Calprotectin Assay

Abstract

Disclosed herein are immunoassay methods for detecting and quantifying human neutrophil elastase (HNE) generated fragments of calprotectin in a biofluid sample; and monoclonal antibodies and assay kits for use in such methods. The methods may be used for detecting, monitoring and/or determining the status or severity of a disease characterized by or exhibiting inflammation in a patient.

Claims

1: An immunoassay method for detecting an HNE-generated fragment of calprotectin, said method comprising contacting a human biofluid sample with a monoclonal antibody that specifically recognises and binds to an HNE-generated neo-epitope consisting of an N-terminus or C-terminus sequence of the HNE-generated fragment of calprotectin, and detecting binding between the monoclonal antibody and peptides in the sample.

2: The method as claimed in claim 1, wherein the detection is quantitative, and wherein the method further comprises determining the amount of binding between said monoclonal antibody and peptides in the sample.

3: The method as claimed in claim 2, wherein the method is an immunoassay method for detecting and/or monitoring the progress of and/or determining the status or severity of a disease in a patient, wherein the disease is a disease characterized by or exhibiting inflammation, the method comprising contacting a biofluid sample obtained from said patient with the monoclonal antibody, detecting and determining the amount of binding between the monoclonal antibody and peptides in the sample, and correlating said amount of binding with values associated with normal healthy subjects and/or with values associated with a known status or severity of the disease and/or with values obtained from said patient at a previous time point and/or with a predetermined cut-off value.

4: The method as claimed in claim 3, wherein the disease is an inflammatory driven disease.

5: The method as claimed in claim 4, wherein the disease is inflammatory bowel disease (IBD), rheumatoid arthritis, psoriasis, psoriasis arthritis, ankylosing spondylitis, osteoarthritis.

6: The method as claimed in claim 3, wherein the disease is chronic obstructive pulmonary disease (COPD) or idiopathic pulmonary fibrosis (IPF).

7: The method as claimed in claim 3, wherein the disease is a cancer.

8: The method as claimed in claim 7, wherein the disease is metastatic melanoma, small cell lung cancer (SCLC) or non-small cell lung cancer (NSCLC).

9: The method as claimed in claim 1, wherein the monoclonal antibody is a monoclonal antibody raised against a synthetic peptide comprising said N-terminus or C-terminus sequence.

10: The method as claimed in claim 1, wherein the monoclonal antibody specifically recognises and binds to an N-terminus or C-terminus sequence of a peptide selected from one of the following HNE-generated fragments of calprotectin: TABLE-US-00015 (SEQ ID NO: 1) KLGHPDTLNQGEFKELV, (SEQ ID NO: 2) RKDLQNFLKKENKNEKV, (SEQ ID NO: 3) RKDLQNFLKKENKNEKVI, (SEQ ID NO: 4) EHIMEDLDTNADKQL, (SEQ ID NO: 5) SHEKMHEGDEGPGHHHKPGLGEGTP, (SEQ ID NO: 6) YRDDLKKLLET, and (SEQ ID NO: 7) WFKELDINTDGAV.

11: The method as claimed in claim 1, wherein the monoclonal antibody specifically recognises and binds to an N-terminus or C-terminus sequence of the peptide KLGHPDTLNQGEFKELV (SEQ ID NO: 1).

12: The method as claimed in claim 1, wherein the monoclonal antibody specifically recognises and binds to said N-terminus sequence of the HNE-generated fragment of calprotectin and does not specifically recognise or bind to an N-extended elongated version of said N-terminus amino acid sequence or an N-truncated shortened version of said N-terminus amino acid sequence.

13: The method as claimed in claim 1, wherein the biofluid sample is plasma or serum.

14: The method as claimed in claim 1, wherein the immunoassay is a competitive immunoassay.

15: The method as claimed in claim 1, wherein the immunoassay is an enzyme-linked immunosorbent assay (ELISA).

16: A monoclonal antibody that specifically recognises and binds to an HNE-generated neo-epitope consisting of an N-terminus or C-terminus sequence of an HNE-generated fragment of calprotectin.

17: The monoclonal antibody as claimed in claim 16, wherein the monoclonal antibody is a monoclonal antibody raised against a synthetic peptide comprising said N-terminus or C-terminus sequence.

18: The monoclonal antibody as claimed in claim 16, wherein the monoclonal antibody specifically recognises and binds to an N-terminus or C-terminus sequence of a peptide selected from one of the following HNE-generated fragments of calprotectin: TABLE-US-00016 (SEQ ID NO: 1) KLGHPDTLNQGEFKELV, (SEQ ID NO: 2) RKDLQNFLKKENKNEKV, (SEQ ID NO: 3) RKDLQNFLKKENKNEKVI, (SEQ ID NO: 4) EHIMEDLDTNADKQL, (SEQ ID NO: 5) SHEKMHEGDEGPGHHHKPGLGEGTP, (SEQ ID NO: 6) YRDDLKKLLET, and (SEQ ID NO: 7) WFKELDINTDGAV.

19: The monoclonal antibody as claimed in claim 16, wherein the monoclonal antibody specifically recognises and binds to an N-terminus or C-terminus sequence of the peptide TABLE-US-00017 (SEQ ID NO: 1) KLGHPDTLNQGEFKELV.

20: The monoclonal antibody as claimed in claim 16, wherein the monoclonal antibody specifically recognises and binds to said N-terminus sequence of the HNE-generated fragment of calprotectin and does not specifically recognise or bind to an N-extended elongated version of said N-terminus amino acid sequence or an N-truncated shortened version of said N-terminus amino acid sequence.

21: An immunoassay kit comprising a monoclonal antibody as claimed in claim 16, and at least one of: a streptavidin coated well plate, a biotinylated peptide comprising said N-terminus or C-terminus sequence linked to biotin, a secondary antibody for use in a sandwich immunoassay, a calibrator peptide comprising said N-terminus or C-terminus sequence, an antibody biotinylation an antibody HRP labelling kit, or an antibody radiolabelling kit.

22: The assay kit as claimed in claim 21, wherein the immunoassay kit comprises the monoclonal antibody, and one, two or all of: a streptavidin coated well plate, a biotinylated peptide comprising said N-terminus or C-terminus sequence linked to biotin, or a calibrator peptide comprising said N-terminus or C-terminus sequence.

Description

FIGURES

[0059] FIG. 1: Overview of the sequence of the calprotectin proteins S100A9 and S100A8 (A and B), and the fragments thereof generated by human neutrophil elastase (HNE). The HNE cleavage points are depicted by a down arrow (↓), with the some of the resulting HNE-generated fragments being highlighted in grey, and with the N-terminus sequences that form all or the start of the N-terminus neo-epitopes of the fragments designated as NBH-222, NBH-223, NBH-224, NBH-225 and NBH-226 being highlighted in a darker shade of grey.

[0060] FIG. 2: Relative abundance of CPa9-HNE (the N-terminus neo-epitope of NBH-222) in samples containing HNE cleaved calprotectin, full length calprotectin or HNE, as tested by mass spec (A); the reactivity of the CPa9-HNE antibody and assay, as tested against the selection peptide, elongated peptide, truncated peptide and non-sense peptide (B); and the abundance of CPa9-HNE, as detected by the CPa9-HNE antibody and assay, in samples containing HNE cleaved calprotectin, full length calprotectin or HNE (C).

[0061] FIG. 3: Spearman rho correlation of CPa9-HNE to faecal calprotectin (faecal-CP) and neutrophil count (A and B).

[0062] FIG. 4: Measured levels of CPa9-HNE in serum from inflammatory bowel disease (IBD), ulcerative colitis (UC) and Crohn's disease (CD) patients and healthy subjects (A and C), and associated ROC curves (B, D and E). Data are depicted as mean with standard error of the mean (SEM). Asterisks (*) depicts significant differences: *P<0.05, **P<0.01, ***P<0.001, ****P<0.0001

[0063] FIG. 5: Correlation of CPa9-HNE and faecal calprotectin (faecal-CP) to endoscopic scores for ulcerative colitis (MES) and Crohn's disease (SES-CD) (A-D). R=correlation coefficient, P=P-value, SES-CD=Simple endoscopic score for Crohn's disease, MES=Mayo endoscopic score.

[0064] FIG. 6: Measured levels of CPa9-HNE in healthy subjects, UC patients in clinical remission, and UC patents with active disease and associated ROC curves (A-C); measured levels of faecal-CP in UC patients in clinical remission, and UC patents with active disease and associated ROC curves (D and E); and correlation of CPa9-HNE with the partial mayo score (pMayo) and Trulove and Witts (TW-score) (F and G).

[0065] FIG. 7: (A) Serum biomarker levels of CPa9-HNE in COPD patients and healthy controls. Data is shown as Tukey's boxplot with lower limit measurement range (LLMR) indicated as a dashed line. Significance was found with a two-tailed Mann-Whitney test. (B) A ROC curve showing the diagnostic ability of CPa9-HNE in COPD patients. AUC: 0.9996.

[0066] FIG. 8: (A) Serum biomarker levels of CPa9-HNE in IPF patients and heathy controls. Data is shown as Tukey's boxplot with LLMR indicated as a dashed line. Significance was found with a two-tailed Mann-Whitney test. (B) A ROC curve showing the diagnostic ability of CPa9-HNE in IPF patients. AUC: 0.9813.

[0067] FIG. 9: Kaplan Meier plot for evaluating progression-free survival and overall survival in patients with metastatic melanoma treated with PD-1 inhibitor associated with CPa9-HNE at baseline by grouping (dichotomizing) at the 75th percentile (Q1+Q2+Q3 vs Q4).

[0068] FIG. 10: Serum biomarker levels of CPa9-HNE in lung cancer patients and controls. Data is shown as a scatter dot plot with line at median, and lower limit measurement range (LLMR) indicated as a dashed line. Significance was found by initially testing for normality and lognormality, where after a Dunnett's multiple comparisons test was applied.

[0069] FIG. 11: Serum biomarker levels of CPa9-HNE in joint disease patients and heathy controls. Data is shown as Tukey's boxplot.

EXAMPLES

[0070] The presently disclosed embodiments described in the following examples are set forth to aid in the understanding of the disclosure, and should not be construed to limit in any way the scope of the disclosure as defined in the claims which follow thereafter. The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the described embodiments, and are not intended to limit the scope of the present disclosure nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g. amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.

[0071] In the following examples, the following materials and methods were employed.

Methods

In Vitro Cleavage of Calprotectin

[0072] Calprotectin fragments were generated in vitro by adding purified calprotectin, a heterodimer composed of the proteins S100A9 and S100A8, to an Eppendorf tube and adding human neutrophil elastase (HNE) in a protein:protease ratio of 100:1 (10 ug of calprotectin per 0.1 ug of HNE). The proteolytic reaction was inhibited after 24 hours by adding 5 mM EDTA stop buffer. Eppendorf tubes containing only protease buffer, or calprotectin without HNE, or HNE without calprotectin served as experimental controls.

Mass Spectrometry Analysis

[0073] 100 μl of cleaved samples or controls were desalted with reverse-phase Vydac UltraMicro Spin C18 columns (Harvard Apparatus, cat #74-7206) according to the manufacturer's instructions. Non-targeted mass spectrometry analysis was performed on a quadrupole Orbitrap benchtop mass spectrometer, QExactive, (Thermo Scientific) equipped with an Easy nano-LC 1000 system (ThermoFisher Scientific). Separation was performed on 75 μm×25 cm, Acclaim Pepmap™ RSLC C18 capillary columns packed with 2 μm particles (ThermoFisher Scientific). A spray voltage of +2000 V was used with a heated ion transfer setting of 275° C. for desolvation. The on-line reversed-phase separation was performed using a flow rate of 300 nl/min and a linear binary gradient 85 min was used. The gradient started with 3% solvent B for 4 min, then going to 35% solvent B in 64 min, after which it goes to 45% solvent B in 5 min. Finally, the organic solvent concentration was increased up to 90% in 5 min and kept at 90% for 7 min. An MS scan (400-1200 m/z) was recorded in the Orbitrap mass analyzer set at a resolution of 70,000 at 200 m/z, 1×10.sup.6 automatic gain control (AGC) target and 100 ms maximum ion injection time (44). The MS was followed by data-dependent collision-induced dissociation MS/MS scans at a resolution of 17,500 on the 15 most intense multiply charged ions at 2×10.sup.4 intensity threshold, 2 m/z isolation width and dynamic exclusion enabled for 30 s.

Calprotectin Fragment Identification

[0074] Identification from discovery data was performed using the Homo sapiens proteome (UniProt proteome ID UP000005640, n20200 downloaded Dec. 6, 2015 with Proteome Discoverer 2.1 software (ThermoFisher Scientific). The processing workflow consisted of the following nodes: Spectrum Selector for spectra pre-processing (precursor mass range: 100-10000 Da; S/N Threshold: 1.5), Sequest-HT search engine (Protein Database: see above; Enzyme: No Enzyme; Max. missed cleavage sites: 2; Peptide length range 6-144 amino acids; Precursor mass tolerance: 10 ppm; Fragment mass tolerance: 0.02 Da; Dynamic modification: oxidation; Static modification: cysteine carbamidomethylation; and Percolator for peptide validation (FDR<0.01 based on peptide q-value). Peptide intensities were quantified using a proprietary algorithm developed in Proteome Discoverer 2.1 (ThermoFisher Scientific).

Monoclonal Antibody Production and Clone Characterization

[0075] Briefly, generation of monoclonal antibodies targeting an HNE-generated neo-epitope consisting of an N-terminus or C-terminus sequence of an HNE-generated fragment of calprotectin (more specifically, targeting the N-terminus neo-epitope, also referred to herein as “CPa9-HNE”, of the HNE-generated fragment of calprotectin referred to as “NBH-222”) was carried out as follows.

[0076] Four to six-week old Balb/C mice were immunized subcutaneously with 200 μL emulsified antigen and 50 μg immunogenic peptide (KLGHPDTLNQ-GGC-Keyhole Limpet Hemocyanin (KLH) (SEQ ID NO: 24)) using Freund's incomplete adjuvant (Sigma-Aldrich). The mice were immunized at two-week intervals until stable serum titer levels were reached. The mouse with the highest serum titer was selected for monoclonal antibody production. The mouse was rested for one month and was then immunized intravenously with 50 μg immunogenic peptide in 100 μL 0.9% sodium chloride (NaCl) solution. After 3 days, splenocytes were isolated for cell fusion. In brief, splenocytes were fused with SP2/0 myeloma cells to produce hybridoma cells and then cloned in culture dishes using the semi-medium method. The clones were plated into 96-well microtiter plates, and limited dilution was used to secure monoclonal growth. The supernatants were screened for reactivity against the selection peptide (KLGHPDTLNQ (SEQ ID NO: 12)) and native material (serum and cleavage material) in an indirect competitive ELISA using streptavidin-coated plates (Roche, Hvidovre, Denmark, cat. 11940279). The clones with the best reactivity were purified using protein-G-columns according to the manufacturer's instructions (GE healthcare Life Sciences, Little Chalfont, Buckinghamshire, UK). These clones were tested for their reactivity toward the selection peptide and the elongated peptide, truncated peptide and non-sense peptide (see Table 1), and the clone showing the highest selectivity towards the selection peptide was chosen for monoclonal antibody production and assay development. Optimal incubation buffer, time, temperature, and optimal ratio between the biotinylated peptide and antibody were determined.

TABLE-US-00010 TABLE 1 overview of peptides Selection sequence KLGHPDTLNQ (SEQ ID NO: 12) Elongated sequence VKLGHPDTLNQ (SEQ ID NO: 8) Truncated sequence LGHPDTLNQ (SEQ ID NO: 9) non-sense peptide YRDDLKKLLET (SEQ ID NO: 6) (sequence of the NBH-225 fragment of calprotectin fragment was used)

[0077] The monoclonal antibody chosen for production and assay development was also sequenced, and the CDRs and isotype determined. The sequence of the chains are as follows (CDRs underlined and in bold; N-terminus signal peptide and C-terminus Constant region in italics):

TABLE-US-00011 Heavy Chain Sequence (Mouse IgG1 isotype) (SEQ ID NO: 25) MEWRIFLFILSGTAGVHSQVQLQQSGPELVKPGASVKMSCKASGYTFTD HVINWVRQRTGQGLEWIGEIYPGSGSTYYNEKFKGKATLTADKSSNTAY MQLSSLTSEDSAVYFCAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAA QTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSS SVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVS SVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTA QTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTI SKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNG QPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHN HHTEKSLSHSPGK Light Chain Sequence (Mouse Kappa Isotype) (SEQ ID NO: 26) MESQTQVLISLLFWVSGACGDIVMTQSPSSLSVSAGEKVTMSCKSSQSL LNSGNQKNYLAWYQQKPGQPPKLLIYGASTRESGVPDRFTGSGSGTDFT LTISSVQAEDLAVYYCLNDHSYPYTFGGGTKLEIKRADAAPTVSIFPPS SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKD STYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Immunoassay (ELISA) Protocol

[0078] The levels of an HNE-generated neo-epitope consisting of an N-terminus or C-terminus sequence of an HNE-generated fragment of calprotectin (more specifically the levels of CPa9-HNE, i.e. the N-terminus neo-epitope of the HNE-generated fragment of calprotectin NBH-222) were assessed in samples by a solid phase competitive enzyme linked immunosorbent assay, which was carried out as follows.

[0079] 96-well plates pre-coated with streptavidin (Roche Diagnostic's cat. No. 11940279, Hvidovre, Denmark) were coated with a biotinylated antigen (KLGHPDTLNQ-K-Biotin (SEQ ID NO: 27)) by incubation with the biotinylated antigen for 30 minutes at room temperature. Unbound biotinylated coater antigen was discarded, and the wells were washed with washing buffer (25 mM TRIZMA, 50 mM NaCl, 0.036% Bronidox L5, 0.1% Tween 20) using a standardized ELISA plate washing machine (BioTek® Instruments, Microplate washer, ELx405 Select CW, Winooski, USA). Samples were diluted in incubation buffer containing 1% bovine serum albumin (Sigma Aldrich, cat. No. a-7906, 98 purity) to maintain protein stability and for blocking. Samples and controls were added to the wells and incubated with the primary monoclonal antibody against the HNE-generated neo-epitope (CPa9-HNE), at 20° C. for 1 hour and agitated at 300 rpm. Unbound primary antibody and sample were discarded, and the wells were washed with washing buffer. Subsequently, HRP conjugated AffiniPure Rabbit anti-mouse IgG secondary antibodies (Jackson cat. No 315-035-045) was added to the wells and incubated for 1 hour at 20° C. Unbound secondary antibody was discarded by washing the wells in washing buffer. Chemiluminescence substrate (Roche Diagnostic's cat. No. 11582950001) was added to the well (100 μl/well), and the plates were incubated for 3 minutes at room temperature before reading the plates. Finally, an ELISA reader (VersaMAX; Molecular Devices, Wokingham Berkshire, UK) was used to quantify the relative light units (RLU) emitted from the plates at 440 nm and 650 nm. A standard curve was plotted using a 4-parametric mathematical fit model.

Immunoassay Development

[0080] To test the robustness of the above assay, dilution recovery, peptide spiking in serum, analyte stability, freeze/thaw, antibody specificity (sanity test), interference (haemolysis, biotin, and lipids spiked in serum), inter/intra variance and biological relevance (cleavage material, serum and plasma) were tested.

Biological Validation in IBD Patients

Patient Demographics

[0081] Serums samples were tested from a patient cohort consisting of a total of 29 UC and 72 CD patients. Demographical data, disease history and therapy were obtained from electronic medical records and questionnaires. Anthropometric parameters were measured at the inclusion. Where available, patients' endoscopic disease activity was based on the simple endoscopic score for CD (SES-CD), and the Mayo endoscopic score for UC (MES). The MES score was used to add the information about disease extension.sup.26. Inflammatory activity was also defined as combination of clinical and biochemical disease activity using Crohn's Disease Activity Index (CDAI), partial Mayo score (pMayo) and C-Reactive Protein (CRP). Patient stratification based on endoscopic scores was done as follows: SES-CD (remission=0-2, mild=3-6, moderate=7-15, severe>15), MES (remission=0-2, mild=3-6, moderate=7-15, severe>15). Clinical and biochemical activity was defined as CDAI≥150 or CRP>5 for CD and pMayo>1 or CRP>5 for UC. Disease severity and extension were assessed by Montreal classification.

Statistical Analysis

[0082] To achieve normal distribution, log-transformation of the data was applied prior to statistical analysis. Student t-test and one-way ANOVA for normally distributed data was applied for analysing statistical differences. If a normal distribution was not achieved by log transformation Mann-Whitney U-test and Kruskal Wallis was applied. False discovery rate method (FDR=5%) was used for multiple comparisons' correction. Target peptide levels are presented as non-log transformed data with mean and standard error of the mean (SEM).

[0083] For the purpose of assessing the diagnostic power of the target peptide, receiver operating characteristic (ROC) curves were calculated. A P-value of ≤0.05 was considered statistically significant. Statistical analysis was performed using Graphpad Prism 7.03 and MedCalc. Figures were made using GraphPad Prism version 7.03.

Biological Validation in COPD and IPF Patients

[0084] CPa9-HNE was measured in serum from COPD patients (n=68) and healthy controls (n=36), and IPF patients (n=16) and healthy controls (n=10).

Biological Validation in Metastatic Melanoma Patients

[0085] CPa9-HNE was measured in pre-treatment serum from metastatic melanoma patients treated with anti-PD-1 therapy (pembrolizumab) (n=35). The patients were treated with pembrolizumab as the standard of care at Copenhagen University Hospital, Herlev, after informed consent and approval by the Ethics Committee for the Capital Region of Denmark in compliance with the Helsinki Declaration 1975. Serum samples were measured blinded. The association between CPa9-HNE levels and progression-free survival (PFS) and overall survival (OS) were assessed by Kaplan Meier analyses and Cox regression analyses, alone and after adjusting for PDL1 expression (≥1%), lactate dehydrogenase (LDH), BRAF mutational status, and C-reactive protein (CRP).

Biological Validation in SCLC and NSCLC Patients

[0086] CPa9-HNE was measured in serum from patients with small cell lung cancer (SCLC), patients with non-small cell lung cancer (NSCLC), and healthy controls.

Biological Validation in Joint Disease Patients

[0087] CPa9-HNE was measured in serum from patients with rheumatoid arthritis (n=15, age [range: 39-47]), psoriatic arthritis (n=11, age [range:31-64]), psoriasis (n=12, age [range: 27-52]), ankylosing spondylitis (n=11, age [range: 35-53]), young osteoarthritis (n=13, age<51 [range: 41-50]), old osteoarthritis (n=10, Age>50) and healthy controls (n=33). 41 of the patients were female.

Results

Calprotectin Neo-Epitope Generation and Identification

[0088] The non-targeted mass spectrometry analysis and subsequent calprotectin fragment identification, applying UniProt proteome ID UP000005640, revealed that several neo-epitope containing calprotectin fragments were generated by HNE, from both the S100A9 and S100A8 proteins (Table 2, and FIG. 1). Five HNE-generated calprotectin fragments (NBH-222, NBH-223, NBH-224, NBH-225, NBH-226) were considered as front runners for assay development, based on their PSM, Quality q-value and Quality PEP scores. Of these, due its PSM count (Table 2) and the uniqueness of its N-terminus neo-epitope sequence, NBH-222 was selected as the calprotectin (S100A9) fragment for development of an immunoassay targeting the HNE-generated N-terminus neo-epitope (CPa9-HNE) of this fragment.

TABLE-US-00012 TABLE 2 P06702 [Protein S100-A9 OS = Homosapiens GN=  S100A9 PE=  1 SV = 1] Percolator Percolator Qvality XCorr Confidence q- PEP Annotated # Qvality q- Sequest Sequest Value Sequest Sequence PSMs PEP value HT HT Sequest HT HT [V].KLGHPDTLNQ 252 0.0763012 0 4.19 High 0 4.95E-05 GEFKELV.[R] (SEQ ID NO: 1) [V].RKDLQNFLKKE 216 0.0347011 0 5.44 High 0 1.58E-05 NKNEKV.[I] (SEQ ID NO: 2) [V].RKDLQNFLKK 197 0.0429293 0 5.43 High 0 0.001887 ENKNEKVI.[E] (SEQ ID NO: 3) [I].EHIMEDLDTNAD 189 0.108379 0 4.27 High 0 0.0001494 KQL.[S] (SEQ ID NO: 4) [A].SHEKMHEGDE 163 0.0821572 0 6.01 High 0 0.0005104 GPGHHHKPGLGE GTP.[-] (SEQ ID NO: 5) [I].MEDLDTNADKQ 111 0.212839 0 2.97 High 0 0.0005214 L.[S] (SEQ ID NO: 28) [I].EHIMEDLDTNAD  63 0.136895 0 2.88 High 0 0.006693 KQLS.[F] (SEQ ID NO: 29) [M].SQLERNIETI.[I]  48 0.294959 0 1.92 High 0.003407 0.08593 (SEQ ID NO: 30) [V].KLGHPDTLNQG  42 0.177644 0 4.18 High 0 0.0005776 EFKEL.[V] (SEQ ID NO: 31) [S].HEKMHEGDEG  32 0.0745309 0 5.06 High 0 0.0003257 PGHHHKPGLGEGT PH (SEQ ID NO: 32) [T].WASHEKMHEG  32 0.0649674 0 7.46 High 0 8.10E-05 DEGPGHHHKPGL GEGTP.[-] (SEQ ID NO: 33) [M].HEGDEGPGHH  30 0.252624 0 4.00 High 0 0.005602 HKPGLGEGTP.[-] (SEQ ID NO: 34) [I].EHIMEDLDTNAD  25 0.16537 0 3.14 High 0 0.0001334 KQL.[S] (SEQ ID NO: 4) [I].MEDLDTNADKQ  21 0.163632 0 2.56 High 0 0.0001257 LS.[F] (SEQ ID NO: 35) [A].SHEKMHEGDE  13 0.34117 0 4.13 High 0.001932 0.06063 GPGHHHKPGLGE GTP.[-] (SEQ ID NO: 5) [I].MEDLDTNADKQ  12 0.263837 0 2.65 High 0 0.001686 L.[S] (SEQ ID NO: 28) [A].SHEKMHEGDE  11 0.222026 0 4.72 High 0 0.0008662 GPGHHHKPG.[L] (SEQ ID NO: 36) P05109 [Protein S100-A8 OS = Homosapiens GN = S100A8 PE = 1 SV = 1] Percolator Percolator Qvality XCorr Confidence q- PEP Annotated # Qvality q- Sequest Sequest Value Sequest Sequence PSMs PEP value HT HT Sequest HT HT [V].YRDDLKKLLET 112 0.301257 0 2.21 High 0.00481 0.1006 [E] (SEQ ID NO: 6) [V].WFKELDINTDG  39 0.32248 0 2.50 High 0 0.004899 AV.[N] (SEQ ID NO: 7) [I].IDVYHKYSLI.[K]   2 0.327439 0 1.92 High 0 0.005295 (SEQ ID NO: 37)

Immunoassay Development for CPa9-HNE

Specificity, Accuracy and Precision

[0089] The mass spectrometry data demonstrated that NBH-222 was only present in samples containing full length human calprotectin+human neutrophil elastase, but not in the control samples containing only full-length human calprotectin or human neutrophil elastase (FIG. 2A). A monoclonal antibody (also referred to herein as the CPa9-HNE antibody) targeting CPa9-HNE (the HNE-generated N-terminus neo-epitope of NBH-222) was developed and used in an ELISA protocol as described above (also referred to hereinafter as the CPa9-HNE assay), and the specificity of this antibody when used in this immunoassay was tested against the selection peptide and the elongated peptide, truncated peptide and non-sense peptide (having the sequences set out in Table 1). The Cpa9-HNE antibody demonstrated only reactivity towards the Cpa9-HNE neo-epitope sequence (FIG. 2B). In samples containing HNE cleaved calprotectin, or only intact full-length human calprotectin, or only human neutrophil elastase, the CPa9-HNE antibody was able to identify the target neo-epitope sequence only when calprotectin cleaved by human neutrophil elastase was present (FIG. 2C). The final specifications of the CPa9-HNE assay are as set out in table 3.

TABLE-US-00013 TABLE 3 CPa9-HNE assay parameters Species possibilities Human Analyte stability, 4° C. Minimum 48 hours Analyte stability, 20° C. 24 hours intra-assay CV %, QC 6% Inter-assay CV %, QC 7.5% RnD Assay range 9.08 ng/mL-492.7 ng/mL (ng/ml).sub.LLMR-ULMR Std.A, conc. (ng/ml) 1000 ng/mL Mean relative light 48251.074 units (RLU) value, StdH (Abs) IC50 (mean, ng/ml) 78.34 Slope (mean) 0.94 CO1 (ng/ml); mean 36.96 ng/mL (± 20%) (29.57-44.35 ng/mL) CO2 (ng/ml); mean 248.2 ng/mL (± 20%) (198.6-297.8 ng/mL)

Patient Demographics in IBD Patients

[0090] CPa9-HNE levels in serum from IBD patients were demonstrated to correlate to faecal calprotectin levels (i.e. levels of intact calprotectin in faeces) and neutrophil count in UC patients (FIGS. 3A and B).

CPa9-HNE Serum Levels in IBD

CPa9-HNE is Elevated in Serum of IBD Compared to Healthy Controls

[0091] The serum levels of CPa9-HNE were measured in serum from UC, CD and healthy subjects. CPa9-HNE was demonstrated to be ˜4-fold higher in the serum of IBD patients compared healthy subjects (AUC: 0.92, P<0.0001) (FIGS. 4A and B). When dividing the patients into CD and UC, serum CPa9-HNE was equally elevated in UC and CD patients, and was ˜4-fold higher in CD (AUC: 0.92, P<0.0001) and UC (AUC: 0.94, P<0.0001) patients compared to healthy subjects (FIGS. 4C, D and E).

CPa9-HNE is Associated with Endoscopic Disease Activity in UC and CD

[0092] CPa9-HNE correlated well with endoscopic disease activity for CD (SES-CD: r=0.057, P<0.0001) and UC (MES: r=0.71, P=0.0003) (FIGS. 5A and B). Faecal-CP correlated with the endoscopic disease activity for CD (SES-CD: r=0.39, P=0.005) but not for UC (MES: r=0.31, P=0.09) (FIGS. 5C and D)

CPa9-HNE is Associated with Clinical Disease Activity in UC

[0093] Dividing the UC patients into clinical remission and clinical active disease based on the partial mayo score, CPa9-HNE was significantly elevated in UC patients with clinical active disease compared to UC patients in remission (AUC: 0.88, P<0.0001) and healthy donors (AUC: 0.93, P<0.0001) (FIGS. 6A, B and C). The performance of CPa9-HNE in comparison to faecal calprotectin then CPa9-HNE demonstrated to be equally or slightly better than faecal calprotectin with increased AUC and sensitivity (FIGS. 6A to E). CPa9-HNE also demonstrated to correlate with the partial mayo score (r=0.51, P=0.008) and the Truelove and Witts score (r=0.64, P=0.0005) for UC (FIGS. 6F and G).

CPa9-HNE is Elevated in COPD Patients Compared to Healthy Controls

[0094] CPa9-HNE was measured in serum samples for COPD patients and healthy controls. FIG. 7A displays the difference of the invention between the healthy controls (n=36) and COPD patients (n=68), (p<0.0001). Furthermore, the diagnostic ability was calculated in a receiver operating characteristics (ROC) curve with an area under the curve (AUC) determined as 0.9996, FIG. 7B. The measurements were not affected by the patients' BMI, age, and sex.

CPa9-HNE is Elevated in IPF Patients Compared to Healthy Controls

[0095] CPa9-HNE was measured in serum samples for IPF patients (n=16) and healthy controls (n=10). FIG. 8A displays the difference of the Invention between healthy controls and patients with IPF (p<0.0001). Moreover, the diagnostic ability was calculated in a ROC curve with an AUC determined as 0.9813, FIG. 8B.

High CPa9-HNE is Associated with a Worse Prognosis in Metastatic Melanoma

[0096] The association between CPa9-HNE and survival outcomes in the metastatic melanoma patients was evaluated by Kaplan-Meier analysis. Using the 75th percentile cut point, it was found that patients with high CPa9-HNE levels (>75th percentile) had significantly worse PFS (p=0.011) and OS (p=0.0002) compared to patients with low CPa9-HNE levels (FIG. 9). In support, univariate Cox regression identified high (>75th percentile) pre-treatment CPa9-HNE as predictor of worse PFS (HR=3.32, 95% C1=1.25-8.82, p=0.016) and OS (HR=11.31, 95% C1=2.27-56.33, p=0.003) when compared to low CPa9-HNE (Table 4). By multivariate Cox regression, high CPa9-HNE was found to be independently predictive of poor PFS (HR=8.22, 95% C1=1.30-52.14, p=0.025) and OS (HR=76.87, 95% C1=4.73-1248.57, p=0.002) when adjusted for PDL1 expression, LDH, BRAF mutations, and CRP (Table 4).

TABLE-US-00014 TABLE 4 Cox regression analysis for predicting progression-free survival and overall survival outcome Progression-free survival Overall survival HR 95% Cl p-value HR 95% Cl p-value Univariate analysis CPa9-HNE, Q4 vs 3.32 1.25-8.82 0.016 11.31  2.27-56.33 0.003 Q1 + Q2 + Q3 Multivariate analysis adjusted for PDL1 expression (≥1%) LDH, BRAF mutations, and CRP CPa9-HNE, Q4 vs 8.22  1.30-52.14 0.025 76.87   4.73-1248.57 0.002 Q1 + Q2 + Q3

CPa9-HNE is Elevated in SCLC and NSCLC Patients Compared to Healthy Controls

[0097] CPa9-HNE was measured in serum from patients with small cell lung cancer (SCLC), patients with non-small cell lung cancer (NSCLC), and healthy controls. The Lung cancer patients experienced a statistically significant increase in CPa9-HNE serum levels, where both small cell lung cancer (SCLC) (p=0.0435, n=10, median=212.1 [IQR 164.0-407.1]) and non-small cell lung cancer (NSCLC) (p=0.0467, n=10, median=281.3 [IQR 186.8-385.8]) were examined (FIG. 10).

CPa9-HNE is Elevated in Joint Diseases Compared to Healthy Donors

[0098] The CPa9-HNE was measured in serum from patients with rheumatoid arthritis (n=15, age [range:39-47]), psoriatic arthritis (n=11, age [range:31-64]), psoriasis (n=12, age [range:27-52]), ankylosing spondylitis (n=11, age [range:35-53]), young osteoarthritis (n=13, age<51 [range:41-50]), old osteoarthritis (n=10, Age>50) and healthy controls (n=33). The CPa9-HNE biomarker was significantly elevated in all joint disease compared to healthy controls, with the greatest difference being observed for ankylosing spondylitis (p<0.001), psoriatic arthritis (p<0.001), young osteoarthritis (p<0.001), and rheumatoid arthritis (p<0.01) patients compared to healthy controls (FIG. 11).

DISCUSSION

[0099] In this study the inventors have demonstrated that the CPa9-HNE assay is technically robust with biological and clinical relevance as a serum based assay for detecting, inter alia, IBD, COPD, IPF, SCLC, NSCLC, rheumatoid arthritis, ankylosing spondylitis, psoriasis, psoriasis arthritis and osteoarthritis, and assessing disease activity. Additionally, the inventors have demonstrated that the CPa9-HNE assay is of prognostic value in patients with metastatic melanoma.

[0100] As indicated in table 3 the CPa9-HNE containing calprotectin fragment (NBH-222) is stable at 4° C. for a minimum of 48 hours in serum, which also means that this neo-epitope containing fragment has a much longer half-life than intact calprotectin in serum and plasma, intact calprotectin having only a half-life of 5 hours in plasma (9) despite being proven to be stable in faeces for 7 days (1). This may explain the poor clinical applicability of the faecal calprotectin assays when applied to serum/plasma, which assays performance is similar to CRP (10-12). The high stability of the CPa9-HNE fragment in serum (minimum 48 hours at 4° celcius) may be explained by the fact that it is a degradation product/metabolite of calprotectin, making the fragment more resistant for further degradation. In addition, the CPa9-HNE assay is also more sensitive than the faecal calprotectin assay, since it measures nanograms/mL instead of micrograms/gram (27).

[0101] Calprotectin's ability to bind metal ions e.g. calcium and zinc ions makes it highly resistant towards to metalloproteinase (MMP) degradation since MMPs require Zinc ions for activation. HNE is a serine protease and does not require activation by metal ions and is thus able to degrade calprotectin and generate HNE derived neo-epitope containing calprotectin fragments (5, 28-30). Therefore, CPa9-HNE levels may be representative of local tissue inflammation, as CPa9-HNE containing fragments will only be generated by activated neutrophil granulocytes and other activated leukocytes, and only the presence of HNE. This, is in contrast to intact calprotectin which can be released randomly into the circulation and faeces by non-activated circulating leukocytes and to some extent by epithelial cells, which also express calprotectin (10,31,32).

[0102] CPa9-HNE was demonstrated to be highly abundant in serum of CD and UC patients, indicating high potential as surrogate biomarker aiding diagnosis of IBD. This is in concordance with faecal calprotectin as this biomarker can reliably distinguish between IBS and IBD patients (6-8). Furthermore, CPa9-HNE also correlated with faecal calprotectin, neutrophil granulocyte count and disease activity for CD and UC, indicating that CPa9-HNE can be used to monitor disease activity and may be surrogate biomarker for endoscopic assessment for CD and UC.

[0103] The CPa9-HNE assay also elucidated a significant difference between patients affected with pulmonary diseases COPD, and IPF as compared to healthy controls. The CPa9-HNE assay measures a specific cleavage site on calprotectin that is generated by neutrophil elastase. Therefore, these results indicate a higher activity of NE in these pulmonary diseases.

[0104] The CPa9-HNE assay was also demonstrated to be predictive of overall and progression free survival rates in patients with metastatic melanoma treated with treated with anti-PD-1 therapy, based on baseline (pre-treatment) concentrations of serum CPa9-HNE.

[0105] Finally, CPa9-HNE was also shown to be significantly elevated in the serum of lung cancer patients (both SCLC and NSCLC) as compared to healthy controls, and in the serum of rheumatoid arthritis, ankylosing spondylitis, psoriasis, psoriasis arthritis and osteoarthritis patients as compared to healthy controls.

CONCLUSION

[0106] The CPa9-HNE ELISA was proven to have high specificity towards the neo-epitope both in in vitro cleavage samples and in the human IBD serum samples as a novel serum biomarker for HNE mediated degradation of calprotectin. CPa9-HNE was highly associated with CD and UC patients and demonstrated high diagnostic accuracy to differentiate IBD patients from healthy donors. Furthermore, CPa9-HNE also correlated with endoscopic disease activity for CD and UC, SES-CD and MES respectively. CPa9-HNE also correlated with clinical disease activity scores for UC (partial Mayo score and the Trulove and Witts score). Therefore, the CPa9-HNE is a surrogate biomarker of disease activity for CD and UC, and performed at least as well as or slightly better than Faecal-CP. Therefore, CPa9-HNE is a novel clinically relevant biomarker for IBD diagnosis and monitoring of disease activity, as well as also other inflammatory driven diseases including, rheumatoid arthritis, psoriasis, psoriasis arthritis, ankylosing spondylitis, osteoarthritis, Sjögrens syndrome, and lupus. It may also be uses to predict or monitor treatment efficacy in e.g. TNF-alpha, vedolizumab and ustekinumab prospective studies.

[0107] Additionally, CPa9-HNE has been shown to be a clinically relevant biomarker in lung diseases such as COPD and IPF, metastatic diseases such as metastatic melanoma, and lung cancers such as SCLC and NSCLC.

[0108] In this specification, unless expressly otherwise indicated, the word ‘or’ is used in the sense of an operator that returns a true value when either or both of the stated conditions is met, as opposed to the operator ‘exclusive or’ which requires that only one of the conditions is met. The word ‘comprising’ as used herein means ‘including’ or ‘consisting of’. All prior teachings acknowledged herein are hereby incorporated by reference.

REFERENCES

[0109] 1. Røseth AG., Fagerhol M K., Aadland E., et al. Assessment of the neutrophil dominating protein calprotectin in feces. A methodologic study. Scand J Gastroenterol 1992; 27(9):793-8. Doi: 10.3109/00365529209011186. [0110] 2. Stephan J R., Nolan E M. Calcium-induced tetramerization and zinc chelation shield human calprotectin from degradation by host and bacterial extracellular proteases. Chem Sci 2016; 7(3):1962-75. Doi: 10.1039/c5sc03287c. [0111] 3. Levine A P., Segal A W. What Is wrong with granulocytes in inflammatory bowel diseases. Dig Dis 2013; 31:321-7. Doi: 10.1159/000354686. [0112] 4. Geboes K. Histopathology of Crohn's Disease and Ulcerative Colitis. Inflammatory Bowel Disease, vol. 18. 2003. p. 255-76. [0113] 5. Wéra O., Lancellotti P., Oury C. The Dual Role of Neutrophils in Inflammatory Bowel Diseases. J Clin Med 2016; 5(12):118. Doi: 10.3390/jcm5120118. [0114] 6. Gionchetti P., Dignass A., Danese S., et al. 3rd European evidence-based consensus on the diagnosis and management of Crohn's disease 2016: Part 2: Surgical management and special situations. J Crohn's Colitis 2017; 11(2):135-49. Doi: 10.1093/ecco-jcc/jjw169. [0115] 7. Schoepfer A M., Trummler M., Seeholzer P., et al. Discriminating IBD from IBS: comparison of the test performance of fecal markers, blood leukocytes, CRP, and IBD antibodies. Inflamm Bowel Dis 2008; 14(1):32-9. Doi: 10.1002/ibd.20275. [0116] 8. Chang M-H., Chou J-W., Chen S-M., et al. Faecal calprotectin as a novel biomarker for differentiating between inflammatory bowel disease and irritable bowel syndrome. Mol Med Rep 2014; 10(1):522-6. Doi: 10.3892/mmr.2014.2180. [0117] 9. Hammer H B., Ødeg̊ard S., Fagerhol M K., et al. Calprotectin (a major leucocyte protein) is strongly and independently correlated with joint inflammation and damage in rheumatoid arthritis. Ann Rheum Dis 2007; 66(8):1093-7. Doi: 10.1136/ard.2006.064741. [0118] 10. Kopi T A., Shahrokh S., Mirzaei A., et al. The role of serum calprotectin as a novel biomarker in inflammatory bowel diseases: A review study. Gastroenterol Hepatol from Bed to Bench 2019; 12(3):183-9. Doi: 10.22037/ghfbb.v12i3.1591. [0119] 11. Meuwis M A., Vernier-Massouille G., Grimaud J C., et al. Serum calprotectin as a biomarker for Crohn's disease. J Crohn's Colitis 2013; 7(12):e678-83. Doi: 10.1016/j.crohns.2013.06.008. [0120] 12. McCann R K., Smith K., Gaya D R. A prospective single centre pilot evaluation of a serum calprotectin assay in unselected GI patients. Clin Biochem 2017; 50(9):533-6. Doi: 10.1016/j.clinbiochem.2017.01.006. [0121] 13. Carlsen K., Malham M., Hansen L F., et al. Serum Calprotectin in Adolescents With Inflammatory Bowel Disease—A Pilot Investigation. J Pediatr Gastroenterol Nutr 2019; 68(5). [0122] 14. Malham M., Carlsen K., Riis L., et al. Plasma calprotectin is superior to serum calprotectin as a biomarker of intestinal inflammation in ulcerative Colitis. Scand J Gastroenterol 2019; 54(10):1214-9. Doi: 10.1080/00365521.2019.1665097. [0123] 15. Kalla R., Kennedy N A., Ventham N T., et al. Serum Calprotectin: A Novel Diagnostic and Prognostic Marker in Inflammatory Bowel Diseases. Am J Gastroenterol 2016; 111(12). [0124] 16. Kirov S., Sasson A., Zhang C., et al. Degradation of the extracellular matrix is part of the pathology of ulcerative colitis. Mol Omi 2019; 15(1):67-76. Doi: 10.1039/c8mo00239h. [0125] 17. Urban C F., Ermert D., Schmid M., et al. Neutrophil Extracellular Traps Contain Calprotectin, a Cytosolic Protein Complex Involved in Host Defense against Candida albicans 2009; 5(10). Doi: 10.1371/journal.ppat.1000639. [0126] 18. Mortensen J H., Manon-Jensen T., Jensen M D., et al. Ulcerative colitis, Crohn's disease, and irritable bowel syndrome have different profiles of extracellular matrix turnover, which also reflects disease activity in Crohn's disease. PLoS One 2017; 12(10):1-16. Doi: 10.1371/journal.pone.0185855. [0127] 19. Kristensen J H., Karsdal M A., Sand J M., et al. Serological assessment of neutrophil elastase activity on elastin during lung ECM remodeling. BMC Pulm Med 2015; 15(1):53. Doi: 10.1186/s12890-015-0048-5. [0128] 20. Magro F., Gionchetti P., Eliakim R., et al. Third European Evidence-based Consensus on Diagnosis and Management of Ulcerative Colitis Part 1: Definitions, Diagnosis, Extra-intestinal Manifestations, Pregnancy, Cancer, Surveillance, Surgery, and Ileo-anal Pouch Disorders. J Crohn's Colitis 2017:1-115. Doi: 10.1093/ecco-jcc/jjx008. [0129] 21. Mortensen J H., Godskesen L E., Jensen M D., et al. Fragments of Citrullinated and MMP-degraded Vimentin and MMP-degraded Type III Collagen Are Novel Serological Biomarkers to Differentiate Crohn's Disease from Ulcerative Colitis. J Crohn's Colitis 2015:jjv123. Doi: 10.1093/ecco-jcc/jjv123. [0130] 22. van Haaften W T., Mortensen J H., Karsdal M A., et al. Misbalance in type III collagen formation/degradation as a novel serological biomarker for penetrating (Montreal B3) Crohn's disease. Aliment Pharmacol Ther 2017; (August 2016). Doi: 10.1111/apt.14092. [0131] 23. Goffin L., Fagagnini S., Vicari A., et al. Anti-MMP-9 Antibody: A Promising Therapeutic Strategy for Treatment of Inflammatory Bowel Disease Complications with Fibrosis. Inflamm Bowel Dis 2016; 22(9):2041-57. Doi: 10.1097/MIB.0000000000000863. [0132] 24. Lindholm M., Manon-Jensen T., Madsen G I., et al. Extracellular Matrix Fragments of the Basement Membrane and the Interstitial Matrix Are Serological Markers of Intestinal Tissue Remodeling and Disease Activity in Dextran Sulfate Sodium Colitis. Dig Dis Sci 2019. Doi: 10.1007/s10620-019-05676-6. [0133] 25. Mortensen J H., Lindholm M., Langholm L L., et al. The intestinal tissue homeostasis—the role of extracellular matrix remodeling in inflammatory bowel disease. Expert Rev Gastroenterol Hepatol 2019; 00(00):1-17. Doi: 10.1080/17474124.2019.1673729. [0134] 26. Lobatón T., Bessissow T., De Hertogh G., et al. The Modified Mayo Endoscopic Score (MMES): A New Index for the Assessment of Extension and Severity of Endoscopic Activity in Ulcerative Colitis Patients. J Crohns Colitis 2015; 9(10):846-52. Doi: 10.1093/ecco-jcc/jjv111. [0135] 27. Labaere D., Smismans A., Van Olmen A., et al. Comparison of six different calprotectin assays for the assessment of inflammatory bowel disease. United Eur Gastroenterol J 2014; 2(1):30-7. Doi: 10.1177/2050640613518201. [0136] 28. Döring G. The Role of Neutrophil Elastase in Chronic Inflammation. Am J Respir Crit Care Med 1994; 150(6_pt_2):5114-7. Doi: 10.1164/ajrccm/150.6_Pt_2.5114. [0137] 29. Alfakry H., Malle E., Koyani C N., et al. Neutrophil proteolytic activation cascades: a possible mechanistic link between chronic periodontitis and coronary heart disease. Innate Immun 2016; 22(1):85-99. Doi: 10.1177/1753425915617521. [0138] 30. Gouni-Berthold I. Neutrophil-elastase in chronic inflammatory bowel disease: A marker of disease activity? Hepatogastroenterology 1999; 46(28):2315-20. [0139] 31. Fukunaga S., Kuwaki K., Mitsuyama K., et al. Detection of calprotectin in inflammatory bowel disease: Fecal and serum levels and immunohistochemical localization. Int J Mol Med 2017:107-18. Doi: 10.3892/ijmm.2017.3244. [0140] 32. Tardif M R., Chapeton-Montes J A., Posvandzic A., et al. Secretion of S100A8, S100A9, and S100A12 by Neutrophils Involves Reactive Oxygen Species and Potassium Efflux. J Immunol Res 2015; 2015. Doi: 10.1155/2015/296149. [0141] 33. Kabat, E. A., T. T. Wu, H. M. Perry, K. S. Gottesman and C. Foeller (1987), Sequences of Proteins of Immunological Interest, United States Department of Health and Human Services, Bethesda, Md., p. 1 [0142] 34. Martinez F J, Collard H R, Pardo A, Raghu G, Richeldi L, Selman M, Swigris J J, Taniguchi H, Wells A U. Idiopathic pulmonary fibrosis. Nat Rev Dis Primers. 2017 Oct. 20; 3:17074. doi: 10.1038/nrdp.2017.74. PMID: 29052582. [0143] 35. Sand J M, Martinez G, Midjord A K, Karsdal M A, Leeming D J, Lange P. Characterization of serological neo-epitope biomarkers reflecting collagen remodeling in clinically stable chronic obstructive pulmonary disease. Clin Biochem. 2016 October; 49(15):1144-1151. doi: 10.1016/j.clinbiochem. 2016.09.003. Epub 2016 Sep. 7. PMID: 27614218. [0144] 36. Jasper A E, McIver W J, Sapey E, Walton G M. Understanding the role of neutrophils in chronic inflammatory airway disease. F1000Res. 2019; 8:F1000 Faculty Rev-557. Published 2019 Apr. 26. doi:10.12688/f1000research.18411.1 [0145] 37. Obayashi Y, Yamadori I, Fujita J, Yoshinouchi T, Ueda N, Takahara J. The role of neutrophils in the pathogenesis of idiopathic pulmonary fibrosis. Chest. 1997 Nov. 5; 112(5):1338-43. doi: 10.1378/chest.112.5.1338. PMID: 9367478. [0146] 38. Hoskin T S, Crowther J M, Cheung J, et al. Oxidative cross-linking of calprotectin occurs in vivo, altering its structure and susceptibility to proteolysis. Redox Biol. 2019; 24:101202. doi:10.1016/j.redox.2019.101202 [0147] 39. Greten F R, Grivennikov S I. Inflammation and Cancer: Triggers, Mechanisms, and Consequences. Immunity. 2019 Jul. 16; 51(1):27-41. doi: 10.1016/j.immuni.2019.06.025. PMID: 31315034; PMCID: PMC6831096.