SEC Report 98.8% 98.2% 97.6% 98.8% 98.3% 97.6% 98.5% 98.1% 97.3% 98.5% 98.0% 97.1% result Monomer Aggregate 1.0% 1.3% 1.6% 1.0% 1.3% 1.6% 1.1% 1.4% 1.9% 1.2% 1.5% 2.0% Fragment 0.3% 0.5% 0.8% 0.2% 0.5% 0.8% 0.4% 0.5% 0.8% 0.4% 0.5% 0.9% IEX Report 70.1% NS 63.3% 70.7% NS 63.9% 71.1% NS 63.0% 71.2% NS 63.1% result Main Acidic 23.5% NS 29.1% 23.1% NS 28.3% 22.7% NS 29.5% 22.8% NS 28.8% Basic 6.3% NS 7.5% 6.3% NS 7.8% 6.2% NS 7.5% 6.0% NS 8.1% PS80 Report 0.037% 0.051% 0.052% 0.052% 0.049% 0.049% 0.056% 0.053% 0.053% 0.051% 0.050% 0.049% result (w/v %) CSYL: Clear slightly yellow liquid., Ini: Initial. SEC: Size exclusion HPLC, IEX: Ion exchange HPLC. PS80: Polysorbate 80. NS: Not scheduled.
(b) Physical Properties
[0422] As shown in Table 26, osmolality values increased as the arginine concentration increased. F1, F2 and F3 showed lower osmolality values as compared to F4 and F5. Therefore, arginine concentration was limited to 250 mmol/L, or less. Viscosity values of F1-F5 were within a narrow range (7.3-8.1 cP) and were not correlated with arginine concentration within 150 to 350 mmol/L. The results of appearance, pH and concentration of PS80 and protein were almost at the target.
(c) Freeze-Thaw Stability Study
[0423] No significant changes were observed in all testing items after three cycles of freeze-thaw testing as shown in Table 26.
(d) Long-Term Stability Study
[0424] As shown in Table 27, no significant changes were observed in all testing items except for size exclusion HPLC (SEC) after three-month storage. Amounts of aggregate and fragment by SEC slightly increased in candidate formulations F1-F5. Each increase rate was similar to the formulation F0.
(e) Accelerated Stability Study
[0425] As shown in Table 28, no significant changes were observed in all testing items except for SEC and ion exclusion HPLC (IEX). Although the amount of aggregate by SEC increased in all the candidates (F1-F5, BAN2401 200 mg/mL) and the rate was faster than formulation F0 as expected, all the candidates were considered to be feasible considering the results in long-term condition and the stability of F0 with a long shelf-life. The higher arginine concentration resulted in slightly slower aggregate formation, consistent with the results described in Example 4. The amount of fragment by SEC also increased in all the candidates but the rate was similar to that in the formulation F0. As for IEX, the amount of acidic peak increased in all the candidates but the rate was similar to that in F0.
(f) Arginine Concentration
[0426] As shown in Table 26, F4 and F5 (at arginine concentrations of 300 and 350 mmol/L) were not considered feasible in the view of osmolality. Among feasible candidates F1, F2 and F3 (at arginine concentrations of 150, 200 and 250 mmol/L), F1 is the closest to isotonic. As shown in Table 28, formulations with higher arginine concentrations showed lower aggregate formation rate in accelerated stability studies but the difference in rate was not significant at the arginine concentration range evaluated. Taking both isotonicity and aggregate formation rate into consideration, 200 mmol/L was selected as the target arginine concentration based on the F2 formulation.
(g) Selection of Protein Concentration
[0427] To select the target protein concentration in the formulation, physical properties were evaluated and freeze-thaw, long-term, and accelerated stability studies were conducted for candidate formulations with different protein concentration (200 to 300 mg/mL, F2, F6, F7) and formulation F0. Physical properties and the results of freeze-thaw study are shown in Table 29. The results of long-term and accelerated stability studies were shown in Table 27 and Table 28.
TABLE-US-00029 TABLE 29 Results of Physical Properties and Freeze-thaw Stability Study for BAN2401 Drug Product (F0, F6 and F7) BAN2401 BAN2401 BAN2401 (Control) 200 mg/mL 250 mg/mL 300 mg/mL Acceptance F0.sup.a Freeze-thaw F2.sup.a Freeze-thaw F6 Freeze-thaw F7 Freeze-thaw Test item Criterion Initial (3 cycle) Initial (3 cycle) Initial (3 cycle) Initial (3 cycle) Appearance Report result CSYL NS CSYL NS CSYL CSYL CSYL CSYL pH Report result 5.00 5.01 4.90 4.90 4.88 4.83 4.85 4.86 Size Report result 98.8% 98.8% 98.7% 98.7% 98.5% 98.5% 98.5% 98.4% exclusion Monomer HPLC Aggregate 0.9% 0.9% 1.0% 1.0% 1.1% 1.1% 1.2% 1.2% Fragment 0.3% 0.3% 0.3% 0.3% 0.4% 0.4% 0.4% 0.4% Ion exchange Report result 67.2% 67.2% 70.4% 70.7% 71.1% 71.2% 71.2% 71.4% HPLC Main peak Acidic peak 27.3% 27.1% 23.2% 23.1% 22.7% 22.6% 22.8% 22.5% Basic peak 5.4% 5.7% 6.4% 6.2% 6.2% 6.2% 6.0% 6.1% Polysorbate Report result 0.053% NS 0.052% NS 0.056% NS 0.051% NS 80 (w/v (%)) Protein Report result 103 NS 222 NS 242 NS 299 NS concentration (mg/mL) Viscosity Report result 2.6 NS 7.8 NS 21 NS 48 NS (cP) (210 mg/mL) Osmolality Report result 506 NS 455 NS 507 NS 554 NS (mOsm/kg) CSYL: Clear slightly yellow liquid. NS: Not scheduled. .sup.aResults are the same in Table 26
(h) Physical Properties
[0428] As shown in Table 29, F2 and F6 showed lower osmolality values as compared to F7. Viscosity values in F2, F6 and F7 were 7.8, 21 and 48 cP, respectively. High viscosity over 20 cP would cause difficulties in manufacturing DS by increasing the back-pressure of the pump and decreasing the transmembrane flux during ultrafiltration and diafiltration steps. In addition, higher concentration solution makes DP filling process more difficult by clogging of filling needles that lead to fill weight variation. Since the desired viscosity is reported to be not more than 20 cP.sup.3, F2 was feasible. The results of appearance, pH and concentration of PS80 and protein were almost on target.
(i) Freeze-Thaw Study
[0429] No significant changes were observed in all the tested items after three cycles of freeze-thaw testing as shown in Table 29.
(j) Long-Term Stability Study
[0430] As shown in Table 27, no significant changes were observed other than size exclusion HPLC (SEC) after three-month storage. Amount of aggregate by SEC slightly increased in candidate formulations F2, F6 and F7 but increase rate was similar to that in F0.
(k) Accelerated Stability Study
[0431] As shown in Table 28, no significant changes were observed other than SEC and ion exclusion HPLC (IEX). The amount of aggregate by SEC increased in all the candidates (F2, F6 and F7) in similar rates at three-month timepoint (0.7-0.8% increase). Therefore, all the candidates were considered feasible. The amount of fragment by SEC also increased in all the candidates but the rate was similar to that in F0. As for IEX, the amount of acidic peak by IEX increased in all the candidates but the rate was similar to that in F0.
(l) Protein Concentration
[0432] Considering the results of osmolality and viscosity shown in Table 29, and the overall stability results shown in Table 27 and Table 28, protein concentration of 200 mg/mL was selected.
(m) Selection of PS80 Concentration
[0433] To select the target PS80 concentration in the formulation, freeze-thaw and agitation studies were conducted for candidate formulations with different PS80 concentration [0 to 0.10 (w/v) %, F8-F12] and formulation F0. The results of freeze-thaw and agitation study are shown in Table 30 and Table 31, respectively.
TABLE-US-00030 TABLE 30 Results of Freeze-thaw Study for BAN2401 Drug Product (F0, F8-F12) PS80 PS80 PS80 PS80 PS8 0 0.02 0.05 0.08 0.10 (Control) w/v % w/v% w/v% w/v% w/v % Freeze- Freeze- Freeze- Freeze- Freeze- Freeze- Acceptance F0 thaw F8 thaw F9 thaw F10 thaw F11 thaw F12 thaw Test item Criterion Initial (3 cycle) Initial (3 cycle) Initial (3 cycle) Initial (3 cycle) Initial (3 cycle) Initial (3 cycle) Appearance Report result CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL pH Report result 4.98 4.98 4.85 4.86 4.85 4.86 4.85 4.86 4.85 4.86 4.85 4.85 Visible Report result FVP FVP FVP FVP FVP FVP FVP FVP FVP FVP FVP FVP particles Size Report result 98.3% 98.4% 98.0% 98.0% 98.0% 97.9% 98.0% 98.0% 98.0% 98.0% 98.0% 98.0% exclusion Monomer HPLC Aggregate 1.0% 1.0% 1.1% 1.1% 1.1% 1.1% 1.1% 1.1% 1.1% 1.1% 1.1% 1.1% Fragment 0.7% 0.7% 0.9% 0.9% 0.9% 1.1% 0.9% 1.0% 0.9% 0.9% 0.9% 0.9% Polysorbate Report result 0.051% 0.050% <0.010% <0.010% 0.020% 0.019% 0.051% 0.050% 0.083% 0.082% 0.106% 0.104% 80 (w/v %) Protein Report result 105 104 187 187 190 187 190 190 187 189 190 191 concen- (mg/mL) tration MFI Report result (unit/mL) ≥25 μm 1 0 55 4 1 1 0 0 3 5 1 0 10-25 μm 4 11 1065 83 14 11 5 8 3 14 8 5 5-10 μm 27 73 1317 287 15 20 8 53 51 56 19 59 2-5 μm 150 308 2321 1172 43 80 50 339 174 304 47 358 CSYL: Clear slightly yellow liquid, FVP: Free from visible particles.
TABLE-US-00031 TABLE 31 Results of Agitation Study for BAN2401 Drug Product (F0, F8-F12) PS80 PS80 PS80 PS80 PS8 0 0.02 0.05 0.08 0.10 (Control) w/v % w/v % w/v % w/v % w/v % Agi- Agi- Agi- Agi- Agi- Agi- Accept- tation tation tation tation tation tation ance F0 250 F8 250 F9 250 F10 250 F11 250 F12 250 Test item Criterion Initial rpm/3D Initial rpm/3D Initial rpm/3D Initial rpm/3D Initial rpm/3D Initial rpm/3D Appear- Report CSYL CSYL CSYL OWL CSYL CSYL CSYL CSYL CSYL CSYL CSYL CSYL ance result pH Report 4.98 4.99 4.87 4.89 4.87 4.87 4.87 4.88 4.88 4.87 4.88 4.88 result Visible Report FVP FVP FVP FVP FVP FVP FVP FVP FVP FVP FVP FVP particles result Size Report 98.3% 98.3% 97.8% 95.3% 97.9% 97.9% 98.0% 98.0% 98.0% 98.0% 98.1% 98.0% exclusion result HPLC Monomer Aggregate 1.0% 1.0% 1.1% 3.8% 1.1% 1.1% 1.1% 1.1% 1.1% 1.1% 1.1% 1.1% Fragment 0.7% 0.7% 1.1% 0.9% 1.1% 1.0% 0.9% 0.9% 0.9% 0.9% 0.9% 0.9% Poly- Report 0.051% 0.049% <0.010% <0.010% 0.019% 0.019% 0.053% 0.054% 0.086% 0.084% 0.107% 0.108% sorbate result 80 (w/v %) Protein Report 105 105 206 195 207 206 206 206 209 207 209 206 concen- result tration (mg/mL) MFI Report result ≥25 μm 1 3 24 NT.sup.a 3 1 0 0 1 0 0 1 10-25 μm 4 10 555 NT.sup.a 4 5 3 5 3 6 3 6 5-10 μm 27 27 1242 NT.sup.a 25 22 18 45 67 34 28 27 2-5 μm 150 75 3209 NT.sup.a 62 50 67 176 145 335 182 250 CSYL: Clear slightly yellow liquid, OWL: Opalescent white liquid, FVP: Free from visible particles. NT: Not tested. .sup.aResults are not reported since particles could not be correctly measured by bubble contamination due to insufficient sample volume.
(n) Freeze-Thaw Study
[0434] As shown in Table 30, no significant changes were observed in all the tested items after three cycles of freeze-thaw testing. Particle counts by MFI were relatively high in F8 (without PS80).
(o) Agitation Study
[0435] As shown in Table 31, formulations containing 0.02 (w/v) % to 0.10 (w/v) % of PS80 (F9 to F12) were stable after agitation. Changes were observed in F8 (without PS80) for appearance, protein concentration and aggregate amount by SEC after agitation. Appearance was changed from clear slightly yellow liquid to opalescent white liquid. Protein concentration slightly decreased from 206 to 195 mg/mL. Aggregate amount increased from 1.1% to 3.8%. Therefore, F8 (without PS80) was not considered feasible.
(p) PS80 Concentration
[0436] Based on the results shown in Table 30 (freeze-thaw study) and Table 31 (agitation study), formulations containing 0.02 (w/v) % to 0.10 (w/v) % of PS80 were stable after three cycle of freeze-thaw and agitation up to three days. Therefore, PS80 concentration of 0.05 (w/v) % was selected as the target.
(q) Conclusion
[0437] In conclusion, the following formulation was selected for BAN2401 formulation for subsequent studies.
TABLE-US-00032 TABLE 32 Formulation for Subsequent Studies Formulation BAN2401 Buffer Stabilizer (Arginine) Polysorbate 80 No. mg/mL mmol/L mg/mL mmol/L mg/mL (w/v) % mg/mL pH F2 200 Histidine 25 3.9 200 34.8 0.05 0.5 5.0
Example 9: Stability Study for 200 mg/mL BAN2401 Formulations with Different pH
[0438] A stability study was conducted to test the stability of BAN2401 formulations at 200 mg/mL with different pH. In addition, the impact of methionine addition on drug product (DP) stability were tested.
A. Sample Preparation
[0439] Each candidate formulation (Table 33) was prepared as follows. Formulations were equilibrated with corresponding formulation buffer by centrifugal filter units. Only for F20 preparation, formulation buffer at 3.5 of a pH was used until the pH of filtrated solution achieved to 4.0 since protons are repelled by concentrated charged protein near semipermeable membrane, known as Donnan effect. After concentration and equilibration, PS80 dissolved in the formulation buffer was added to achieve pre-determined concentration and then the protein concentration was adjusted to the final concentration. Each candidate formulation was filled into vials with fill volume of 0.5 mL. Formulation F0 (see, Table 33) was evaluated as a control.
TABLE-US-00033 TABLE 33 Composition of Drug Substance and Candidate SC Formulations Fill BAN2401 Buffer Stabilizer Polysorbate 80 volume No. mg/mL mmol/L mg/mL mmol/L mg/mL (w/v) % mg/mL pH.sup.a mL/Vial F0 100 Citrate 50 9.6 Arg 350 61.0 0.05 0.5 5.0 5 F13 200 Histidine 25 3.9 Arg 200 34.8 0.05 0.5 4.5 0.5 F15 200 Histidine 25 3.9 Arg 200 34.8 0.05 0.5 5.0 0.5 F17 200 Histidine 25 3.9 Arg 200 34.8 0.05 0.5 5.5 0.5 F18 200 Histidine 25 3.9 Arg 200 34.8 0.05 0.5 5.0 0.5 Met 10 1.5 F20 200 Histidine 25 3.9 Arg 200 34.8 0.05 0.5 4.0 0.5 F21.sup.b 200 Histidine 25 3.9 Arg 200 34.8 0.05 0.5 5.0 0.5 F22 200 Histidine 25 3.9 Arg 200 34.8 0.05 0.5 6.0 0.5 Arg: Arginine, Met: Methionine .sup.aTo adjust pH, arginine and arginine hydrochloride was combined for F0 and hydrochloride was added for F13 through F22. .sup.bF21 is the same formulation as F15
B. Storage Protocol
[0440] Storage protocols are shown in Table 34, Table 35, and Table 36. Once removed from storage, the vials were stored at 5° C. until the testing started. Storage conditions are as follows: [0441] Long-term condition: stored at 5° C.±3° C. upright [0442] Accelerated condition: Stored at 25° C.±2° C., 60% RH±5% RH upright [0443] Stressed condition (Freeze-thaw): Frozen at −30° C. and thawed at room temperature, upright
1000 lx: 25° C.±2° C., 60% RH±5% RH, lay down with light exposure of 1000 lx
Dark: 25° C.±2° C. 60% RH±5% RH, lay down without light exposure by covering with aluminum foil
[0444] To confirm aggregate level after three-month or longer storage, size exclusion HPLC was additionally evaluated as extended storage samples at nine-months for long-term and three-months for accelerated stability study. Latter samples were tested after stored in refrigerator for six months.
TABLE-US-00034 TABLE 34 Sampling Schedule for Long-term Stability Study (5° C. ± 3° C. Upright) F13, F17 F0, F15, F18 F20, F21, F22 5° C. 5° C. 5° C. Initial 2M 9M.sup.a Initial 2M 9M.sup.a Initial 3M Color X X NT X X NT X X Clarity X X NT X X NT X X Particles X X NT X X NT X X pH X X NT X X NT X X Protein X X NT X X NT X X conc ELISA X X NT X X NT NT NT FcR X X NT X X NT NT NT cSDS-R X X NT X X NT NT NT cSDS-NR X X NT X X NT NT NT SEC X X X X X X X X IEX X X NT X X NT X X Viscosity X NT NT X NT NT X NT Osmolality X NT NT X NT NT X NT PS80 X X NT X X NT X X MFI X X NT X X NT X NT PMAP-R NT NT NT X X NT NT NT X: Conducted, NT: Not tested Color: Degree of coloration of liquids, Clarity: Clarity and degree of opalescence, Protein conc: Protein concentration, ELISA: Antigen binding ELISA, FcR: Binding assay (CD32a), cSDS: Capillary SDS Gel Electrophoresis R: Reduced, NR: Non-reduced, SEC: Size exclusion HPLC, IEX: Ion exchange HPLC, PS80: Polysorbate 80 content, MFI: Micro-flow imaging. PMAP: Peptide map .sup.aExtended evaluation
TABLE-US-00035 TABLE 35 Sampling Schedule for Accelerated Stability Study (25° C. ± 2° C., 60% RH ± 5% RH Upright) F13, F17 F0, F15, F18 F20, F21, F22 25° C. 23° C. 25° C. Test items Initial 1M, 2M Ex Initial 1M 2M Ex Initial 1M 3M Color X X NT X X X NT X X X Clarity X X NT X X X NT X X X Particles X X NT X X X NT X X X pH X X NT X X X NT X X X Protein conc X X NT X X X NT X X X ELISA X X NT X X X NT NT NT NT FcR X X NT X X X NT NT NT NT cSDS-R X X NT X X X NT NT NT NT cSDS-NR X X NT X X X NT NT NT NT SEC X X X X X X X X X X IEX X X NT X X X NT X X X Viscosity X NT NT X NT NT NT X NT NT Osmolality X NT NT X NT NT NT X NT NT PS80 X X NT X X X NT X X X MFI X X NT X X X NT X X NT PMAP-R NT NT NT X NT X NT NT NT NT Ex: Extended evaluation, stored for 3M at 25° C. and for 6M at 5° C. after sample pull X: Conducted, NT: Not tested Color: Degree of coloration of liquids, Clarity: Clarity and degree of opalescence, Protein conc: Protein concentration, ELISA: Antigen binding ELISA, FcR: Binding assay (CD32a), cSDS: Capillary SDS Gel Electrophoresis R: Reduced, NR: Non-reduced, SEC: Size exclusion HPLC, IEX: Ion exchange HPLC, PS80: Polysorbate 80 content, MFI: Micro-flow imaging, PMAP: Peptide map
TABLE-US-00036 TABLE 36 Sampling Schedule for Freeze-thaw and Photo-stability study F15 F18 Test FT Dark 1000 lx FT Dark 1000 lx items Initial 3cycle 7 D 7 D Initial 3cycle 7 D 7 D Color X X X X X X X X Clarity X X X X X X X X Particles X X X X X X X X Pro conc X X X X X X X X pH X X X X X X X X PS80 X X X X X X X X ELISA X X X X X X X X FcR X X X X X X X X cSDS-R X X X X X X X X cSDS- X X X X X X X X NR SEC X X X X X X X X IEX X X X X X X X X PMAP- X NT X X X NT X X R FT: Freeze-thaw (Frozen at −30° C. and thawed at room temperature. Upright), Dark: 25° C. ± 2° C., 60% RH ± 5% RH, lay down without light exposure by covering with aluminum foil. 1000 lx: 25° C. ± 2° C., 60% RH ± 5% RH, lay down with light exposure of 1000 lx by fluorescent light. X: Conducted, Color: Degree of coloration of liquids, Clarity: Clarity and degree of opalescence, MFI: Micro-flow imaging, Pro conc: Protein concentration, PS80: Polysorbate 80 content, ELISA: Antigen binding ELISA, FcR: Binding assay (CD32a), cSDS: Capillary SDS Gel Electrophoresis, R: Reduced, NR: Non-reduced, SEC: Size exclusion HPLC, IEX: Ion exchange HPLC, PMAP: Peptide map
C. Results and Discussion
[0445] Physical properties were evaluated and long-term, and accelerated studies were conducted for candidate formulations including pH variation (pH 4.0 to pH 6.0), and methionine addition. Freeze-thaw and photo-stability studies were also conducted to evaluate the efficiency of methionine addition.
D. pH Variation
[0446] As shown in Table 37, Table 38A and 38B, Table 39, and Table 40, no significant differences among candidate formulations (F13, F15, F17 and F20 to F22) were observed for any testing items except for size exclusion HPLC (SEC). Formulation F20 (i.e., a formulation with lower pH of 4.0), showed lower amount of aggregates by SEC at initial timepoint. In addition, slightly lower rate of aggregates formation and higher rate of fragments formation were observed in an accelerated stability study. Results of formulations with pH from 4.5 to 5.5 were confirmed to be comparable.
TABLE-US-00037 TABLE 37 Results of Stability Study for Formulations of BAN2401 with pH 4.0 to 6.0, Stored at 5° C. ± 3° C., Upright Position Acceptance F0 (Control) F13 pH 4.5 F15 pH 5.0 Test item Criterion Initial 5° C./2M Initial 5° C./2M Initial 5° C./2M Color Report result BY5 BY5 BY5 BY5 BY5 BY5 Clarity Report result ≤RS2 ≤RS3 ≤RS3 ≤RS3 ≤RS2 ≤RS3 Particles Report result FVP FVP FVP FVP FVP FVP pH Report result 4.95 4.98 4.63 4.64 4.94 4.96 Protein Report result 104 102 200 201 197 195 conc (mg/L) ELISA Report result 101.3% 102.6% 109.2% 104.5% 102.1% 123.1% FcR Report result 91.7% 93.8% 101.0% 100.4% 108.8% 99.0% cSDS-R Report result 98.3% 97.7% 98.8% 98.2% 98.9% 98.5% cSDS-NR Report result 91.2% 91.9% 91.5% 92.5% 91.2% 92.9% SEC Monomer ≥ 98.6% 98.7% 99.2% 99.2% 99.1% 99.1% 95.0% Aggregate ≤ 1.0% 0.9% 0.8% 0.8% 0.9% 0.9% 5.0% Report Fragment 0.5% 0.4% <0.1% <0.1% <0.1% <0.1% IEX Main 50%-90% 71.3% 70.8% 77.2% 73.1% 76.7% 72.9% Acidic 24.4% 25.2% 19.1% 19.5% 19.4% 19.7% Basic 4.2% 4.0% 3.7% 7.4% 3.9% 7.4% Viscosity Report result 2.6 NT 8.1 NT 7.9 NT Osmolality Report result 512 NT 416 NT 407 NT Polysorbate Report result 0.048% 0.051% 0.044% 0.047% 0.044% 0.047% 80 (w/v %) MFI Report result ≥25 μm 1 5 3 3 7 3 10-25 μm 4 81 99 5 26 26 5-10 μm 27 283 537 67 335 170 2-5 μm 150 1452 980 276 1246 977 Acceptance F17 pH 5.5 F20 pH 4.0 Test item Criterion Initial 5° C./2M Initial 5° C./2M Color Report result BY5 BY5 BY5 BY5 Clarity Report result ≤RS3 ≤RS3 ≤RS3 ≤RS3 Particles Report result FVP FVP FVP FVP pH Report result 5.68 5.73 4.03 4.05 Protein Report result 204 204 197 195 conc (mg/L) ELISA Report result 107.0% 125.7% NT NT FcR Report result 116.6% 103.4% NT NT cSDS-R Report result 98.8% 98.4% NT NT cSDS-NR Report result 91.3% 92.6% NT NT SEC Monomer ≥ 98.8% 98.8% 99.3% 99.1% 95.0% Aggregate ≤ 1.2% 1.2% 0.7% 0.7% 5.0% Report Fragment <0.1% <0.1% 0.1% 0.2% IEX Main 50%-90% 76.8% 72.8% 76.8% 74.7% Acidic 19.4% 19.9% 18.8% 21.6% Basic 3.8% 7.2% 4.4% 3.6% Viscosity Report result 10.0 NT 8.0 NT Osmolality Report result 402 NT 420 NT Polysorbate Report result 0.043% 0.045% 0.052% 0.049% 80 (w/v %) MFI Report result ≥25 μm 0 0 0 NT 10-25 μm 17 10 10 NT 5-10 μm 214 207 152 NT 2-5 μm 1365 1273 698 NT Acceptance F21 pH 5.0 F22 pH 6.0 Test item Criterion Initial 5° C./3M Initial 5° C./3M Color Report result BY5 BY5 BY5 BY5 Clarity Report result ≤RS3 ≤RS3 ≤RS3 ≤RS3 Particles Report result FVP FVP FVP FVP pH Report result 4.91 4.92 5.90 5.91 Protein Report result 200 195 207 195 conc (mg/L) ELISA Report result NT NT NT NT FcR Report result NT NT NT NT cSDS-R Report result NT NT NT NT cSDS-NR Report result NT NT NT NT SEC Monomer ≥ 99.2% 99.0% 98.8% 98.6% 95.0% Aggregate ≤ 0.8% 1.0% 1.2% 1.4% 5.0% Report Fragment <0.1% <0.1% <0.1% <0.1% IEX Main 50%-90% 76.7% 75.2% 76.6% 74.8% Acidic 18.9% 21.1% 19.1% 21.3% Basic 4.3% 3.7% 4.3% 3.9% Viscosity Report result 9.4 NT 11.6 NT Osmolality Report result 423 NT 396 NT Polysorbate Report result 0.052% 0.052% 0.051% 0.048% 80 (w/v %) Report result ≥25 μm 0 NT 0 NT 10-25 μm 5 NT 14 NT 5-10 μm 5 NT 76 NT 2-5 μm 95 NT 322 NT BY5: Equal to reference solution BY5 RS2: Reference suspension I, RS3: Reference nspension HL FVP: Free from visible particles, NT: Not tested.
TABLE-US-00038 TABLE 38A Results of Stability Study for Formulations of BAN2401 with pH 4.0 to 6.0, Stored at 25° C. ± 2° C., 60% RH ± 5% RH, Upright Position F0 (Control) F13 pH 4.5 F15 pH 5.0 Test Acceptance 25° C./ 25° C./ 25° C./ 25° C./ 25° C./ 25° C./ item Criterion Initial 1M 2M Initial 1M 2M Initial 1M 2M Color Report BY5 BY5 BY5 BY5 BY5 BY5 BY5 BY5 BY5 Clarity Report ≤RS2 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 Particles Report FVP FVP FVP FVP FVP FVP FVP FVP FVP pH Report 4.95 4.94 4.99 4.63 4.63 4.66 4.94 4.96 4.98 Protein Report 104 103 101 200 201 199 197 194 192 conc (mg/ml) ELISA Report 101.3% 102.7% 91.8% 109.2% 104.5% 107.0% 102.1% 103.6% 96.9% FcR Report 91.7% 95.3% 93.5% 101.0% 99.4% 101.5% 108.8% 98.3% 102.2% cSDS-R Report 98.3% 98.1% 97.2% 98.8% 98.9% 97.9% 98.9% 98.8% 98.0% cSDS- Report 91.2% 89.7% 90.4% 91.5% 89.6% 90.1% 91.2% 89.5% 90.0% NR SEC Monomer ≥ 98.6% 98.4% 98.4% 99.2% 98.6% 98.4% 99.1% 98.4% 98.2% 95.0% Aggregate ≤ 1.0% 1.0% 0.9% 0.8% 1.1% 1.2% 0.9% 1.4% 1.5% 5.0% Report 0.5% 0.5% 0.7% <0.1% 0.2% 0.4% <0.1% 0.1% 0.3% Fragment IEX Main 50%- 71.3% 69.4% 67.7% 77.2% 75.4% 74.1% 76.7% 75.2% 71.4% 90% Acidic 24.4% 26.3% 28.2% 19.1% 20.3% 22.0% 19.4% 20.6% 23.2% Basic 4.2% 4.4% 4.1% 3.7% 4.3% 3.8% 3.9% 4.2% 5.4% F17 pH 5.5 F20 pH 4.0 Test Acceptance 25° C./ 25° C./ 25° C./ 25° C./ item Criterion Initial 1M 2M Initial 1M 3M Color Report BY5 BY5 BY5 BY5 BY5 BY5 Clarity Report ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 Particles Report FVP FVP FVP FVP FVP FVP pH Report 5.68 5.68 5.72 4.03 4.02 4.10 Protein Report 204 207 203 197 198 193 conc (mg/ml) ELISA Report 107.0% 107.4% 101.6% NT NT NT FcR Report 116.6% 103.8% 104.9% NT NT NT cSDS-R Report 98.8% 98.7% 98.1% NT NT NT cSDS-NR Report 91.3% 89.7% 90.8% NT NT NT SEC Monomer ≥ 95.0% 98.8% 98.2% 98.2% 99.3% 98.4% 97.4% Aggregate ≤ 5.0% 1.2% 1.8% 1.7% 0.7% 1.0% 0.9% Report Fragment <0.1% 0.1% 0.1% 0.1% 0.6% 1.7% IEX Main 50%-90% 76.8% 76.0% 72.9% 76.8% 68.9% 64.3% Acidic 19.4% 20.2% 22.5% 18.8% 23.9% 32.0% Basic 3.8% 3.8% 4.6% 4.4% 7.2% 3.7% F21 pH 5.0 F22 pH 6.0 Test Acceptance 25° C./ 25° C./ 25° C./ 25° C./ item Criterion Initial 1M 3M Initial 1M 3M Color Report BY5 BY5 BY5 BY5 BY5 BY5 Clarity Report ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 Particles Report FVP FVP FVP FVP FVP FVP pH Report 4.91 4.91 4.94 5.90 5.91 5.91 Protein Report 200 198 194 207 204 194 conc (mg/ml) ELISA Report NT NT NT NT NT NT FcR Report NT NT NT NT NT NT cSDS-R Report NT NT NT NT NT NT cSDS-NR Report NT NT NT NT NT NT SEC Monomer ≥ 95.0% 99.2% 98.6% 98.4% 98.8% 98.2% 98.1% Aggregate ≤ 5.0% 0.8% 1.3% 1.3% 1.2% 1.7% 1.7% Report Fragment <0.1% 0.1% 0.4% <0.1% 0.1% 0.2% IEX Main 50%-90% 76.7% 71.2% 67.5% 76.6% 71.2% 67.6% Acidic 18.9% 21.9% 28.5% 19.1% 22.1% 28.3% Basic 4.3% 7.0% 4.0% 4.3% 6.7% 4.0% BY5: Equal to reference solution BY.sub.5 RS2: Reference suspension II, RS3: Reference suspension III, FVP: Free from visible particles. NT: Not tested. Report: Report result
TABLE-US-00039 TABLE 38B Ac- F0 (Control) F13 pH 4.5 F15 Test ceptance 25° C./ 25° C./ 25° C./ 25° C./ pH 5.0 item Criterion Initial 1M 2M Initial 1M 2M Initial Vis- Report 2.6 NT NT 8.1 NT NT 7.9 cos- (cP) ity Os- Report 512 NT NT 416 NT NT 407 mol- (mOsm/ ality kg) Poly- Report 0.048% 0.052% 0.050% 0.044% 0.047% 0.045% 0.044% sor- (w/v %) bate 80 MFI ≥25 μm 1 5 0 3 0 3 7 10-25 μm 4 3 35 99 51 23 26 5-10 μm 27 81 292 537 769 163 335 2-5 μm 150 457 1830 980 3139 647 1246 Ac- F15 pH 5.0 F17 pH 5.5 Test ceptance 25° C./ 25° C./ 25° C./ 25° C./ item Criterion 1M 2M Initial 1M 2M Vis- Report NT NT 10.0 NT NT cos- (cP) ity Os- Report NT NT 402 NT NT mol- (mOsm/ ality kg) Poly- Report 0.047% 0.043% 0.043% 0.041% 0.042% sor- (w/v %) bate 80 MFI ≥25 μm 0 0 0 10 5 10-25 μm 49 35 17 46 49 5-10 μm 959 714 214 597 553 2-5 μm 2919 1963 1365 2243 1778 F20 pH 4.0 F21 Acceptance 25° C./ 25° C./ pH 5.0 Test item Criterion Initial 1M 3M Initial Vis- Report 8.0 NT NT 9.4 cosity (cP) Osm- Report 420 NT NT 423 olality (mOsm/kg) Polysor- Report: 0.052% 0.049% 0.042% 0.052% bate 80 (w/v %) MFI ≥25 μm 0 0 NT 0 10-25 μm 10 26 NT 5 5-10 μm 152 246 NT 5 2-5 μm 698 454 NT 95 Acceptance F21 pH 5.0 F22 pH 6.0 Test item Criterion 25° C./ 25° C./ 25° C./ 25° C./ 1M 3M Initial 1M 3M Vis- Report NT NT 11.6 NT NT cosity (cP) Osm- Report NT NT 396 NT NT olality (mOsm/kg) Poly- Report: 0.053% 0.051% 0.051% 0.048% 0.043% bate 80 (w/v %) MFI ≥25 μm 0 NT 0 0 NT 10-25 μm 3 NT 14 3 NT 5-10 μm 7 NT 76 35 NT 2-5 μm 69 NT 322 285 NT NT: Not tested. Report: Report result
TABLE-US-00040 TABLE 39 Results of Extended Stability Study for Formulations with pH 4.5 to 5.5, Stored at 5° C. ± 3° C., Upright Position F0 (Control) F13 pH 4.5 F15 pH 5.0 F17 pH 5.5 5° C./ 5° C./ 5° C./ 5° C./ 5° C./ 5° C./ 5° C./ 5° C./ Test item Initial 2M 9M Initial 2M 9M Initial 2M 9M Initial 2M 9M Size exclusion Monomer 98.6% 98.7% 98.6% 99.2% 99.2% 98.8% 99.1% 99.1% 98.6% 98.8% 98.8% 98.3% HPLC Aggregate 1.0% 0.9% 1.0% 0.8% 0.8% 1.1% 0.9% 0.9% 1.4% 1.2% 1.2% 1.7% Fragment 0.5% 0.4% 0.5% <0.1% <0.1% 0.1% <0.1% 0.1% 0.1% <0.1% 0.1% <0.1%
TABLE-US-00041 TABLE 40 Results of Extended Stability Study for Current and Lead Formulation with pH 4.5 to 5.5, Stored at 25° C. ± 2° C., 60% RH ± 5% RH, Upright Position F0 (Control) F13 pH 4.5 F15 pH 5.0 25° C./ 25° C./ 25° C./ 3M + 3M + 3M + 25° C./ 25° C./ 5° C./ 25° C./ 25° C./ 5° C./ 25° C./ 25° C./ 5° C./ Test item Initial 1M 2M 6M Initial 1M 2M 6M Initial 1M 2M 6M Size Monomer 98.6% 98.4% 98.4% 98.0% 99.2% 98.6% 98.4% 97.7% 99.1% 98.4% 98.2% 97.7% exclusion Aggregate 1.0% 1.0% 0.9% 1.0% 0.8% 1.1% 1.2% 1.3% 0.9% 1.4% 1.5% 1.8% HPLC Fragment 0.5% 0.5% 0.7% 0.9% <0.1% 0.2% 0.4% 0.8% <0.1% 0.1% 0.3% 0.5% F17 pH 5.5 25° C./ 25° C./ 25° C./ 3M + 5° C./ Test item Initial 1M 2M 6M Size Monomer 98.8% 98.2% 98.2% 97.7% exclusion Aggregate 1.2% 1.8% 1.7% 2.0% HPLC Fragment <0.1% 0.1% 0.1% 0.3%
E. Methionine Addition
[0447] As shown in Tables 41A and 41B, and Table 42 to Tables 46, no significant difference was observed between formulations with or without methionine (F18 and F15). Formulation with methionine (F18) showed slightly lower rate of aggregate formation in extended a long-term stability study, accelerated stability study, and photostability study. F18 also showed slightly lower oxidation of methionine residue (e.g., at position 259 in the heavy chains) in light exposure with 1000 lux up to seven days. Freeze-thaw study did not show any difference. The effect of 10 mmol/L of methionine as a stabilizer was limited.
TABLE-US-00042 TABLE 41A Results of Stability Study for Formulations with or without Met, Stored at 5° C. ± 3° C., Upright Position F0 (Control) F15 Met(−) F18 Met(+) Test item Acceptance Criterion Initial 5° C./2M Initial 5° C./2M Initial 5° C./2M Color Repon result BY5 BY5 BY5 BY5 BY5 BY5 Clarity Report result ≤RS2 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 Particles Report result FVP FVP FVP FVP FVP FVP pH Report result (mg/mL) 4.95 4.98 4.94 4.96 4.95 4.98 Protein conc Report result 104 102 197 195 191 189 ELISA Report result 101.3% 102.6% 102.1% 123.1% 108.2% 118.1% FcR Report result 91.7% 93.8% 108.8% 99.0% 92.4% 94.7% cSDS-R Report result 98.3% 97.7% 98.9% 98.5% 98.9% 98.5% cSDS-NR Report result 91.2% 91.9% 91.2% 92.9% 91.5% 92.7% SEC Monomer ≥ 95.0% 98.6% 98.7% 99.1% 99.1% 99.2% 99.1% Aggregate ≤ 5.0% 1.0% 0.9% 0.9% 0.9% 0.8% 0.9% Report Fragment 0.5% 0.4% <0.1% <0.1% <0.1% <0.1% IEX Main 50%-90% 71.3% 70.8% 76.7% 72.9% 77.2% 75.9% Acidic 24.4% 25.2% 19.4% 19.7% 19.0% 19.2% Basic 4.2% 4.0% 3.9% 7.4% 3.8% 4.9% Met: Methionine, BY5: Equal to reference solution BY.sub.5, RS2: Reference suspension II, RS3: Reference suspension III, FVP: Free from visible particles
TABLE-US-00043 TABLE 41B F0 (Control) F15 Me(−) F18 Met (+) Test item Acceptance Criterion Initial 5° C./2M Initial 5° C./2M Initial 5° C./2M Viscosity Report result (cP) 2.6 NT 7.9 NT 7.3 NT Osmolality Report result (mOsm/kg) 512 NT 407 NT 416 NT Polysorbate 80 Report result (w/v %) 0.048% 0.051% 0.044% 0.047% 0.045% 0.039% MFI ≥25 μm 1 5 7 3 0 0 10-25 μm 4 81 26 26 3 0 5- 10 μm 27 283 335 170 131 130 2-5 μm 150 1452 1246 977 691 163 Met: Methionine, NT: Not tested.
TABLE-US-00044 TABLE 42 Results of Stability Study for Formulations with or without Met, Stored at 25° C. ± 2° C., 60% RH ± 5% RH, Upright Position Acceptance F0 (Control) F15 Met(−) F18 Met(+) Test item Criterion Initial 25° C./1M 25° C./2M Initial 25° C./1M 25° C./2M Initial 25° C./1M 25° C./2M Color Report result BY5 BY5 BY5 BY5 BY5 BY5 BY5 BY5 BY5 Clarity Report result ≤RS2 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 Particles Report result FVP FVP FVP FVP FVP FVP FVP FVP FVP pH Report result 4.95 4.94 4.99 4.94 4.96 4.98 4.95 4.94 4.97 Protein conc Report result 104 103 101 197 194 192 191 192 189 ELISA Report result 101.3% 102.7% 91.8% 102.1% 103.6% 96.9% 108.2% 97.0% 97.8% FcR Report result 91.7% 95.5% 93.5% 108.8% 98.3% 102.2% 92.4% 91.9% 92.9% cSDS-R Report result 98.3% 98.1% 97.2% 98.9% 98.8% 98.0% 98.9% 98.8% 98.1% cSDS-NR Report result 91.2% 89.7% 90.4% 91.2% 89.5% 90.0% 91.5% 89.8% 90.6% SEC Monomer ≥ 98.6% 98.4% 98.4% 99.1% 98.4% 98.2% 99.2% 98.6% 98.5% 95.0% Aggregate ≤ 1.0% 1.0% 0.9% 0.9% 1.4% 1.5% 0.8% 1.2% 1.2% 5.0% Report Fragment 0.5% 0.5% 0.7% <0.1% 0.1% 0.3% <0.1% 0.1% 0.3% IEX Main 50%-90% 71.3% 69.4% 67.7% 76.7% 75.2% 71.4% 77.2% 76.1% 72.9% Acidic 24.4% 26.3% 28.2% 19.4% 20.6% 23.2% 19.0% 20.2% 22.6% Basic 4.2% 4.4% 4.1% 3.9% 4.2% 5.4% 3.8% 3.7% 4.4% Viscosity Report result 2.6 NT NT 7.9 NT NT 7.3 NT NT (cP) Osmolality Report result 512 NT NT 407 NT NT 416 NT NT (mOsm/kg) Polysorbate Report result 0.048% 0.052% 0.050% 0.044% 0.047% 0.043% 0.045% 0.043% 0.038% 80 (w/v %) MFI ≥25 μm 1 5 0 7 0 0 0 0 3 10-25 μm 4 3 35 26 49 35 5 7 65 5-10 μm 27 81 292 335 959 714 131 230 647 2-5 μm 150 457 1830 1246 2919 1963 691 792 2516 Met: Methioine, NT: Not tested, BY5: Equal to reference solution BY.sub.5, RS2: Reference suspension II, RS3: Reference suspension III, FVP: Free from visibile particles, NT: Not tested.
TABLE-US-00045 TABLE 43 Results of Extended Stability Study for Current and Lead Formulation with or without Met, from DS1 or DS2, Stored at 5° C. + 3° C., Upright Position F0 (Control) F15 Met(−) F18 Met(+) 5° C./ 5° C./ 5° C./ 5° C./ 5° C./ 5° C./ Test item Initial 2M 9M Initial 2M 9M Initial 2M 9M Size exclusion Monomer 98.6% 98.7% 98.6% 99.1% 99.1% 98.6% 99.2% 99.1% 98.7% HPLC Aggregate 1.0% 0.9% 1.0% 0.9% 0.9% 1.4% 0.8% 0.9% 1.2% Fragment 0.5% 0.4% 0.5% <0.1% <0.1% 0.1% <0.1% <0.1% 0.1% Met: Methionine
TABLE-US-00046 TABLE 44 Results of Extended Stability Study for Formulations with or without Met, Stored at 25° C. ± 2° C., 60% RH ± 5% RH, Upright Position F0 (Control) F15 Met(−) F18 Met(+) 25° C./ 25° C./ 25° C./ 3M + 3M + 3M + 25° C./ 25° C./ 5° C./ 25° C./ 25° C./ 5° C./ 25° C./ 25° C./ 5° C./ Test item Initial 1M 2M 6M Initial 1M 2M 6M Initial 1M 2M 6M Size Monomer 98.6% 98.4% 98.4% 98.0% 99.1% 98.4% 98.2% 97.7% 99.2% 98.6% 98.5% 98.0% exclusion Aggregate 1.0% 1.0% 0.9% 1.0% 0.9% 1.4% 1.5% 1.8% 0.8% 1.2% 1.2% 1.5% HPLC Fragment 0.5% 0.5% 0.7% 0.9% <0.1% 0.1% 0.3% 0.5% <0.1% 0.1% 0.3% 0.5% Met: Methionine
TABLE-US-00047 TABLE 45 Results of Stressed (Freeze-thaw and Photo-stability) Study for Formulations with or without Methionine Acceptance F15 Met(−) F18 Met (+) Test item Criterion Initial FT 3cycle 25° C. Dark/7 D 25° C. 1000 lx/7 D Initial FT 3cycle vColor Report result BY5 BY5 BY5 BY5 BY5 BY5 Clarity Report result ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 ≤RS3 Particles Report result FVP FVP FVP FVP FVP FVP pH Report result 4.94 4.94 4.94 4.94 4.95 4.94 Protein conc Report result 197 197 190 193 191 190 ELISA Report result 102.1% 107.7% 107.0% 100.9% 108.2% 103.8% FcR Report result 108.8% 107.5% 104.0% 117.6% 106.0% 105.6% cSDS-R Report result 98.9% 99.3% 99.3% 98.7% 98.9% 99.1% cSDS-NR Report result 91.2% 93.0% 92.6% 92.0% 91.5% 92.8% Size Monomer ≥ 95.0% 99.1% 99.0% 98.9% 97.5% 99.2% 99.1% exclusion Aggregate ≤ 3.0% 0.9% 1.0% 1.0% 2.4% 0.8% 0.9% HPLC Report Fragment <0.1% <0.1% 0.1% 0.1% <0.1% <0.1% IEX Main 50%-90% 76.7% 73.5% 74.8% 65.5% 77.2% 77.3% Acidic 19.4% 20.8% 20.9% 20.3% 19.0% 18.8% Basic 3.9% 5.8% 4.4% 14.2% 3.8% 3.9% Viscosity Report result 7.9 NT NT NT 7.3 NT Osmolality Report result 407 NT NT NT 416 NT Polysorbate Report result 0.044% 0.047% 0.046% 0.046% 0.045% 0.047% 80 (w/v %) MFI ≥25 μm 7 0 NT 44 0 5 10-25 μm 26 76 NT 278 3 44 5-10 μm 335 661 NT 1074 131 294 2-5 μm 1246 2704 NT 3293 691 1289 Acceptance F18 Met (+) Test item Criterion 25° C. Dark/7 D 25° C. 1000 lx/7 D vColor Report result BY5 BY5 Clarity Report result ≤RS3 ≤RS3 Particles Report result FVP FVP pH Report result 4.93 4.92 Protein conc Report result 189 190 ELISA Report result 104.7% 109.1% FcR Report result 104.8% 109.4% cSDS-R Report result 99.3% 98.7% cSDS-NR Report result 92.9% 91.4% Size Monomer ≥ 95.0% 98.9% 97.9% exclusion Aggregate ≤ 3.0% 1.0% 2.0% HPLC Report Fragment 0.1% 0.1% IEX Main 50%-90% 76.2% 62.7% Acidic 19.8% 20.0% Basic 3.9% 17.3% Viscosity Report result NT NT Osmolality Report result NT NT Polysorbate Report result 0.042% 0.046% 80 (w/v %) MFI ≥25 μm NT 14 10-25 μm NT 99 5-10 μm NT 698 2-5 μm NT 2491 FT: freeze-thaw, (Frozen at −30° C. and thawed at room temperature. Upright), 25° C.: 25° C. ± 2° C. 60% RH ± 5% RH. 1000 lx: lay down with light exposure of 1000 lx. Dark: lay down without light exposure by covering with aluminum foil. Met: Methionine, BY5: Equal to reference solution BY.sub.5, RS3: Reference suspension III, FVP: Free from visible particles, NT: Not tested
TABLE-US-00048 TABLE 46 Results of Reduced Peptide Map F0 F15 Met (−) 5° C. 25° C. 5° C. 25° C. 25° C. 25° C. Formulation No. Initial 2M 2M Initial 2M 2M Dark, 7 D 1000 lux, 7 D Sequence HC 100.0% 100.0% 100.0% 100.0% 100.0% 100.0% 100.0% 100.0% Coverage LC 99.5% 100.0% 100.0% 100.0% 98.6% 100.0% 100.0% 98.6% Dea- HC N332 8.7% 8.4% 8.3% 8.2% 7.6% 7.6% 7.6% 7.8% midation LC N33 11.0% 11.6% 12.3% 11.1% 10.4% 11.3% 10.8% 10.5% Oxidation HC M259 <1% 4.5% 5.0% 3.5% 4.0% 5.8% 4.3% 12.4% HC M356 <1% <1% <1% <1% <1% <1% <1% 1.9% HC M435 3.4% 2.4% 2.8% 1.9% 2.1% 2.7% 2.7% 9.6% LC M4 1.5% 1.5% 1.5% 1.6% 1.8% 1.7% 1.8% 2.2% Lys loss HC K454 95.6% 96.0% 95.8% 98.7% 98.6% 98.6% 98.6% 98.7% N-Glycan A2G0 3.1% 3.0% 2.8% 2.3% 2.3% 2.2% 2.2% 2.2% HC N304 A2G0F 57.0% 55.5% 55.2% 52.2% 54.3% 53.0% 53.3% 53.1% A2G1F 34.8% 34.1% 34.6% 37.8% 38.1% 39.1% 38.7% 38.1% A2G2P 5.2% 5.1% 5.2% 5.7% 5.3% 5.7% 5.9% 5.4% M5 0.0% 1.2% 1.1% 1.0% 0.0% 0.0% 0.0% 0.0% M8 0.0% 1.2% 1.1% 1.0% 0.0% 0.0% 0.0% 1.1% F18 Met (+) 5° C. 25° C. 25° C. 25° C. Initial 2M 2M Dark, 7 D 1000 lux, 7 D Sequence HC 100.0% 100.0% 100.0% 100.0% 100.0% Coverage LC 98.6% 100.0% 100.0% 98.6% 98.6% Dea- HC N332 7.7% 7.2% 7.2% 7.7% 7.6% midation LC N33 11.0% 10.9% 11.3% 10.3% 10.7% Oxidation HC M259 2.7% 2.7% 2.8% 3.1% 9.4% HC M356 <1% <1% <1% <1% <1% HC M435 1.7% 1.4% 1.5% 0.8% 8.2% LC M4 1.6% 1.5% 1.4% 1.7% 1.7% Lys loss HC K454 98.5% 98.7% 98.7% 98.6% 98.6% N-Glycan A200 2.3% 2.3% 2.3% 2.3% 2.3% HC N304 A2G0F 52.9% 52.7% 53.8% 53.3% 53.6% A2G1F 39.1% 39.4% 38.4% 39.1% 38.8% A2G2P 5.6% 5.6% 5.4% 5.3% 5.4% MS 0.0% 0.0% 0.0% 0.0% 0.0% MS 0.0% 0.0% 0.0% 0.0% 0.0% Met: Methionine, 5° C.: 5° C. ± 3° C., 25° C.: 25° C. ± 2° C., 60% RH ± 5% RH, 1000 lx: lay down with light exposure of 1000 lx, Dark: lay down without light exposure by covering with aluminum foil. HC: heavy chain, LC: light chain
F. Conclusion
[0448] Quality attributes were comparable among formulations of BAN2401 with pH variation from pH 4.5 to pH 5.5. s at pH 4.0 showed lower aggregate formation rate and, on the contrary, faster fragment formation rate during storage. We saw no significant difference between formulations with and without methionine at a concentration of 10 mmol/L based on evaluations of quality, stability studies including long-term, accelerated, freeze-thaw, and photo. Though slightly slower aggregate formation rate and minor suppression in oxidation of amino acid residue were observed, the differences were not significant. In conclusion, F15 and F21, which were composed of 200 mg/mL of BAN2401, 25 mmol/L of L-histidine/histidine hydrochloride, 200 mmol/L of L-arginine, 0.05 (w/v) % of polysorbate 80 at a pH of 5.0f 0.5 were determined to be good drug substance candidates for further development.
Example 10: Investigation on Effect of Arginine Concentration to the Stability of BAN2401 Formulation
[0449] The effect of arginine concentration (0, 50, 100, and 200 mmol/L) to the stability of BAN2401 at 200 mg/mL was evaluated. The samples of each arginine concentration level were stored at accelerated condition (25° C./60%/*RH) and tested at 0, 1, and 2 months.
A. Sample Preparation
[0450] Samples (F1-F4) were prepared by buffer exchange of the concentrated BAN2401 drug substance process intermediate by ultrafiltration. After aseptic filtration, each 0.4 mL sample was filled into vial. The sample information is shown in Table 47.
TABLE-US-00049 TABLE 47 Sample information Formulation Stabilizer Polysorbate No. BAN2401 Buffer (Arginine) 80 pH F1 200 mg/mL Histidine 0 mmol/L 0.05 5.0 25 mmol/L (w/v)% F2 200 mg/mL Histidine 50 mmol/L 0.05 5.0 25 mmol/L (w/v) F3 200 mg/mL Histidine 100 mmol/L 0.05 5.0 25 mmol/L (w/v)% F4 200 mg/mL Histidine 200 mmol/L 0.05 5.0 25 mmol/L (w/v)%
B. Results
[0451] Results of this stability study for samples F1 to F4 are shown in Table 48 to 51. There was no difference in pH and protein concentration between samples, and the arginine concentration level were consistent with the target for initial samples.
[0452] Aggregates % for samples containing arginine (F2 to F4) were lower than that of the sample without arginine (F1).
TABLE-US-00050 TABLE 48 Test results of sample F1 (Arginine 0 mmol/L targeted) Test items Initial 1M 2M pH 5.1 — — Protein concentration (mg/mL) 195 — — SEC Monomer area % 98.3% 98.0% 97.8% Aggregates area % 1.6% 1.7% 1.9% Fragments area % 0.1% 0.2% 0.3% Arginine concentration (mmol/L) 47 — —
TABLE-US-00051 TABLE 49 Test results of sample F2 (Arginine 50 mmol/L targeted) Test items Initial 1M 2M pH 5.0 — — Protein concentration (mg/mL) 192 — — SEC Monomer area % 98.4% 98.1% 97.8% Aggregates area % 1.5% 1.7% 1.8% Fragments area % 0.1% 0.2% 0.4% Arginine concentration (mmol/L) 47 — —
TABLE-US-00052 TABLE 50 Test results of sample F3 (Arginine 100 mmol/L targeted) Test items Initial 1M 2M pH 5.0 — — Protein concentration (mg/mL) 198 — — SEC Monomer area % 98.4% 98.1% 97.8% Aggregates area % 1.5% 1.7% 1.8% Fragments area % 0.1% 0.2% 0.4% Arginine concentration (mmol/L) 87 — —
TABLE-US-00053 TABLE 51 Test results of sample F4 (Arginine 200 mmol/L targeted) Test items Initial 1M 2M pH 5.0 — — Protein concentration (mg/mL) 191 — — SEC Monomer area % 98.4% 98.1% 97.9% Aggregates area % 1.5% 1.6% 1.7% Fragments area % 0.1% 0.2% 0.4% Arginine concentration (mmol/L) 173 — —
C. Discussion and Conclusion
[0453] Results of this study indicated that arginine concentrations of 50 to 200 mmol/L prevent increases of protein aggregates in BAN2401 200 mg/ml formulation. Variation of arginine concentration between batches may result in variation in aggregate % between batches. In addition, arginine concentration may affect increase trend of aggregates % in the stability study.
[0454] The formulation comprising histidine buffer appeared to show effect on reducing fragmentation of BAN2401 as compared the percentage of fragmentation in the sample F1 with the percentage of fragmentation shown in
SEQUENCE LISTING
[0455]
TABLE-US-00054 TABLE 52 Amino acid sequences of mAb variable regions SEQ IgG ID mAb chain NO Amino acid sequence BAN2401 Heavy 1 EVQLVESGGGLVQPGGSLRLSCSASGF chain TFSSFGMHWVRQAPGKGLEWVAYISS GSSTIYYGDTVKGRFTISRDNAKNSLFL QMSSLRAEDTAVYYCAREGGYYYGRS YYTMDYWGQGTTVTVSS BAN2401 Light 2 DVVMTQSPLSLPVTPGAPASISCRSSQSI chain VHSNGNTYLEWYLQKPGQSPKLLIYKV SNRFSGVPDRFSGSGSGTDFTLRISRVE AEDVGIYYCFQGSHVPPTFGPGTKLEIK
TABLE-US-00055 TABLE 53 Amino acid sequences of mAb constant regions SEQ IgG ID mAb chain Class NO Amino acid sequence BAN2401 Heavy IgG1 3 ASTKGPSVFPLAPSSKSTSGGT chain AALGCLVKDYFPEPVTVSWN SGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNV NHKPSNTKVDKRVEPKSCDK THTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEA LHNHYTQKSLSLSPGK BAN2401 Light kappa 4 RTVAAPSVFIFPPSDEQLKSGT chain ASVVCLLNNFYPREAKVQWK VDNALQSGNSQESVTEQDSK DSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNR GEC
TABLE-US-00056 TABLE 54 Amino acid sequences of mAb CDRs mAb IgG chain SEQ ID NO Amino acid sequence BAN2401 HCDR1 5 SFGMH HCDR2 6 YISSGSSTIYYGDTVKG HCDR3 7 EGGYYYGRSYYTMDY BAN2401 LCDR1 8 RSSQSIVHSNGNTYLE LCDR2 9 KVSNRFS LCDR3 10 FQGSHVPPT Heavy Chain (SEQ ID NO: 11): evqlvesggglvqpggslrlscsasgftfssfgmhwvrqapgkglewvay issgsstiyygdtvkgrftisrdnaknslflqmsslraedtavyycareg gyyygrsyytmdywgqgttvtvssastkgpsvfplapsskstsggtaalg clvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpsssl gtqtyicnvnhkpsntkvdkrvepkscdkthtcppcpapellggpsvflf ppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpre eqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqp repqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykt tppyldsdgsfflyskltvdksrwqqgnvfsesymhealhnhytqkslsi spgk Light Chain (SEQ ID NO: 12): dvvmtqsplslpvtpgapasiscrssqsivhsngntylewylqkpgqspk lliykvsnrfsgvpdrfsgsgsgtdftlrisrveaedvgiyycfqgshvp ptfgpgtkleikrtvaapsvfifppsdeqlksgtasyycllnnfypreak vqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkvyace vthgglsspvtksfnrgec