BISPECIFIC BINDING PROTEINS

20170342169 · 2017-11-30

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure provides bispecific proteins that bind to two antigens, as well as their compositions, uses, and methods of making.

    Claims

    1. A bispecific binding protein capable of binding CD40 and capable of binding mesothelin, comprising two polypeptides of formula (II):
    scFv.sup.X-H-Fc-L-scFv.sup.Y  (II), wherein L is a polypeptide linker, H is a hinge region, Fc comprises CH2 and CH3 regions of an immunoglobulin, scFv.sup.X and scFv.sup.Y are each independently a single chain variable fragment, scFv.sup.X specifically binds a first antigen, scFv.sup.Y specifically binds a second antigen, and one of the two antigens is CD40 and the other is mesothelin.

    2. The bispecific binding protein of claim 1, wherein scFv.sup.X- has the structure of formula (V) or (VI):
    V.sub.H.sup.X-L.sup.X-V.sub.L.sup.X-  (V),
    V.sub.L.sup.X-L.sup.X-V.sub.H.sup.X-  (VI), wherein V.sub.H.sup.X is a variable heavy chain, V.sub.L.sup.X is a variable light chain, and L.sup.X is a polypeptide linker.

    3. The bispecific binding protein of claim 1, wherein -scFv.sup.Y has the structure of formula (VII) or (VIII):
    -V.sub.L.sup.Y-L.sup.Y-V.sub.H.sup.Y  (VII),
    -V.sub.H.sup.Y-L.sup.Y-V.sub.L.sup.Y  (VIII), wherein V.sub.H.sup.Y is a variable heavy chain, V.sub.L.sup.Y is a variable light chain, and L.sup.Y is a polypeptide linker.

    4. The bispecific binding protein of claim 1, wherein L has an amino acid sequence comprising any one of SEQ ID NOS:251 and 253-262.

    5. The bispecific binding protein of claim 2, wherein L.sup.X and L.sup.Y each has an amino acid sequence comprising any one of SEQ ID NOS:301-306.

    6. The bispecific binding protein of claim 1, wherein the scFv that binds CD40 comprises a V.sub.H having a CDR-H1 according to SEQ ID NO:25, a CDR-H2 according to SEQ ID NO:26, and a CDR-H3 according to SEQ ID NO:27, and a V.sub.L having a CDR-L1 according to SEQ ID NO:55, a CDR-L2 according to SEQ ID NO:56, and a CDR-L3 according to SEQ ID NO:57.

    7. (canceled)

    8. The bispecific binding protein of claim 1, wherein the scFv that binds CD40 comprises a V.sub.H according to SEQ ID NO: 17 and a V.sub.L according to SEQ ID NO:44.

    9.-11. (canceled)

    12. The bispecific binding protein of claim 1, wherein the scFv that binds mesothelin comprises a V.sub.H having a CDR-H1 according to SEQ ID NO:241, a CDR-H2 according to SEQ ID NO:242, and a CDR-H3 according to SEQ ID NO:243, and a V.sub.L having a CDR-L1 according to SEQ ID NO:244, a CDR-L2 according to SEQ ID NO:245, and a CDR-L3 according to SEQ ID NO:246.

    13. (canceled)

    14. The bispecific binding protein of claim 1, wherein the scFv that binds mesothelin comprises a V.sub.H according to SEQ ID NO:120 and a V.sub.L according to SEQ ID NO:137.

    15. The bispecific binding protein of claim 1, wherein the scFv that binds mesothelin comprises a V.sub.H according to SEQ ID NO:120 and a V.sub.L according to SEQ ID NO:141.

    16.-18. (canceled)

    19. The bispecific binding protein of claim 1, wherein the two polypeptides each comprise the amino acid sequence of SEQ ID NO:406.

    20. The bispecific binding protein of claim 1, wherein the two polypeptides each comprise the amino acid sequence of SEQ ID NO:407.

    21. The bispecific binding protein of claim 1, wherein the two polypeptides each comprise the amino acid sequence of SEQ ID NO:408.

    22. (canceled)

    23. The bispecific binding protein of claim 1, wherein the two polypeptides each comprise the amino acid sequence of SEQ ID NO:419.

    24. The bispecific binding protein of claim 1, wherein the two polypeptides each comprise the amino acid sequence of SEQ ID NO:420.

    25. (canceled)

    26. A pharmaceutical composition comprising a bispecific binding protein of any claim 1, and a pharmaceutically acceptable carrier.

    27. A method of treating a cancer, comprising administering to a patient in need thereof a bispecific binding protein of claim 1, optionally wherein the cancer is a solid tumor.

    28. A bispecific binding protein capable of binding 4-1BB and capable of binding prostate-specific membrane antigen, comprising two polypeptides of formula (II):
    scFv.sup.X-H-Fc-L-scFv.sup.Y  (II), wherein L is a polypeptide linker, H is a hinge region, Fc comprises CH2 and CH3 regions of an immunoglobulin, scFv.sup.X and scFv.sup.Y are each independently a single chain variable fragment, scFv.sup.X specifically binds a first antigen, scFv.sup.Y specifically binds a second antigen, and one of the two antigens is 4-1BB and the other is prostate-specific membrane antigen.

    29.-32. (canceled)

    33. The bispecific binding protein of claim 28, wherein the scFv that binds 4-1BB comprises a V.sub.H having a CDR-H1 according to SEQ ID NO:280, a CDR-H2 according to SEQ ID NO:281, and a CDR-H3 according to SEQ ID NO:282, and a V.sub.L having a CDR-L1 according to SEQ ID NO:283, a CDR-L2 according to SEQ ID NO:284, and a CDR-L3 according to SEQ ID NO:285.

    34. (canceled)

    35. The bispecific binding protein of claim 33, wherein the scFv that binds 4-1BB comprises a V.sub.H according to SEQ ID NO:69 and a V.sub.L according to SEQ ID NO:89.

    36. The bispecific binding protein of claim 33, wherein the scFv that binds 4-1BB comprises a V.sub.H according to SEQ ID NO:71 and a V.sub.1 according to SEQ ID NO:94.

    37. The bispecific binding protein of claim 28, wherein the scFv that binds prostate-specific membrane antigen comprises a V.sub.H according to any one of SEQ ID NOS:191-197 and a V.sub.L according to any one of SEQ ID NOS:201-207.

    38.-40. (canceled)

    41. The bispecific binding protein of claim 28, wherein the two polypeptides each comprise the amino acid sequence of SEQ ID NO:447.

    42. (canceled)

    43. A pharmaceutical composition comprising a bispecific binding protein of claim 28, and a pharmaceutically acceptable carrier.

    44. A method of treating a cancer, comprising administering to a patient in need thereof a bispecific binding protein of claim 28, optionally wherein the cancer is a solid tumor.

    45. A bispecific binding protein capable of binding CD40 and capable of binding mesothelin, comprising two polypeptides of formula (III):
    Fab-H-Fc-L-scFv.sup.Y  (III), wherein L is a polypeptide linker, H is a hinge region, Fc comprises CH2 and CH3 regions of an immunoglobulin, Fab is a fragment antigen-binding region, scFv.sup.Y is a single chain variable fragment, Fab specifically binds a first antigen, scFv.sup.Y specifically binds a second antigen, and the first antigen is mesothelin and the second antigen is CD40.

    46.-48. (canceled)

    49. The bispecific binding protein of claim 45, wherein the scFv that binds CD40 comprises a Vii having a CDR-H1 according to SEQ ID NO:25, a CDR-H2 according to SEQ ID NO:26, and a CDR-H3 according to SEQ ID NO:27, and a V.sub.L having a CDR-L1 according to SEQ ID NO:55, a CDR-L2 according to SEQ ID NO:56, and a CDR-L3 according to SEQ ID NO:57.

    50.-51. (canceled)

    52. The bispecific binding protein of claim 45, wherein the scFv that binds CD40 comprises a Vii according to SEQ ID NO:22 and a V.sub.L according to SEQ ID NO:48.

    53. The bispecific binding protein of claim 45, wherein the scFv that binds CD40 comprises a V.sub.H according to SEQ ID NO:23 and a V.sub.L according to SEQ ID NO:49.

    54. (canceled)

    55. The bispecific binding protein of claim 45, wherein the Fab that binds mesothelin comprises a V.sub.H according to SEQ ID NO: 120 and a V.sub.L according to SEQ ID NO:137.

    56. The bispecific binding protein of claim 45, wherein the Fab that binds mesothelin comprises a Vii according to SEQ ID NO:129 and a V.sub.L according to SEQ ID NO:143.

    57. (canceled)

    58. The bispecific binding protein of claim 45, wherein the two polypeptides each comprise the heavy chain amino acid sequence of SEQ ID NO: 359 and the light chain amino acid sequence of SEQ ID NO: 371.

    59. The bispecific binding protein of claim 45, wherein the two polypeptides each comprise the heavy chain amino acid sequence of SEQ ID NO: 360 and the light chain amino acid sequence of SEQ ID NO: 371.

    60.-61. (canceled)

    62. A pharmaceutical composition comprising a bispecific binding protein of claim 45, and a pharmaceutically acceptable carrier.

    63. A method of treating a cancer, comprising administering to a patient in need thereof a bispecific binding protein of claim 45, optionally wherein the cancer is a solid tumor.

    64. A bispecific binding protein comprising two polypeptides of formula (I):
    X-H-Fc-L-scFv.sup.Y  (I), wherein X is scFv.sup.X or a Fab region, wherein X specifically binds a first antigen and scFv.sup.Y specifically binds a second antigen, H is a hinge region, Fc comprises CH2 and CH3 regions of an immunoglobulin, L is a polypeptide linker, scFv.sup.X and scFv.sup.Y are each independently a single chain variable fragment, one of the two antigens is an immunomodulatory protein and the other is a tumor antigen, and the bispecific binding protein activates the immunomodulatory protein.

    65. (canceled)

    66. The bispecific binding protein of claim 64, wherein the immunomodulatory protein is selected from CD40, 4-1BB, TNFR2, ICOS, TRAILR1, and TRAILR2.

    67.-68. (canceled)

    69. The bispecific binding protein of claim 64, wherein the tumor antigen is selected from mesothelin, nectin-4, epidermal growth factor receptor, prostate-specific membrane antigen, and B7-H4.

    70. (canceled)

    71. The bispecific binding protein of claim 64, wherein the first antigen is an immunomodulatory protein and the second antigen is a tumor antigen.

    72. (canceled)

    73. A pharmaceutical composition comprising a bispecific binding protein of claim 64, and a pharmaceutically acceptable carrier.

    74. (canceled)

    75. A nucleic acid comprising a nucleotide sequence encoding a bispecific binding protein of claim 1.

    76.-77. (canceled)

    78. A eukaryotic host cell transformed with the vector comprising the nucleic acid of claim 75.

    79.-80. (canceled)

    81. A method of producing a bispecific binding protein, comprising: (a) culturing the host cell of claim 78 and (b) recovering the protein.

    82. A method of activating the immune system, comprising administering to a patient in need thereof a bispecific binding protein of claim 1.

    Description

    6. BRIEF DESCRIPTION OF THE FIGURES

    [0025] FIGS. 1A-1B show representations of bispecific binding protein formats of the disclosure. FIG. 1A depicts an exemplary embodiment of a bispecific binding protein of the disclosure having scFv regions; FIG. 1B depicts an exemplary embodiment of a bispecific binding protein of the disclosure having an IgG region and scFv regions.

    [0026] FIGS. 2A-2B depict representations of bispecific binding proteins that do not afford conditional activation when targeting an immunomodulatory protein in the presence of a tumor antigen. FIG. 2A depicts a dual variable domain immunoglobulin (DVD-Ig); FIG. 2B depicts a crossover dual variable domain protein (CO-DVD).

    [0027] FIGS. 3A-3G depict exemplary amino acid sequences of anti-CD40 antibody variable domains. CDR amino acid sequences are shown in bold. FIG. 3A-3C depicts amino acid sequences of mouse anti-human CD40 antibody variable domains: FIG. 3A shows muAb1 through muAb3; FIG. 3B shows muAb4 through muAb7; FIG. 3C shows muAb8 through muAb10. FIG. 3D-3G depicts amino acid sequences of humanized anti-human CD40 antibody variable domains: FIG. 3D shows antibodies derived from muAb6 and muAb8; FIG. 3E shows antibodies derived from muAb8 and muAb9; FIG. 3F shows antibodies derived from muAb9; and FIG. 3G shows further antibodies derived from muAb9.

    [0028] FIGS. 4A-4E depict exemplary amino acid sequences of anti-mesothelin antibody variable domains. CDR amino acid sequences are shown in bold. FIG. 4A shows sequences from HuAb17 and HuAM1 through HuAM4; FIG. 4B shows sequences from HuAM5 through HuAM9; FIG. 4C shows sequences from HuAM11 through HuAM18; FIG. 4D shows sequences from HuAM19, HuAM21 and HuAM15 variants; FIG. 4E shows sequences from MSLN76923 and a HuAM15 variant.

    [0029] FIGS. 5A-5C show binding of anti-mesothelin antibodies HuAM5, HuAM11, and HuAM16 in the presence of increasing amounts of CA125 in different cancer cell lines. FIG. 5A depicts OVCAR-3 ovarian cancer cell results; FIG. 5B depicts SW1990 pancreatic cancer cell results; FIG. 5C depicts SN12C renal cancer cell results.

    [0030] FIGS. 6A-6B depict binding curves of different concentrations of anti-mesothelin antibodies HuAM5, HuAM11, and HuAM16 with or without soluble CA125 in different cell lines. FIG. 6A depicts results in 293 cells expressing mesothelin; FIG. 6B depicts results in OVCAR-3 ovarian cancer cells.

    [0031] FIGS. 7A-7G depict amino acid sequences of exemplary anti-4-1BB antibody variable domains. FIG. 7A depicts sequences from rat TABBY101 through TABBY103. FIG. 7B depicts sequences from rat TABBY104 through TABBY106. FIG. 7C depicts sequences from rat TABBY107 and TABBY108. FIG. 7D depicts sequences of humanized antibodies. FIG. 7E depicts additional humanized antibodies. FIG. 7F depicts sequences from mouse TABBY1.1 through TABBY5. FIG. 7G depicts sequences from mouse TABBY6 through TABBY10. CDR amino acid sequences are shown in bold.

    [0032] FIGS. 8A-8H depict amino acid sequences of exemplary bispecific binding proteins against CD40 and mesothelin. FIG. 8A shows LB-1 and h24; FIG. 8B shows h26 and B37; FIG. 8C shows B38 and B39; FIG. 8D shows B40 and B41; FIG. 8E shows B42 and B43; FIG. 8F shows B44 and B45; FIG. 8G shows B46, and V6-2; FIG. 8H shows V6-5 and V6-6. CD40 CDRs are shown in bold; mesothelin CDRs are shown in bold underline; constant region is shown in italics dotted underline.

    [0033] FIGS. 8I-8M depict amino acid sequences of exemplary bispecific binding proteins against 4-1BB and mesothelin. FIG. 8I shows hu106MSLN-1 and hu106MSLN-2; FIG. 8J shows hu106MSLN-3 and hu106MSLN-4; FIG. 8K shows hu106MSLN-5 and hu106MSLN-6; FIG. 8L shows hu107MSLN-1 and hu107MSLN-2; FIG. 8M shows hu107MSLN-3 and hu107MSLN-4. 4-1BB CDRs are shown in bold; mesothelin CDRs are shown in bold underline; constant region is shown in italics dotted underline.

    [0034] FIGS. 9A-9B depict activation of immune cells (dendritic cells and B cells, respectively) by bispecific binding proteins of the disclosure in the presence of mesothelin. Black bar depicts results for immune cells co-cultured with HEK293 cells without mesothelin (“293S”); hollow bar depicts results for immune cells co-cultured with HEK293 cells expressing cell-surface human mesothelin (“293S huMSLN”). FIG. 9A shows IL-12p70 levels in dendritic cells (DC) on the y-axis; FIG. 9B shows B cell proliferation in counts per minute (CPM) on the y-axis.

    [0035] FIGS. 10A-10L depict amino acid sequences of antibody variable domains or corresponding bispecific proteins for immunomodulatory proteins CD40 or 4-1BB and tumor antigens nectin-4, EGFR, B7-H4 or PSMA. FIG. 10A depicts amino acid sequences of exemplary antibody variable domains against nectin-4, EGFR, or PSMA. CDR amino acid sequences are shown in bold.

    [0036] FIG. 10B depicts amino acid sequences of exemplary bispecific binding proteins binding CD40 and nectin-4. CD40 CDRs are shown in bold; nectin-4 CDRs are shown in bold underline; constant region is shown in italics dotted underline.

    [0037] FIG. 10C depicts amino acid sequences of exemplary bispecific binding proteins R89 and R90 binding CD40 and PSMA. FIG. 10D depicts amino acid sequences of exemplary bispecific binding proteins A16 and A17 binding CD40 and EGFR. CD40 CDRs are shown in bold; tumor antigen CDRs are shown in bold underline; constant region is shown in italics dotted underline.

    [0038] FIGS. 10E-10G depict amino acid sequences of exemplary murine and humanized antibody variable domains against B7-H4. FIG. 10E shows mouse 182.19.1, a humanized 182.19.1, and mouse 182.17.1; FIG. 10F shows mouse 182.10.21 and humanized versions of 182.17.1, 182.19.1, and 182.10.21; FIG. 10G shows mouse 181.23.1 and humanized versions of 182.10.21 and 181.23.1. CDR amino acid sequences are shown in bold.

    [0039] FIGS. 10H and 10I depict amino acid sequences of exemplary bispecific proteins binding 4-1BB and B7-H4. FIG. 10H shows Hu106B7H4-1 and Hu106B7H4-2; FIG. 10I shows Hu106B7H4-3 and Hu106B7H4-4. 4-1BB CDRs are shown in bold; B7-H4 CDRs are shown in bold underline.

    [0040] FIG. 10J depicts amino acid sequences of exemplary antibody variable domains against PSMA. FIG. 10K depicts additional sequences of antibody variable domains against PSMA. CDR amino acid sequences are shown in bold.

    [0041] FIG. 10L depicts amino acid sequences of exemplary bispecific proteins binding 4-1BB and PSMA. 4-1BB CDRs are shown in bold; PSMA CDRs are shown in bold underline.

    [0042] FIGS. 11A-11B depict effects of bispecific binding proteins that bind CD40 and either nectin-4 or PSMA in various B cell co-cultures. FIG. 11A depicts the effects of bispecific protein R87 binding CD40 and nectin-4 in B cells cultured alone (upper graph), B cells co-cultured with HEK293 cells (middle graph), and B cells co-cultures with HEK293 cells expressing nectin-4 (lower graph), as compared with isotype control, anti-CD40 antibody huAb6-1, or anti-nectin-4 antibody 66.3. FIG. 11B depicts the effects of bispecific protein R89 binding CD40 and PSMA in B cells cultured with 4T1 cells (upper graph), and B cells co-cultures with 4T1 cells expressing PSMA (lower graph), as compared with isotype control, anti-CD40 antibody huAb6-1, or anti-PSMA antibody SAM3.1.

    [0043] FIGS. 12A-12B depict effects of bispecific binding proteins that bind 4-1BB and mesothelin in a FACS assay. FIG. 12A shows effects of hu106MSLN-1 through hu106MSLN-4; and FIG. 12B shows effects of hu107MSLN-1 through hu107MSLN-4. The graphs show binding in the presence of HEK293 cells expressing 4-1BB (upper graphs) or HEK293 cells expressing mesothelin (lower graphs).

    [0044] FIG. 13 depicts the agonistic activity of 4-1BB bispecific proteins binding mesothelin measured by luciferase gene expression driven by NF-κB. Upper graph depicts effects on 4-1BB transfected in HEK293 cells in the presence of an Fc cross-linker; lower graph depicts effects without Fc cross-linker.

    [0045] FIGS. 14A-14B depict the activity of 4-1BB bispecific proteins binding mesothelin in the presence of HEK293 cells with or without cell-surface mesothelin. Upper graphs depict effects in HEK293 cells expressing mesothelin; lower graphs depict effects in HEK293 cells with mock transfectant. FIG. 14A shows effects of hu106MSLN-1 through hu106MSLN-4; and FIG. 14B shows effects of hu107MSLN-1 through hu107MSLN-4.

    [0046] FIGS. 15A-15C depict conditional CD8+ T cell activation by bispecific binding proteins of the disclosure binding 4-1BB and mesothelin. FIG. 15A shows CD8+ T cell proliferation effects in counts per minute (cpm) in the presence of CT26 cells expressing mesothelin (upper graph) or in the presence of CT26 cells without mesothelin (lower graph); FIG. 15B shows interferon-gamma secretion from CD8+ T cells in the presence of CT26 cells expressing mesothelin (upper graph) or in the presence of CT26 cells without mesothelin (lower graph). FIG. 15C shows effects of bispecific protein administration on interferon-gamma secretion from CD8+ T cells in the presence of PC3 cells expressing mesothelin (upper graph) or PC3 cells (lower graph).

    [0047] FIGS. 15D-15E shows the effects of bispecific binding proteins of formula (I) binding 4-1BB and PSMA. FIG. 15D shows the effects of exemplary bispecific proteins in a FACS assay showing binding in the presence of CT26 cells expressing mouse PSMA (upper graph) or HEK293 cells expressing mouse 4-1BB (lower graph). FIG. 15E shows the agonistic activity measured by NFκB activation of exemplary bispecific proteins in the presence of CT26 cells with or without cell-surface PSMA: upper graph depicts effects in CT26 cells expressing mouse PSMA; lower graph depicts effects in CT26 cells with mock transfectant.

    [0048] FIG. 16 shows effects of bispecific binding proteins of formula (I) binding CD40 and mesothelin as compared to isotype control antibody in co-cultures of PC3 tumor cell expressing mesothelin with DC and T cells.

    [0049] FIGS. 17A-17B show effects of bispecific binding proteins of formula (I) binding CD40 and mesothelin (“MSLN”), PSMA, or nectin-4 in mouse PC3 cancer cell models. FIG. 17A shows effects of bispecific binding protein h24 in PC3 tumors expressing mesothelin (upper graph) and effects of bispecific binding protein R89 in PC3 tumors expressing PSMA (lower graph). FIG. 17B shows effects of bispecific binding protein R87 in PC3 tumors expressing nectin-4 (upper graph) and effects of bispecific binding protein h24 in PC3 tumors without mesothelin expression (lower graph).

    [0050] FIG. 18 shows effects of anti-CD40 antibody 1C10 and bispecific binding protein LB-1 on tumor volume in mice carrying 4T1 syngeneic tumors expressing mesothelin (“4T1 MSLN”).

    [0051] FIG. 19 depicts effects of dosing anti-CD40 antibody 1C10, anti-mesothelin antibody MOR06626, or bispecific binding protein LB-1 on liver enzyme ALT levels in mg/dL in mice carrying 4T1 syngeneic tumors expressing mesothelin.

    [0052] FIG. 20 depicts effects on cytokine levels interleukin-6 (“IL-6”), tumor necrosis factor-alpha (“TNFa”), keratinocyte chemoattractant (“KC”), interferon gamma-induced protein 10 (“IP-10”) and monokine induced by interferon-gamma (“MIG”) in mice after dosing with 5 mg/kg of anti-CD40 antibody 1C10 mIgG1 (“1C10”), mouse IgG1 (“isotype”), and bispecific binding protein LB-1 (“LB-1”).

    [0053] FIG. 21 depicts effects of repeat dosing of an anti-4-1BB antibody, an anti-4-1BB anti-PSMA binding protein, or isotype control on tumor volume in syngeneic immunocompetent Balb/c mice bearing CT26-PSMA tumors. Anti-4-1BB antibody hu106-1 with muIgG1 constant region and T252M mutation (“hu106-1 mIgG1 T252M”), bispecific binding proteins Hu106mPSMA-3 or Hu106mPSMA-4, or isotype control TIB191 mIgG1 was administered three times total. Dosing was performed on days 18, 20, and 22 post-inoculation as indicated by arrows. Y-axis shows tumor volume in mm.sup.3, x-axis shows days post-inoculation.

    [0054] FIGS. 22A and 22B depict tumor volumes in individual animals after repeat dosing of an anti-4-1BB antibody, an anti-4-1BB anti-PSMA binding protein, or isotype control in syngeneic immunocompetent Balb/c mice bearing CT26-PSMA tumors. FIG. 22A shows data in animals dosed with TIB191 mIgG1 (upper graph) and anti-4-1BB antibody hu106-1 mIgG1 T252M (lower graph). FIG. 22B shows data in animals dosed with anti-4-1BB anti-PSMA binding proteins Hu106mPSMA-3 (upper graph) and Hu106mPSMA-4 (lower graph). Dosing was performed on days 18, 20, and 22 post-inoculation as indicated by arrows. Y-axis shows tumor volume in mm.sup.3, x-axis shows days post-inoculation.

    [0055] FIGS. 23A and 23B depict serum cytokine levels after repeat dosing of an anti-4-1BB antibody, an anti-4-1BB anti-PSMA binding protein, or isotype control in syngeneic immunocompetent Balb/c mice bearing CT26-PSMA tumors. FIG. 23A shows serum levels of monocyte chemoattractant protein-1 (“MCP-1”, upper graph) and granulocyte-macrophage colony-stimulating factor (“GM-CSF”, lower graph). FIG. 23B shows serum levels of interleukin-6 (“IL-6”, upper graph) and keratinocyte chemoattractant (“KC”, lower graph). Y-axis shows serum cytokine level in pg/mL, x-axis shows control antibody TIB191 mIgG1, anti-4-1BB antibody hu106-1 mIgG1 T252M, binding protein Hu106mPSMA-3 or Hu106mPSMA-4.

    [0056] FIG. 23C depicts CD45+ staining in mouse liver samples after repeat dosing of an anti-4-1BB antibody, an anti-4-1BB anti-PSMA binding protein, or isotype control in syngeneic immunocompetent Balb/c mice bearing CT26-PSMA tumors. Y-axis shows % CD45+ staining, x-axis shows control antibody TIB191 mIgG1, anti-4-1BB antibody hu106-1 mIgG1 T252M, binding protein Hu106mPSMA-3 or Hu106mPSMA-4.

    7. DETAILED DESCRIPTION

    7.1. Abbreviations

    [0057] The bispecific binding proteins and polynucleotides described herein are, in many embodiments, described by way of their respective polypeptide or polynucleotide sequences. Unless indicated otherwise, polypeptide sequences are provided in N.fwdarw.C orientation; polynucleotide sequences in 5′.fwdarw.3′ orientation. For polypeptide sequences, the conventional three or one-letter abbreviations for the genetically encoded amino acids are used, as noted in TABLE 1, below.

    TABLE-US-00001 TABLE 1 Encoded Amino Acid Abbreviations Three Letter One-Letter Amino Acid Abbreviation Abbreviation Alanine Ala A Arginine Arg R Asparagine Asn N Aspartic acid Asp D Cysteine Cys C Glutamic acid Glu E Glutamine Gln Q Glycine Gly G Histidine His H Isoleucine Ile I Leucine Leu L Lysine Lys K Methionine Met M Phenylalanine Phe F Proline Pro P Serine Ser S Threonine Thr T Tryptophan Trp W Tyrosine Tyr Y Valine Val V

    [0058] Certain sequences are defined by structural formulae specifying amino acid residues belonging to certain classes (e.g., aliphatic, hydrophobic, etc.). The various classes to which the genetically encoded amino acids belong as used herein are noted in TABLE 2, below. Some amino acids may belong to more than one class. Cysteine, which contains a sulfhydryl group, and proline, which is conformationally constrained, are not assigned classes.

    TABLE-US-00002 TABLE 2 Encoded Amino Acid Classes Class Amino Acids Aliphatic A, I, L, V Aromatic F, Y, W Non-Polar M, A, I, L, V Polar N, Q, S, T Basic H, K, R Acidic D, E Small A, G

    7.2. Definitions

    [0059] Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure have the meanings that are commonly understood by those of ordinary skill in the art.

    [0060] As used herein, numbering of binding protein amino acid residues is done according to Kabat EU nomenclature unless otherwise indicated.

    7.3. Bispecific Binding Proteins

    [0061] 7.3.1. Bispecific Formats

    [0062] To assist understanding, two exemplary embodiments of bispecific binding proteins are illustrated in FIGS. 1A-1B. With reference to FIG. 1A, one exemplary embodiment comprises two polypeptides linked together via disulfide bonds (17). Each polypeptide comprises a V.sub.H region (10a or 10b) and a respective V.sub.L region (14a or 14b) linked together by a respective polypeptide linker (12a or 12b). Together V.sub.H 10a, V.sub.L 14a and linker 12a constitute a single chain variable fragment (scFv), referred to herein as scFv.sub.a. Similarly, V.sub.H 10b, V.sub.L 14b and linker 12b constitute scFv.sub.b. The V.sub.L region (14a or 14b) is fused to a hinge region (16a or 16b, respectively), which in turn is fused to an Fc region, which comprises a CH2 domain (18a or 18b, respectively) fused to a CH3 domain (20a or 20b, respectively). The scFv.sub.a.sup.X or scFv.sub.b.sup.X regions may bind to the same or different antigens but in many embodiments bind the same antigen. As illustrated, scFv.sub.a.sup.X and scFV.sub.b.sup.X specifically bind to a first antigen (antigen X).

    [0063] The binding protein in FIG. 1A comprises a second scFv, scFv.sup.Y, which comprises a second V.sub.L region (24a or 24b) (i.e., V.sub.L.sup.Y) and a second V.sub.H region (28a or 28b, respectively) (i.e., V.sub.H.sup.Y) linked together via a variable chain linker (26a or 26b, respectively). Together V.sub.H 28a, variable chain linker 26a, and V.sub.L 24a constitute a scFv, scFv.sub.a.sup.Y, attached via linker 22a to the C-terminal end of CH3 domain 20a. Similarly, V.sub.H 28b, variable chain linker 26b, and V.sub.L 24b constitute scFV.sub.b.sup.Y attached by linker 22b at the C-terminus of CH3 domain 20b. The two moieties scFv.sub.a.sup.Y and scFV.sub.b.sup.Y may bind to the same or different antigens but in many embodiments bind the same antigen. In some embodiments, scFv.sub.a.sup.Y and scFV.sub.b.sup.Y specifically bind a second antigen (antigen Y).

    [0064] Referring to FIG. 1B, another exemplary embodiment comprises an IgG linked at the C-terminal end of each CH3 domain 20a or 20b to a respective scFv via linker 22a or 22b. The IgG portion comprises two V.sub.H (10a or 10b) and two V.sub.L (14a or 14b) domains, each attached to their corresponding CH1 (30a or 30b) and CL (32a or 32b) regions. As is known in the art, an IgG CH1 region (30a or 30b) is attached to a corresponding hinge (16a or 16b, respectively), which is fused to an Fc region, which comprises a CH2 domain (18a or 18b) fused to a CH3 domain (20a or 20b). At each of the C-termini of CH3 domains 20a or 20b is a linker 22a or 22b, respectively, linking to V.sub.L 24a or 24b of the scFv. The V.sub.L 24a or 24b is then linked via linker 26a or 26b to V.sub.H 28a or 28b, respectively.

    [0065] CH1 regions 30a and 30b, and CL regions 32a and 32b that compose the Fab domain may independently be IgG.sub.1, IgG.sub.2, or IgG.sub.4 regions. CH1 regions 30a and 30b can be the same or different, but in many embodiments are the same. Similarly, CL regions 32a and 32b can be the same or different, but in many embodiments are the same.

    [0066] The linkers 12a or 12b linking their respective V.sub.L and V.sub.H regions may the same or different, but in most embodiments are the same. Likewise, linkers 26a or 26b may be the same or different, but in most embodiments are the same, and may be the same as linkers 12a or 12b. In some embodiments, linkers 12a or 12b are the same. In some embodiments, linkers 26a or 26b are the same. Specific sequences for linkers useful for linking V.sub.H and V.sub.L chains are provided in a later section.

    [0067] As noted above in FIG. 1A, scFv.sub.a.sup.X and scFV.sub.b.sup.X specifically bind a first antigen (antigen X). Binding specificity, as well as affinity, is imparted by V.sub.H chains (10a or 10b) (i.e., V.sub.H.sup.X) and V.sub.L chains (14a or 14b, respectively) (i.e., V.sub.L.sup.X). In the binding proteins of the disclosure and the specific embodiment depicted in FIG. 1A, the respective CDRs comprising V.sub.H 14a and 14b may be the same or different, as may be the overall V.sub.H chains. In a specific embodiment, V.sub.H 14a and 14b are the same, and V.sub.L 10a and 10b are the same.

    [0068] Similarly, scFv.sub.a.sup.Y and scFv.sub.b.sup.Y specifically bind a second antigen (antigen Y). Binding specificity, as well as affinity, is imparted by V.sub.H chains (28a or 28b) (i.e., V.sub.H.sup.Y) and V.sub.L chains (24a or 24b, respectively) (i.e., V.sub.L.sup.Y). In the binding proteins of the disclosure and the specific embodiments depicted in FIGS. 1A and 1B, the respective CDRs comprising V.sub.H 28a and 28b may be the same or different, as may be the overall V.sub.H chains. In a specific embodiment, V.sub.H 28a and 28b are the same, and V.sub.L 24a and 24b are the same.

    [0069] As is known in the art, each V.sub.H chain has three complementarity determining regions (“CDRs”) referred to herein (in N.fwdarw.C order) as V.sub.H CDR#1, V.sub.H CDR#2, and V.sub.H CDR#3, and each V.sub.L chain has three CDRs referred to herein (in N.fwdarw.C order) as V.sub.L CDR#1, V.sub.L CDR#2, and V.sub.L CDR#3. Specific exemplary CDR, V.sub.H and V.sub.L sequences useful for binding specific antigens of interest are provided in a later section.

    [0070] The scFv regions that compose the bispecific binding proteins of the disclosure, e.g., a bispecific binding protein of formula (I), comprise V.sub.H and V.sub.L regions that together specifically bind an antigen. The V.sub.H and V.sub.L regions and CDRs incorporated into bispecific binding proteins may be derived from multiple sources, including pre-existing antibodies, newly generated antibodies, V.sub.H and V.sub.L chain libraries, CDR libraries or synthetic sequences. The V.sub.H and V.sub.L chains within a scFv are linked by way of a polypeptide linker that does not significantly interfere with the antigen binding properties of the V.sub.H and V.sub.L regions. The scFv regions can have a V.sub.H-V.sub.L or a V.sub.L-V.sub.H orientation (in N.fwdarw.C direction), and the orientation can be the same or different between scFv.sup.X and scFv.sup.Y. Accordingly, in bispecific binding proteins that comprise an scFv region at both the N- and C-termini, the orientation of the variable chains can be V.sub.H.sup.X-V.sub.L.sup.X and V.sub.L.sup.Y-V.sub.H.sup.Y; V.sub.H.sup.X-V.sub.L.sup.X and V.sub.H.sup.Y-V.sub.L.sup.Y; V.sub.L.sup.X-V.sub.H.sup.X and V.sub.L.sup.Y-V.sub.H.sup.Y; or V.sub.L.sup.X-V.sub.H.sup.X and V.sub.H.sup.Y-V.sub.L.sup.Y. In the example described above and illustrated in FIG. 1A, the bispecific binding protein comprises a polypeptide with a variable chain orientation of V.sub.H.sup.X-V.sub.L.sup.X and V.sub.L.sup.Y-V.sub.H.sup.Y.

    [0071] In some embodiments of the disclosure, the bispecific binding proteins exhibit conditional activation, by which they provide activation of an immunomodulatory protein in the presence of a cell-surface tumor antigen, and reduced, minimal or no activation of the immunomodulatory protein in the absence of the cell-surface tumor antigen. In contrast, the bispecific binding proteins shown in FIGS. 2A-2B do not afford conditional activation. FIG. 2A depicts one embodiment in the dual variable domain immunoglobulin (DVD-Ig) format, in which the two variable regions 1 and 2, specifically binding to two antigens, are linked in tandem prior to fusion to an IgG constant region. FIG. 2B shows a bispecific protein of the crossover dual variable domain (CO-DVD) format, in which the variable regions 1 and 2, that bind specifically to two antigens, are linked in tandem by a longer linker region and are also fused to an IgG constant region.

    [0072] In some embodiments, a bispecific binding protein of the disclosure comprises a linker linking the single chain variable fragment V.sub.H chain with the V.sub.L chain, the linker independently in each instance having a sequence corresponding to a sequence selected from one of the sequences in the table below:

    TABLE-US-00003 Sequence (N.fwdarw.C) Identifier GGGGSGGGGSGGGGS SEQ ID NO: 301 GGGGSGGGGSGGGGSGGGGS SEQ ID NO: 302 GGGGSGGGGSGGGGSGGGGSGGGGS SEQ ID NO: 303 GGGGSGGGGSGGGGSGGGGSGGGGSGGGGS SEQ ID NO: 304 GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS SEQ ID NO: 305 GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSG SEQ ID NO: 306 GGGS

    [0073] The linker linking the single chain variable fragment V.sub.H chain with the V.sub.L chain may be selected to increase expression, solubility, stability (for example, as measured by lower aggregation levels, lower rate of aggregation, higher melting temperature, and/or longer plasma half-life), and/or titer of a bispecific binding protein of the disclosure.

    [0074] As is known in the art, hinge regions 16a and 16b connect the variable regions 14a and 14b with the CH2 domains 18a and 18b, respectively. IgG.sub.1, IgG.sub.2, IgG.sub.3 or IgG.sub.4 hinge regions may be used, as well as variant hinge regions as is known in the art.

    [0075] Hinge region variants can be used in the bispecific binding proteins of the disclosure to optimize certain characteristics. In an illustrative example, one or more amino acid substitutions, insertions, and/or deletions within a hinge region of a human IgG.sub.1, IgG.sub.2, IgG.sub.3 or IgG.sub.4 can be introduced to reduce the level or rate of fragmentation and/or aggregation. Such modifications have been described, for example, by Cohen, S. L. et al. Journal of the American Chemical Society, 129 (22), 6976-6977 (2007). In a particular embodiment, the bispecific binding protein of the disclosure comprises a variant IgG.sub.1, IgG.sub.2 or IgG.sub.4, for example, an IgG.sub.1 or IgG.sub.2 hinge region comprising the amino acid substitution C219S and/or C220S. See, US Patent Appl. No. 2010/0226925. In another embodiment, the bispecific binding protein comprises an IgG.sub.4 hinge region comprising the amino acid substitution S228P.

    [0076] As used herein, the “constant region” includes the natural constant region of an antibody and allotypes or natural variants, such as D356E and L358M, or A431G in human IgG.sub.1. See, e.g., Jefferis and Lefranc, MAbs, 1(4): 332-338 (July-August 2009). The light constant region may be a kappa (κ) light region or a lambda (λ) region. A X light region can be any one of the known subtypes, e.g., λ.sub.1, λ.sub.2, λ.sub.3, or λ.sub.4. In some embodiments, the X light region has a C-terminal residue truncation as compared to the corresponding wild type sequence. See, e.g., Shen et al., MAbs, 5(3): 418-431 (May-June 2013). In some embodiments, the anti-CD40 antibody comprises a kappa (κ) light region.

    [0077] As is standard in a fragment crystallizable (Fc) region of an IgG, CH2 domains 18a and 18b are fused with their respective CH3 domains 20a and 20b. CH3 regions from IgG.sub.1, IgG.sub.2, or IgG.sub.4 constant regions may be used, as well as variant constant regions as is known in the art, and can be the same or different, but in many embodiments are the same.

    [0078] An exemplary constant region variant corresponds to “mutant 3” (shown in FIG. 4 of U.S. Pat. No. 5,834,597) in which residues 234 and 237 (using EU numbering) are substituted with alanines. A mutant 3 (also known as “M3”) variant can be used in a number of isotypes, e.g., IgG.sub.2.

    [0079] Another exemplary constant region variant with S228P, i.e., in which a serine residue is substituted with proline, can be used for IgG.sub.4. See, Angal, S. et al. Molecular Immunology, 30, 105-108 (1993) and Bloom, J. W. et al. Protein Science, 6: 407-514 (1997).

    [0080] The bispecific binding proteins of the disclosure may be proteins whose sequences have been modified to alter at least one constant region-mediated biological effector function. For example, in some embodiments, a bispecific binding protein may be modified to reduce at least one constant region-mediated biological effector function relative to the unmodified binding protein, e.g., reduced binding to the Fc receptor (FcγR). FcγR binding may be reduced by mutating the immunoglobulin constant region segment of the binding protein at particular regions necessary for FcγR interactions (See, e.g., Canfield and Morrison, 1991, J. Exp. Med. 173:1483-1491; and Lund et al., 1991, J. Immunol. 147:2657-2662). Reducing FcγR binding may also reduce other effector functions which rely on FcγR interactions, such as opsonization, phagocytosis and antigen-dependent cellular cytotoxicity (“ADCC”).

    [0081] The bispecific binding proteins of the disclosure can comprise modified (or variant) CH2 domains or entire Fc domains that include amino acid substitutions that increase binding to FcγRIIB and/or reduced binding to FcγRIIIA as compared to the binding of a corresponding wild-type CH2 or Fc region. A binding protein of the disclosure can be a monomer or multimer (e.g., dimer or tetramer), each monomeric unit comprising one or more CH2 or Fc domains. Variant CH2 or variant Fc domains have been described, for example, in U.S. Pat. App. No. 2014/0377253. A variant CH2 or variant Fc domain typically includes one or more substitutions at position 263, position 266, position 273, and position 305, wherein the numbering of the residues in the Fc domain is that of the EU index as in Kabat. In some embodiments, the bispecific binding proteins comprise one or more substitutions selected from V263L, V266L, V273C, V273E, V273F, V273L, V273M, V273S, V273Y, V305K, and V305W, relative to the wild-type CH2 domain. In specific embodiments, the one or more substitutions of the CH2 domain are selected from V263L, V273E, V273F, V273M, V273S, and V273Y, relative to the CH2 domain of a human IgG.sub.1. For example, the one or more substitutions of an IgG.sub.1 CH2 domain can be V273E. In another specific embodiment, the bispecific binding protein of the disclosure comprises a variant IgG.sub.1 CH2 domain comprising the amino acid substitution V263L.

    [0082] Other examples of variant CH2 or variant Fc domains that can increase binding to FcγRIIB and/or reduce binding to FcγRIIIA as compared to the binding of a corresponding wild-type CH2 or Fc region include those found in Vonderheide, et al. Clin. Cancer Res., 19(5), 1035-1043 (2013), such as S267E or S267E/L328F.

    [0083] The bispecific binding proteins of the disclosure may include modifications that increase or decrease their binding affinities to the neonatal Fc receptor, FcRn, for example, by mutating the immunoglobulin constant region segment at particular regions involved in FcRn interactions (see, e.g., WO 2005/123780). In particular embodiments, a bispecific binding protein of the IgG class is mutated such that at least one of amino acid residues 250, 314, and 428 of the heavy chain constant region is substituted alone, or in any combinations thereof, such as at positions 250 and 428, or at positions 250 and 314, or at positions 314 and 428, or at positions 250, 314, and 428, with substitution at positions 250 and 428 being a specific combination. For position 250, the substituting amino acid residue may be any amino acid residue other than threonine, including, but not limited to, alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, leucine, methionine, asparagine, proline, glutamine, arginine, serine, valine, tryptophan, or tyrosine. For position 314, the substituting amino acid residue may be any amino acid residue other than leucine, including, but not limited to, alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, methionine, asparagine, proline, glutamine, arginine, serine, threonine, valine, tryptophan, or tyrosine. For position 428, the substituting amino acid residues may be any amino acid residue other than methionine, including, but not limited to, alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, leucine, asparagine, proline, glutamine, arginine, serine, threonine, valine, tryptophan, or tyrosine. An exemplary substitution known to modify Fc effector function is the Fc substitution M428L, which can occur in combination with the Fc substitution T250Q. Additional specific combinations of suitable amino acid substitutions are identified in Table 1 of U.S. Pat. No. 7,217,797. Such mutations increase binding to FcRn, which protects the bispecific binding protein from degradation and increases its half-life.

    [0084] Polypeptide linkers 22a and 22b linking the CH3 domains 20a and 20b with their respective variable chains 24a and 24b may be selected to fuse the constant region to scFv.sup.Y, and can be the same or different, but in most embodiments are the same. The linker linking the CH3 domain in the Fc region with a variable region comprising a single chain variable fragment may be selected to increase expression, solubility, stability (for example, as measured by lower fragmentation levels, lower fragmentation rate, lower aggregation levels, lower rate of aggregation, higher melting temperature, and/or longer plasma half-life), and/or titer of a bispecific binding protein of the disclosure. Linkers linking an Fc region to other functional portions of a polypeptide are disclosed, for example, in US Patent Appl. No. 2014/0044711. Illustrative linkers are known in the art, for example, in Shan, J. et al. Journal of Immunology 1999; 162:6589-6595.

    [0085] In some embodiments, a bispecific binding protein of the disclosure comprises a linker linking the Fc region with a variable region, the linker having a sequence corresponding to a sequence selected from one of the sequences in the table below:

    TABLE-US-00004 Sequence (N.fwdarw.C) Identifier VDGASSPVNVSSPSVQDI SEQ ID NO: 251 VDGASSPVNVGSPSVQDI SEQ ID NO: 253 GASSPVNVSSPSV SEQ ID NO: 254 GGGGSGGGNGTGSGGGGS SEQ ID NO: 255 LSAGGHGGLDNDTSAFHL SEQ ID NO: 256 SDKTHTSPPSPAPESSGG SEQ ID NO: 257 VTTTDFQIQTEMAATMET SEQ ID NO: 258 DFLPTTAQPTKKSTLKKR SEQ ID NO: 259 TESRSPPAENEVSTPMQA SEQ ID NO: 260 GGGGSGGGNGSGSGGGGS SEQ ID NO: 261 GGGGSGGGSGGGSGGGGS SEQ ID NO: 262

    [0086] In some embodiments, a bispecific binding protein comprises two polypeptides of formula (I):


    X-H-Fc-L-scFv.sup.Y  (I),

    wherein [0087] X is scFv.sup.X or a Fab region, wherein X specifically binds a first antigen and scFv.sup.Y specifically binds a second antigen, [0088] H is a hinge region, [0089] Fc comprises CH2 and CH3 regions of an immunoglobulin, [0090] scFv.sup.X and scFv.sup.Y are each independently a single chain variable fragment, and [0091] L is a polypeptide linker.
    In some embodiments, one of the two antigens is an immunomodulatory protein and the other is a tumor antigen. In some embodiments, when X is a Fab region, then the first antigen is a tumor antigen, and the second antigen is an immunomodulatory protein. In other embodiments, when X is a Fab region, then the first antigen is an immunomodulatory protein, and the second antigen is a tumor antigen. In some embodiments, L has an amino acid sequence of any one of SEQ ID NOS:251 and 253-262.

    [0092] In some embodiments, X is scFv.sup.X. In other embodiments, X is a Fab region.

    [0093] In some embodiments, scFv.sup.X has the structure of formula (V) or (VI):


    V.sub.H.sup.X-L.sup.X-V.sub.L.sup.X-  (V),


    V.sub.L.sup.X-L.sup.X-V.sub.H.sup.X-  (VI),

    wherein V.sub.H.sup.X is a variable heavy chain, V.sub.L.sup.X is a variable light chain, and L.sup.X is a polypeptide linker. In some embodiments, L.sup.X has an amino acid sequence of any one of SEQ ID NOS: 301-306.

    [0094] In some embodiments, scFv.sup.Y has the structure of formula (VII) or (VIII):


    -V.sub.L.sup.Y-L.sup.Y-V.sub.H.sup.Y  (VII),


    -V.sub.H.sup.Y-L.sup.Y-V.sub.L.sup.Y  (VIII),

    wherein V.sub.H.sup.Y is a variable heavy chain, V.sub.L.sup.Y is a variable light chain, and L.sup.Y is a polypeptide linker. In some embodiments, L.sup.Y has an amino acid sequence of any one of SEQ ID NOS: 301-306.

    [0095] In some embodiments, the bispecific binding protein of formula (I) comprises two polypeptides of formula (II), two polypeptides of formula (III), or two polypeptides of formula (IV) as described below.

    [0096] In an embodiment, provided herein is a polypeptide of formula (II):


    scFv.sup.X-H-Fc-L-scFv.sup.Y  (II),

    [0097] wherein L is a polypeptide linker, [0098] H is a hinge region, [0099] Fc comprises CH2 and CH3 regions of an immunoglobulin, [0100] scFv.sup.X and scFv.sup.Y are each independently a single chain variable fragment, [0101] scFv.sup.X specifically binds a first antigen, [0102] scFv.sup.Y specifically binds a second antigen, and

    [0103] one of the two antigens is an immunomodulatory protein and the other is a tumor antigen.

    In some embodiments, L has an amino acid sequence of any one of SEQ ID NOS:251 and 253-262.

    [0104] In some embodiments, scFv.sup.X has the structure of formula (V) or (VI):


    V.sub.H.sup.X-L.sup.X-V.sub.L.sup.X-  (V),


    V.sub.L.sup.X-L.sup.X-V.sub.H.sup.X-  (VI),

    wherein V.sub.H.sup.X is a variable heavy chain, V.sub.L.sup.X is a variable light chain, and L.sup.X is a polypeptide linker. In some embodiments, L.sup.X has an amino acid sequence of any one of SEQ ID NOS: 301-306.

    [0105] In some embodiments, scFv.sup.Y has the structure of formula (VII) or (VIII):


    -V.sub.L.sup.Y-L.sup.Y-V.sub.H.sup.Y  (VII),


    -V.sub.H.sup.Y-L.sup.Y-V.sub.L.sup.Y  (VIII),

    wherein V.sub.H.sup.Y is a variable heavy chain, V.sub.L.sup.Y is a variable light chain, and L.sup.Y is a polypeptide linker. In some embodiments, L.sup.Y has an amino acid sequence of any one of SEQ ID NOS: 301-306.

    [0106] In another aspect, provided is a polypeptide of formula (III):


    Fab-H-Fc-L-scFv.sup.Y  (III),

    wherein

    [0107] L is a polypeptide linker,

    [0108] H is a hinge region,

    [0109] Fc comprises CH2 and CH3 regions of an immunoglobulin,

    [0110] Fab is a fragment antigen-binding region,

    [0111] scFv.sup.Y is a single chain variable fragment,

    [0112] Fab specifically binds a first antigen, and

    [0113] scFv.sup.Y specifically binds a second antigen.

    [0114] In some embodiments, the first antigen is a tumor antigen and the second antigen is an immunomodulatory protein. In some embodiments, the first antigen is an immunomodulatory protein and the second antigen is a tumor antigen. In some embodiments, L has an amino acid sequence of any one of SEQ ID NOS:251 and 253-262.

    [0115] In some embodiments, scFv.sup.Y has the structure of formula (VII) or (VIII):


    -V.sub.L.sup.Y-L.sup.Y-V.sub.H.sup.Y  (VII),


    -V.sub.H.sup.Y-L.sup.Y-V.sub.L.sup.Y  (VIII),

    wherein V.sub.H.sup.Y is a variable heavy chain, V.sub.L.sup.Y is a variable light chain, and L.sup.Y is a polypeptide linker. In some embodiments, L.sup.Y has an amino acid sequence of any one of SEQ ID NOS: 301-306.

    [0116] In another aspect is provided a polypeptide of formula (IV):


    V.sub.H-CH1-H-Fc-L-scFv.sup.Y  (IV),

    wherein [0117] L is a polypeptide linker, [0118] V.sub.H-CH1, when combined with a peptide comprising V.sub.L-CL, specifically binds a first antigen, [0119] CH1 is a CH1 constant domain, [0120] CL is a light chain constant domain, [0121] V.sub.H is a variable heavy chain, [0122] V.sub.L is a variable light chain, [0123] H is a hinge region, [0124] Fc comprises CH2 and CH3 regions of an immunoglobulin, [0125] scFv.sup.Y is a single chain variable fragment, and [0126] scFv.sup.Y specifically binds a second antigen.

    [0127] In some embodiments, the first antigen is a tumor antigen and the second antigen is an immunomodulatory protein. In some embodiments, the first antigen is an immunomodulatory protein and the second antigen is a tumor antigen. In some embodiments, L has an amino acid sequence of any one of SEQ ID NOS:251 and 253-262.

    [0128] In some embodiments, scFv.sup.Y has the structure of formula (VII) or (VIII):


    -V.sub.L.sup.Y-L.sup.Y-V.sub.H.sup.Y  (VII),


    -V.sub.H.sup.Y-L.sup.Y-V.sub.L.sup.Y  (VIII),

    wherein V.sub.H.sup.Y is a variable heavy chain, V.sub.L.sup.Y is a variable light chain, and L.sup.Y is a polypeptide linker. In some embodiments, L.sup.Y has an amino acid sequence of any one of SEQ ID NOS: 301-306.

    [0129] The bispecific binding proteins of the disclosure can comprise fragments or portions of monoclonal antibodies, genetically engineered, and/or otherwise modified in nature, including but not limited to, chimeric antibodies, humanized antibodies, human antibodies, etc. In various embodiments, the binding proteins comprise all or a portion of a constant region of an immunoglobulin. In some embodiments, the constant region is an isotype selected from: IgA (e.g., IgA.sub.1 or IgA.sub.2), IgD, IgE, IgG (e.g., IgG.sub.1, IgG.sub.2, IgG.sub.3 or IgG.sub.4), and IgM. In some embodiments, a bispecific binding protein comprises one or more constant regions from one or more isotypes. In an illustrative example, a bispecific binding protein can comprise a hinge and a CH2 region from IgG.sub.1, and a CH3 region from IgG.sub.4. In specific embodiments, the bispecific binding proteins of the disclosure comprise an IgG.sub.1, IgG.sub.2, or IgG.sub.4 constant region.

    [0130] The bispecific binding proteins of the disclosure may be derivatized. Derivatized binding proteins are typically modified by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to, specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-natural amino acids. See, e.g., Wolfson, 2006, Chem. Biol. 13(10):1011-2.

    [0131] A bispecific binding protein of the disclosure may have one or more amino acids inserted into one or more of its CDR regions, for example as described in Jung & Plückthun, 1997, Protein Engineering 10:9, 959-966; Yazaki et al., 2004, Protein Eng. Des Sel. 17(5):481-9; and U.S. Pat. App. No. 2007/0280931.

    [0132] In some embodiments, the bispecific binding protein comprises an amino acid sequence shown in FIGS. 8A-8H. In some embodiments, the bispecific binding protein comprises an amino acid sequence of any one of SEQ ID NOS: 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 419, 420, and 421. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 401. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 402. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 403. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 404. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 405. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 406. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 407. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 408. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 409. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 410. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 411. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 412. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 419. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 420. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 421.

    [0133] In some embodiments, the bispecific binding protein comprises an amino acid sequence shown in FIGS. 8I-8M. In some embodiments, the bispecific binding protein comprises an amino acid sequence of any one of SEQ ID NOS: 431-440. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 431. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 432. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 433. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 434. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 435. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 436. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 437. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 438. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 439. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 440.

    [0134] In some embodiments, the bispecific binding protein comprises an amino acid sequence shown in FIGS. 10B-10D. In some embodiments, the bispecific binding protein comprises an amino acid sequence of any one of SEQ ID NOS: 413-418. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 413. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 414. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 415. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 416. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 417. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 418.

    [0135] In some embodiments, the bispecific binding protein comprises an amino acid sequence shown in FIGS. 10H-10I. In some embodiments, the bispecific binding protein comprises an amino acid sequence of any one of SEQ ID NOS: 441-444. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 441. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 442. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 443. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 444.

    [0136] In some embodiments, the bispecific binding protein comprises an amino acid sequence shown in FIG. 10L. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 445. In some embodiments, the bispecific binding protein comprises an amino acid sequence of SEQ ID NO: 446.

    [0137] When a bispecific binding protein comprises a Fab region and an scFv region, the binding protein comprises two polypeptides, e.g., a polypeptide of formula (III), each comprising two amino acid sequences: a light chain, e.g., a peptide comprising V.sub.L-CL, covalently bound by a disulfide bridge to a heavy chain, e.g., a polypeptide of formula (IV). In some embodiments, the light chain comprises a kappa light constant region. In other embodiments, the light chain comprises a lambda light constant region. In certain embodiments, the light chain comprises an amino acid sequence of SEQ ID NO: 371 or 372. In some embodiments, the heavy chain sequence comprises an amino acid sequence of any one of SEQ ID NOS: 351-370.

    [0138] In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:371 and a heavy chain according to SEQ ID NO:351. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:371 and a heavy chain according to SEQ ID NO:352. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:371 and a heavy chain according to SEQ ID NO:353. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:371 and a heavy chain according to SEQ ID NO:354. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:371 and a heavy chain according to SEQ ID NO:355. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:371 and a heavy chain according to SEQ ID NO:356. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:371 and a heavy chain according to SEQ ID NO:357. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:371 and a heavy chain according to SEQ ID NO:358. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:371 and a heavy chain according to SEQ ID NO:359. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:371 and a heavy chain according to SEQ ID NO:360.

    [0139] In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:372 and a heavy chain according to SEQ ID NO:361. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:372 and a heavy chain according to SEQ ID NO:362. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:372 and a heavy chain according to SEQ ID NO:363. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:372 and a heavy chain according to SEQ ID NO:364. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:372 and a heavy chain according to SEQ ID NO:365. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:372 and a heavy chain according to SEQ ID NO:366. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:372 and a heavy chain according to SEQ ID NO:367. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:372 and a heavy chain according to SEQ ID NO:368. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:372 and a heavy chain according to SEQ ID NO:369. In some embodiments, the bispecific binding protein comprises a light chain according to SEQ ID NO:372 and a heavy chain according to SEQ ID NO:370.

    [0140] The bispecific binding proteins can bind to two different antigens. In some embodiments, the presence of both antigens are required to effect the desired biological response, e.g., modulation (e.g., an increase or a decrease) of a biochemical signal. In such embodiments, the biological response is effected in a selected biological environment, e.g., a tumor microenvironment, when both antigens are present. In some embodiments, the modulation of a biochemical signal provides a selective biological effect, e.g., activation of the immune system selectively in the tumor microenvironment. In some embodiments, the modulation of a biochemical signal provides a greater avoidance of systemic toxicity.

    [0141] The bispecific binding proteins described herein generally bind specifically to human antigens. Cross reactive binding to antigens from other species, for example, from mouse or monkey, e.g., cynomolgus monkey, may offer advantages, such as the ability to test in animal models for biological activity. Such animal model testing may be used to screen bispecific binding proteins to select for properties, e.g., favorable pharmacokinetics, relative to biological activity. In some embodiments, the bispecific binding protein binds to a cynomolgus antigen. In some embodiments, the bispecific binding protein binds to a mouse antigen.

    [0142] In some embodiments, the bispecific binding protein competes for binding in in vitro assays with a reference antibody. The reference antibody can bind a first antigen or a second antigen. In some embodiments, the reference antibody is any one of the antibodies described herein. In some embodiments, the reference antibody is a humanized or human version of an antibody described herein.

    [0143] Assays for competition include, but are not limited to, a radioactive material labeled immunoassay (RIA), an enzyme-linked immunosorbent assay (ELISA), a sandwich ELISA, fluorescence activated cell sorting (FACS) assays, and surface plasmon resonance assays.

    [0144] In conducting an antibody competition assay between a reference antibody and a test binding protein (irrespective of species or isotype), one may first label the reference with a detectable label, such as a fluorophore, biotin or an enzymatic (or even radioactive) label to enable subsequent identification. In this case, cells expressing an antigen of interest (i.e., a first antigen or a second antigen) are incubated with unlabeled test binding protein, labeled reference antibody is added, and the intensity of the bound label is measured. If the test binding protein competes with the labeled reference antibody by binding to an overlapping epitope, the intensity will be decreased relative to a control reaction carried out without the test binding protein.

    [0145] In a specific embodiment of this assay, the concentration of labeled reference antibody that yields 80% of maximal binding (“conc.sub.80%”) under the assay conditions (e.g., a specified density of cells) is first determined, and a competition assay carried out with 10× conc.sub.80% of unlabeled test binding protein and conc.sub.80% of labeled reference antibody.

    [0146] Binding inhibition in a competition assay described herein can be expressed as an inhibition constant, or K.sub.i, which is calculated according to the following formula:


    K.sub.i=IC.sub.50/(1+[reference Ab concentration]/K.sub.d),

    [0147] where IC.sub.50 is the concentration of test binding protein that yields a 50% reduction in binding of the reference antibody and K.sub.d is the dissociation constant of the reference antibody, a measure of its affinity for the antigen of interest. Antibodies that compete with binding proteins disclosed herein can have a K.sub.i from 10 pM to 1000 nM under assay conditions described herein.

    [0148] In various embodiments, a test binding protein is considered to compete with a reference antibody if it decreases binding of the reference antibody by at least about 20% or more, for example, by at least about 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or even more, or by a percentage ranging between any of the foregoing values, at a reference antibody concentration that is 80% of maximal binding under the specific assay conditions used, and a test binding protein concentration that is 10-fold higher than the reference antibody concentration.

    [0149] A specific assay and assay conditions useful for assessing whether a test binding protein competes for binding an antigen of interest with a reference antibody as described herein is provided in Example 3. Antibody competition can be determined in an analogous manner to the method described for determining 4-1BB ligand competition in Section 8.3.3.3.

    [0150] As discussed above, a bispecific binding protein of the disclosure can bind to two different antigens, and activate one conditionally in the presence of the other. In one embodiment, the bispecific binding protein binds to an immunomodulatory protein, for example, to activate an immune receptor, and a tumor antigen. In one particular embodiment, the bispecific binding protein agonizes CD40 when bound to the tumor antigen mesothelin, and exhibits reduced CD40 agonizing activity in the absence of mesothelin. In another particular embodiment, the bispecific binding protein agonizes 4-1BB when bound to the tumor antigen mesothelin, and exhibits reduced 4-1BB agonizing activity in the absence of mesothelin. In another particular embodiment, the bispecific binding protein agonizes 4-1BB when bound to the tumor antigen B7-H4, and exhibits reduced 4-1BB agonizing activity in the absence of B7-H4. In such cases, the bispecific binding protein provides for target-specific conditional activation of the immune response in a tumor microenvironment. For example, the bispecific proteins described herein can be used to initiate target-specific conditional activation of an immunological response against tumor cells to treat subjects diagnosed with solid tumors.

    [0151] Assays to determine conditional activation are known in the art. In an illustrative example with a bispecific protein that binds to an immunomodulatory protein and a tumor antigen, conditional activation may be determined by comparing immunomodulatory protein activity with and without the tumor antigen. In such cases, conditional activation is determined, for example, by an increase in activation in the presence of the tumor antigen compared with its absence. In some embodiments, the immunomodulatory protein activity is at least about 5-fold, such as 6, 7, 8, 9, 10, 12, 15, 18, 20, 25, 30, 40, 50, 70, 80, 100, 200, 400, 500, 700, 800, or 1000-fold or greater increase in activity in the presence of tumor antigen compared with its absence. In some embodiments, the immunomodulatory protein activity is less than about 10000-fold, such as 5000, 2000, 1000, 800, 600, 500, 300, 200 or 100-fold or lower increase in activity in the presence of tumor antigen compared with its absence. In certain embodiments, the assay is an assay described in Section 8.1.2. In other embodiments, the assay is an assay described in Section 8.3.3.

    [0152] 7.3.2. Immunomodulatory Binding Proteins

    [0153] In some embodiments, the bispecific binding protein of the disclosure, e.g., a bispecific binding protein of formula (I), selectively binds to an immunomodulatory protein selected from a tumor necrosis factor receptor (TNFR) and a CD28 family protein. TNFR superfamily proteins include, but are not limited to, CD27 (S152, Tp55, TNFR superfamily member 7), CD30, CD40 (p50, Bp50), CD95, HVEM (CD270, TNFSF14, TR2, ATAR), 4-1BB (CD137, ILA, TNFR superfamily member 9), TRAILR1 (CD120a, DR4, Apo2, CD261, TNFR superfamily member 10a), TRAILR2 (DR5, KILLER, TRICK2A, TRICKB, CD262, TNFR superfamily member 10b), TNFR2 (CD120b), and TACI (CD267). The CD28 receptor family members include, but are not limited to, CD28, ICOS, PD-1, and CTLA-4. In one particular embodiment, the immunomodulatory protein is CD40. In another specific embodiment, the immunomodulatory protein is 4-1BB.

    [0154] In an illustrative embodiment, when the immunomodulatory protein is CD40 and X is scFv.sup.X, the bispecific binding protein of formula (I) comprises scFv.sup.X binding CD40 and scFv.sup.Y binding a tumor antigen. In certain embodiments, when the immunomodulatory protein is CD40 and X is scFv.sup.X, the bispecific binding protein of formula (I) comprises scFv.sup.X binding a tumor antigen and scFv.sup.Y binding CD40. In certain embodiments, when the immunomodulatory protein is 4-1BB and X is scFv.sup.X, the bispecific binding protein of formula (I) comprises scFv.sup.X binding 4-1BB and scFv.sup.Y binding a tumor antigen. In certain embodiments, when the immunomodulatory protein is 4-1BB and X is scFv.sup.X, the bispecific binding protein of formula (I) comprises scFv.sup.X binding a tumor antigen and scFv.sup.Y binding 4-1BB. In certain embodiments, when the immunomodulatory protein is CD40 and X is Fab, the bispecific binding protein of formula (I) comprises Fab binding a tumor antigen and scFv.sup.Y binding CD40.

    [0155] In an illustrative embodiment, when the immunomodulatory protein is CD40, the polypeptide of formula (II) comprises scFv.sup.X binding CD40 and scFv.sup.Y binding a tumor antigen. In certain embodiments, when the immunomodulatory protein is CD40, the polypeptide of formula (II) comprises scFv.sup.X binding a tumor antigen and scFv.sup.Y binding CD40. In certain embodiments, when the immunomodulatory protein is 4-1BB, the polypeptide of formula (II) comprises scFv.sup.X binding 4-1BB and scFv.sup.Y binding a tumor antigen. In certain embodiments, when the immunomodulatory protein is 4-1BB, the polypeptide of formula (II) comprises scFv.sup.X binding a tumor antigen and scFv.sup.Y binding 4-1BB.

    [0156] In an illustrative embodiment, when the immunomodulatory protein is CD40, the polypeptide of formula (III) comprises Fab binding a tumor antigen and scFv.sup.Y binding CD40. In certain embodiments, when the immunomodulatory protein is 4-1BB, the polypeptide of formula (III) comprises Fab binding a tumor antigen and scFv.sup.Y binding 4-1BB. In certain embodiments, when the immunomodulatory protein is 4-1BB, the polypeptide of formula (III) comprises Fab binding 4-1BB and scFv.sup.Y binding a tumor antigen.

    [0157] In an illustrative embodiment, when the immunomodulatory protein is CD40, the polypeptide of formula (IV) comprises V.sub.H-CH1, when combined with a peptide comprising V.sub.L-CL, binding a tumor antigen, and scFv.sup.Y binding CD40. In certain embodiments, when the immunomodulatory protein is 4-1BB, the polypeptide of formula (IV) comprises V.sub.H-CH1, when combined with a peptide comprising V.sub.L-CL, binding a tumor antigen, and scFv.sup.Y binding 4-1BB. In certain embodiments, when the immunomodulatory protein is 4-1BB, the polypeptide of formula (IV) comprises V.sub.H-CH1, when combined with a peptide comprising V.sub.L-CL, binding 4-1BB, and scFv.sup.Y binding a tumor antigen.

    [0158] For some uses, it is desirable to have bispecific binding proteins with affinity to an immunomodulatory protein. For certain uses, such as therapeutic uses, an affinity, e.g., K.sub.D, of at least about 3000 nM is desirable. For applications in which specific affinities are desired, bispecific binding proteins specifically bind an immunomodulatory protein with an affinity of at least about 3000 nM, or even higher, for example, at least about 2000 nM, 1000 nM, 900 nM, 800 nM, 700 nM, 600 nM, 500 nM, 400 nM, 300 nM, 250 nM, 200 nM, 150 nM, 100 nM, 90 nM, 80 nM, 70 nM, 60 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 15 nM, 10 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM or greater. In some embodiments, the K.sub.D to an immunomodulatory protein is in a range bounded by any two of the foregoing values, e.g., from about 1 to about 5000 nM, such as 10 to 3000, 50 to 3000, 100 to 2000, 1 to 1000, 20 to 2000, 30 to 3000, or about 100 to 3000 nM.

    [0159] In some embodiments, the bispecific binding proteins compete for binding human CD40 (SEQ ID NO:271) on cells expressing CD40 in in vitro assays with a reference antibody. The reference antibody may be any of the anti-CD40 antibodies described herein or known in the art. In some embodiments, the reference antibody is an antibody provided in TABLE 1-4. In specific embodiments, the reference antibody is selected from antibody AD163.9.3 (“muAb1”); antibody AD166.4.4 (“muAb2”); antibody AD175.14.11 (“muAb3”); antibody AD163.10.7 (“muAb4”); antibody AD165.1.2 (“muAb5”); antibody AD163.162.1 (“muAb6”); antibody AD163.27.12 (“muAb7”); antibody AD163.7.2 (“muAb8”); antibody AD164.14.6 (“muAb9”); and antibody AD164.76.2 (“muAb10”). In some embodiments, the reference antibody is a humanized version of an antibody provided in TABLE 1-4. In some embodiments, the reference antibody is a humanized version of muAb1, muAb1, muAb2, muAb3, muAb4, muAb5, muAb6, muAb7, muAb8, muAb9, or muAb10. In a specific embodiment, the reference antibody is huAb9-5 having a heavy chain according to SEQ ID NO:310 or 311, and a light chain according to SEQ ID NO:320. In another specific embodiment, the reference antibody is huAb9-5 V273E having a heavy chain according to SEQ ID NO:312 or 313, and a light chain according to SEQ ID NO:320. In another specific embodiment, the reference antibody is huAb9-5 V273Y having a heavy chain according to SEQ ID NO:314 or 315, and a light chain according to SEQ ID NO:320. In another specific embodiment, the reference antibody is huAb9 A2I having a heavy chain according to SEQ ID NO:312 or 313, and a light chain according to SEQ ID NO:321. In another specific embodiment, the reference antibody is huAb9 A2V having a heavy chain according to SEQ ID NO:312 or 313, and a light chain according to SEQ ID NO:322.

    [0160] In some embodiments, a bispecific binding protein of the disclosure comprises an immunomodulatory protein binding region comprising a V.sub.H sequence selected from the following sequences (CDR sequences in bold):

    TABLE-US-00005 V.sub.H Sequence (N.fwdarw.C) Identifier muAb1 V.sub.H QVQLQQPGAELVKPGASVKMSCKASGYTFTSYWITWVKQRPG (SEQ ID NO: 1) QGLEWIGEINPGSGSTNYNEKFKSKATLTVDTSSSTAYMQLSSL TSEDSAVYYCARNRGTGDYWGQGTTLTVSS muAb2 V.sub.H QVQLQQSGAELMKPGASAKLSCKATGYTFTGYWIQWVKQRPG (SEQ ID NO: 2) HGLEWIGEILPGGDHTKYNEKFRGKATFTSDTSSNTVYMQLSS LTTEDSAIYYCARVGGDYWGQGTTLTVSS muAb3 V.sub.H EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGK (SEQ ID NO: 3) SLEWIGDINPNNGGTSYNQKFKGKATLTVDKSSSTAYMELRSLT SEDSAVYYCARRGGLGRGTYALDYWGQGTSVTVSS muAb4 V.sub.H LVQPGGSLSLSCAASGFTFSDYYMSWVRQPPGKALEWLGFIRN (SEQ ID NO: 4) KANGYTTEFSASVKGRFTISRDNSQSILYLQMNALRAEDSATYY CARYGGLRQGWYFDVWGTGTTVTVSS muAb5 V.sub.H DVQLQESGPGLVEPSQSLFLTCSVTGYSITTNYNWNWIRQFPGN (SEQ ID NO: 5) KLEWMGYIRHDGTNNYNPSLKNRISIIRDTPKNQFFIKLNSVTTE DTAIYFCTRLDYWGQGTSVTVSS muAb6 V.sub.H QVQLQQPGAELVRPGSSVKLSCKASGYTFTSYWMHWVKQRPIQ (SEQ ID NO: 6) GLEWIGNIDPSNGETHYNQKFKDKATLTVDKSSSTAYMQLSSLT SEDSAVYYCARERIYYSGSTYDGYFDVWGTGTTVTVSS muAb8 V.sub.H QVQLQQSGPELVKSGASVKISCKASGYTFTDYYINWVKQRPGQ (SEQ ID NO: 7) GLEWIGWIFPGSGSVYCNEQFKGQATLTVDRSSSTAYMLLSSLT SEDSAVYFCASSLGKFAYWGQGTLVTVSA muAb9 V.sub.H DVQLQESGPGLVKPSQSLSLTCSVTGYSITSNYYWNWIRQFPGN (SEQ ID NO: 8) KLEWMGYIRYDGSNNYNPSLKNRISITRDTSKNQFFLKLNSVTT EDTATYYCARLDYWGQGTTLTVSS muAb10 V.sub.H DVQLQESGPGLVKPSQSLSLTCSVTGYSITSNYYWNWIRQFPGN (SEQ ID NO: 9) KLEWMGYIRYDGSNNYNPSLKNRISITRDTSKNQFFLRLNSVTTE DTATYYCTRLDYWGQGTTLTVSS huAb6-1 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAPG (SEQ ID NO: 10) QGLEWIGNIDPSNGETHYNQKFKDRATLTVDKSTSTAYMELSSL RSEDTAVYYCARERIYYSGSTYDGYFDVWGQGTTVTVSS huAb6-2 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAPG (SEQ ID NO: 11) QGLEWIGNIDPSNGETHYNQKFKDRVTITVDKSTSTAYMELSSL RSEDTAVYYCARERIYYSGSTYDGYFDVWGQGTTVTVSS huAb6-3 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAPG (SEQ ID NO: 12) QGLEWIGNIDPSNGETHYAQKFQGRVTITVDKSTSTAYMELSSL RSEDTAVYYCARERIYYSGSTYDGYFDVWGQGTTVTVSS huAb8-1 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYINWVRQAPGQ (SEQ ID NO: 13) GLEWIGWIFPGSGSVYCNEQFKGRATLTVDRSTSTAYMELSSLR SEDTAVYFCASSLGKFAYWGQGTLVTVSS huAb8-2 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYINWVRQAPGQ (SEQ ID NO: 14) GLEWIGWIFPGSGSVYSNEQFKGRATLTVDRSTSTAYMELSSLR SEDTAVYFCASSLGKFAYWGQGTLVTVSS huAb8-3 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYINWVRQAPGQ (SEQ ID NO: 15) GLEWIGWIFPGSGSVYCNEQFKGRVTITVDKSTSTAYMELSSLR SEDTAVYYCASSLGKFAYWGQGTLVTVSS huAb9-1 V.sub.H EVQLQESGPGLVKPSETLSLTCTVSGYSITSNYYWNWIRQPPGKG (SEQ ID NO: 16) LEWMGYIRYDGSNNYNPSLKNRITISRDTSKNQFSLKLSSVTAA DTAVYYCARLDYWGQGTTVTVSS huAb9-2 V.sub.H EVQLQESGPGLVKPSETLSLTCTVSGYSITSNYYWNWIRQPPGKG (SEQ ID NO: 17) LEWMGYIRYDGSNNYNPSLKNRVTISRDTSKNQFSLKLSSVTAA DTAVYYCARLDYWGQGTTVTVSS huAb9-3 V.sub.H EVQLQESGPGLVKPSETLSLTCTVSGYSISSNYYWNWIRQPPGKG (SEQ ID NO: 18) LEWMGYIRYDGSNNYNPSLKSRVTISRDTSKNQFSLKLSSVTAA DTAVYYCARLDYWGQGTTVTVSS huAb9 EVQLVESGGGLVKPGETLSLTCTVSGYSITSNYYWNWIRQPPGK (SEQ ID NO: 19) Stab1 V.sub.H GLEWMGYIRYDGSNNYNPSLKGRVTISRDTSKNQFYLKLSSVTA ADTAVYYCARLDYWGQGTTVTVSS huAb9 EVQLVESGGGLVQPGGSLRLSCAASGYSITSNYYWNWIRQPPGK (SEQ ID NO: 20) Stab2 V.sub.H GLEWMGYIRYDGSNNYNPSLKGRVTISRDTSKNQLYLKLSSVT AADTAVYYCARLDYWGQGTLVTVSS huAb9 EVQLVESGGGLVKPGETLILTCTVSGYDITSNYYWNWIRQPPGK (SEQ ID NO: 21) Stab3 V.sub.H GLEWMGYIRYDGSNNYNPSLKGRVTISRDTSKNQFYLKLSSVTA ADTAVYYCARLDYWGQGTTVTVSS huAb9 QVQLQESGPGLVKPSETLSLTCTVSGYSITSNYYWNWIRQPPGK (SEQ ID NO: 22) rehuVH4 GLEWMGYIRYDGSNNYNPSLKNRITISRDTSKNQFSLKLSSVTA V.sub.H ADTAVYYCARLDYWGQGTLVTVSS huAb9 EVQLVESGGGLVQPGGSLRLSCAASGYSITSNYYWNWVRQAPG (SEQ ID NO: 23) rehuVH3 KGLEWMGYIRYDGSNNYNPSLKNRITISRDTSKNTFYLQMNSLR V.sub.H AEDTAVYYCARLDYWGQGTLVTVSS
    and the amino acid sequence of the corresponding V.sub.L sequence is selected from the following sequences (CDR sequences in bold):

    TABLE-US-00006 V.sub.L Sequence (N.fwdarw.C) Identifier muAb1 V.sub.L DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSYGNTYLHWYLQ (SEQ ID NO: 31) KPGQSPKFLIYKVSNRISGVPDRLSGSGSGTDFTLKISRVEPEDLG VYFCSQSTHVPYTFGGGTKLEIK muAb2 V.sub.L DVVMTQTPLSLPVSLGDQASISCRSSQSLVNSNENTYLHWYLQK (SEQ ID NO: 32) PGQSPKLLIYKVFNRYSGVPDRFSGSGSGTDFTLKISRVEAEDLG VYFCFQSTHVPWTFGGGTKLEIK muAb3 V.sub.L DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTV (SEQ ID NO: 33) KPLIYYTSRLHLGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQ GNTLPLTFGAGTKLELK muAb4 V.sub.L DIQMTQTTSSLSASLGDRVTISCRASQDIRNYLNWYQQKPDGTV (SEQ ID NO: 34) KLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQ GKTLPWTFGGGSKLEMK muAb5 V.sub.L DAVMTQTPLSLPVSLGDQASISCRSSQSLENSYGNTFLNWFLQR (SEQ ID NO: 35) PGQSPQLLIYRVSNRFCGVPDRFSGSGSGTDFTLKISRVEAEDLGI YFCLQVTHVPYTFGGGTKLEIK muAb6 V.sub.L QIVLTQSPAIMSASPGEKVTMTCSASSSLSYMHWYQQKSGTSPK (SEQ ID NO: 36) RWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQ QWSSNPWTFGGGTKLEIK muAb7 V.sub.L QIVLTQSPAIMSASPGEKVTMTCSASSSLSYMHWYQQKSGTSPK (SEQ ID NO: 37) RWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEGEDGATYYCQ QWSSNPWTFGGGTKLEIK muAb8 V.sub.L DIVMTQSQKFMSTTVGDRVSITCKASQSVVTAVAWYQQKPGQS (SEQ ID NO: 38) PKLLIYSASNRYTGVPDRFTGSGSGTDFALTIRTMQSEDLADYFC QQYSSYPYTFGGGTKLEIK muAb9 V.sub.L DAVMTQTPLSLPVSLGDQASISCRSSQSLENTNGNTFLNWFLQK (SEQ ID NO: 39) PGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGV YFCLQVTHVPFTFGSGTKLEIK muAb10 V.sub.L DAVMTQTPLSLPVSLGDQASISCRSSQSLENSNGNTFLNWFLQK (SEQ ID NO: 40) PGQSPQLLIYRISNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGV YFCLQVTHVPFTFGSGTKLEIK huAb6-1 V.sub.L DIQLTQSPSFLSASVGDRVTITCSASSSLSYMHWYQQKPGKSPKR (SEQ ID NO: 41) WIYDTSKLASGVPSRFSGSGSGTEYTLTISSLQPEDFATYYCQQW SSNPWTFGGGTKVEIK huAb8-1 V.sub.L DIQMTQSPSSLSASVGDRVTITCKASQSVVTAVAWYQQKPGKSP (SEQ ID NO: 42) KLLIYSASNRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQ YSSYPYTFGGGTKVEIK huAb9-1 V.sub.L DAVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWFLQK (SEQ ID NO: 43) PGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVG VYFCLQVTHVPFTFGQGTKLEIK huAb9-4 V.sub.L DAVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWYLQK (SEQ ID NO: 44) PGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVG VYYCLQVTHVPFTFGQGTKLEIK huAb9 DAVMTQTPLSLSVTEGQPASISCRSSQSLENTNGNTFLNWYLQK (SEQ ID NO: 45) Stab1 V.sub.L PGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVG VYYCLQVTHVPFTFGQGTKLEIK huAb9 DAVMTQTPLSLAVLPGQPASISCRSSQSLENTNGNTFLNWYLQK (SEQ ID NO: 46) Stab3 V.sub.L PGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVG VYYCLQVTHVPFTFGQGTKLEIK huAb9 Stab DIQMTQSPSSLSASVGDRVTITCRSSQSLENTNGNTFLNWVQQK (SEQ ID NO: 47) VK1 V.sub.L PGKAPKLLIYRVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFAT YYCLQVTHVPFTFGQGTKVEIK huAb9 rehu DAVMTQSPLSLPVTLGEPASISCRSSQSLENTNGNTFLNWFQQK (SEQ ID NO: 48) VK2 V.sub.L PGQSPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCLQVTHVPFTFGQGTKLEIK huAb9 rehu DAQMTQSPSSLSASVGDRVTITCRSSQSLENTNGNTFLNWFQQK (SEQ ID NO: 49) VK1 V.sub.L PGKAPKLLIYRVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFAT YYCLQVTHVPFTFGQGTKLEIK huAb9 A2I DIVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWYLQKP (SEQ ID NO: 50) V.sub.L GQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGV YYCLQVTHVPFTFGQGTKLEIK huAb9 A2V DVVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWYLQK (SEQ ID NO: 51) V.sub.L PGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVG VYYCLQVTHVPFTFGQGTKLEIK

    [0161] In some embodiments, a bispecific binding protein of the disclosure, e.g., a protein of formula (I), is suitable for administration to humans. In a specific embodiment, the bispecific binding protein comprises humanized immunomodulatory protein binding domains. In another specific embodiment, the bispecific binding protein comprises an immunomodulatory protein binding region comprising a V.sub.H sequence selected from the following sequences (CDR sequences in bold):

    TABLE-US-00007 V.sub.H Sequence (N.fwdarw.C) Identifier huAb6-1 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAP (SEQ ID NO: 10) GQGLEWIGNIDPSNGETHYNQKFKDRATLTVDKSTSTAYMELS SLRSEDTAVYYCARERIYYSGSTYDGYFDVWGQGTTVTVSS huAb6-2 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAP (SEQ ID NO: 11) GQGLEWIGNIDPSNGETHYNQKFKDRVTITVDKSTSTAYMELS SLRSEDTAVYYCARERIYYSGSTYDGYFDVWGQGTTVTVSS huAb6-3 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAP (SEQ ID NO: 12) GQGLEWIGNIDPSNGETHYAQKFQGRVTITVDKSTSTAYMELS SLRSEDTAVYYCARERIYYSGSTYDGYFDVWGQGTTVTVSS huAb8-1 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYINWVRQAPG (SEQ ID NO: 13) QGLEWIGWIFPGSGSVYCNEQFKGRATLTVDRSTSTAYMELSS LRSEDTAVYFCASSLGKFAYWGQGTLVTVSS huAb8-2 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYINWVRQAPG (SEQ ID NO: 14) QGLEWIGWIFPGSGSVYSNEQFKGRATLTVDRSTSTAYMELSS LRSEDTAVYFCASSLGKFAYWGQGTLVTVSS huAb8-3 V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYINWVRQAPG (SEQ ID NO: 15) QGLEWIGWIFPGSGSVYCNEQFKGRVTITVDKSTSTAYMELSS LRSEDTAVYYCASSLGKFAYWGQGTLVTVSS huAb9-1 V.sub.H EVQLQESGPGLVKPSETLSLTCTVSGYSITSNYYWNWIRQPPGK (SEQ ID NO: 16) GLEWMGYIRYDGSNNYNPSLKNRITISRDTSKNQFSLKLSSVTA ADTAVYYCARLDYWGQGTTVTVSS huAb9-2 V.sub.H EVQLQESGPGLVKPSETLSLTCTVSGYSITSNYYWNWIRQPPGK (SEQ ID NO: 17) GLEWMGYIRYDGSNNYNPSLKNRVTISRDTSKNQFSLKLSSVT AADTAVYYCARLDYWGQGTTVTVSS huAb9-3 V.sub.H EVQLQESGPGLVKPSETLSLTCTVSGYSISSNYYWNWIRQPPGK (SEQ ID NO: 18) GLEWMGYIRYDGSNNYNPSLKSRVTISRDTSKNQFSLKLSSVT AADTAVYYCARLDYWGQGTTVTVSS huAb9 Stab1 EVQLVESGGGLVKPGETLSLTCTVSGYSITSNYYWNWIRQPPG (SEQ ID NO: 19) V.sub.H KGLEWMGYIRYDGSNNYNPSLKGRVTISRDTSKNQFYLKLSSV TAADTAVYYCARLDYWGQGTTVTVSS huAb9 Stab2 EVQLVESGGGLVQPGGSLRLSCAASGYSITSNYYWNWIRQPPG (SEQ ID NO: 20) V.sub.H KGLEWMGYIRYDGSNNYNPSLKGRVTISRDTSKNQLYLKLSSV TAADTAVYYCARLDYWGQGTLVTVSS huAb9 Stab3 EVQLVESGGGLVKPGETLILTCTVSGYDITSNYYWNWIRQPPGK (SEQ ID NO: 21) V.sub.H GLEWMGYIRYDGSNNYNPSLKGRVTISRDTSKNQFYLKLSSVT AADTAVYYCARLDYWGQGTTVTVSS huAb9 QVQLQESGPGLVKPSETLSLTCTVSGYSITSNYYWNWIRQPPGK (SEQ ID NO: 22) rehuVH4 V.sub.H GLEWMGYIRYDGSNNYNPSLKNRITISRDTSKNQFSLKLSSVTA ADTAVYYCARLDYWGQGTLVTVSS huAb9 EVQLVESGGGLVQPGGSLRLSCAASGYSITSNYYWNWVRQAP (SEQ ID NO: 23) rehuVH3 V.sub.H GKGLEWMGYIRYDGSNNYNPSLKNRITISRDTSKNTFYLQMNS LRAEDTAVYYCARLDYWGQGTLVTVSS
    and the amino acid sequence of the corresponding V.sub.L is selected from the following sequences (CDR sequences in bold):

    TABLE-US-00008 V.sub.L Sequence (N.fwdarw.C) Identifier huAb6-1 V.sub.L DIQLTQSPSFLSASVGDRVTITCSASSSLSYMHWYQQKPGKSPK (SEQ ID NO: 41) RWIYDTSKLASGVPSRFSGSGSGTEYTLTISSLQPEDFATYYCQQ WSSNPWTFGGGTKVEIK huAb8-1 V.sub.L DIQMTQSPSSLSASVGDRVTITCKASQSVVTAVAWYQQKPGKS (SEQ ID NO: 42) PKLLIYSASNRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQ QYSSYPYTFGGGTKVEIK huAb9-1 V.sub.L DAVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWFLQK (SEQ ID NO: 43) PGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVG VYFCLQVTHVPFTFGQGTKLEIK huAb9-4 V.sub.L DAVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWYLQ (SEQ ID NO: 44) KPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDV GVYYCLQVTHVPFTFGQGTKLEIK huAb9 Stab1 DAVMTQTPLSLSVTEGQPASISCRSSQSLENTNGNTFLNWYLQ (SEQ ID NO: 45) V.sub.L KPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDV GVYYCLQVTHVPFTFGQGTKLEIK huAb9 Stab3 DAVMTQTPLSLAVLPGQPASISCRSSQSLENTNGNTFLNWYLQ (SEQ ID NO: 46) V.sub.L KPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDV GVYYCLQVTHVPFTFGQGTKLEIK huAb9 Stab DIQMTQSPSSLSASVGDRVTITCRSSQSLENTNGNTFLNWYQQ (SEQ ID NO: 47) VK1 V.sub.L KPGKAPKLLIYRVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFA TYYCLQVTHVPFTFGQGTKVEIK huAb9 rehu DAVMTQSPLSLPVTLGEPASISCRSSQSLENTNGNTFLNWFQQK (SEQ ID NO: 48) VK2 V.sub.L PGQSPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVG VYYCLQVTHVPFTFGQGTKLEIK huAb9 rehu DAQMTQSPSSLSASVGDRVTITCRSSQSLENTNGNTFLNWFQQ (SEQ ID NO: 49) VK1 V.sub.L KPGKAPKLLIYRVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFA TYYCLQVTHVPFTFGQGTKLEIK huAb9 A2I DIVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWYLQK (SEQ ID NO: 50) V.sub.L PGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVG VYYCLQVTHVPFTFGQGTKLEIK huAb9 A2V DVVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWYLQ (SEQ ID NO: 51) V.sub.L KPGQSPQLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDV GVYYCLQVTHVPFTFGQGTKLEIK

    [0162] In some embodiments, the bispecific binding protein has a CD40 binding domain with amino acid sequences of the CDRs of:

    TABLE-US-00009 CDR Sequence (N.fwdarw.C) Identifier V.sub.H CDR#1 GYSITSNYYWN (SEQ ID NO: 25) V.sub.H CDR#2 YIRYDGSNNYNPSLKN (SEQ ID NO: 26) V.sub.H CDR#3 LDY (SEQ ID NO: 27) V.sub.L CDR#1 RSSQSLENTNGNTFLN (SEQ ID NO: 55) V.sub.L CDR#2 RVSNRFS (SEQ ID NO: 56) V.sub.L CDR#3 LQVTHVPFT (SEQ ID NO: 57)

    [0163] In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:10 and a V.sub.L according to SEQ ID NO:41. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:11 and a V.sub.L according to SEQ ID NO:41. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO: 12 and a V.sub.L according to SEQ ID NO:41. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO: 13 and a V.sub.L according to SEQ ID NO:42. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO: 14 and a V.sub.L according to SEQ ID NO:42. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:15 and a V.sub.L according to SEQ ID NO:42. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:16 and a V.sub.L according to SEQ ID NO:43. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:17 and a V.sub.L according to SEQ ID NO:43. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:18 and a V.sub.L according to SEQ ID NO:43. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:16 and a V.sub.L according to SEQ ID NO:44. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:17 and a V.sub.L according to SEQ ID NO:44. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:17 and a V.sub.L according to SEQ ID NO:49. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:17 and a V.sub.L according to SEQ ID NO:50. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:17 and a V.sub.L according to SEQ ID NO:51. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:18 and a V.sub.L according to SEQ ID NO:44. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:22 and a V.sub.L according to SEQ ID NO:48. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:22 and a V.sub.L according to SEQ ID NO:49. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:23 and a V.sub.L according to SEQ ID NO:48. In some embodiments, the bispecific binding protein has a CD40 binding domain comprising a V.sub.H according to SEQ ID NO:23 and a V.sub.L according to SEQ ID NO:49.

    [0164] In some embodiments, the bispecific binding proteins compete for binding human 4-1BB (SEQ ID NO:273) on cells expressing 4-1BB in in vitro assays with a reference antibody. The reference antibody may be any of the anti-4-1BB antibodies described herein or known in the art. In specific embodiments, the reference antibody is selected from antibody TABBY101 (“TABBY101”), antibody TABBY102 (“TABBY102”), antibody TABBY103 (“TABBY103”), antibody TABBY104 (“TABBY104”), antibody TABBY105 (“TABBY105”), antibody TABBY106 (“TABBY106”), antibody TABBY107 (“TABBY107”), antibody TABBY108 (“TABBY108”), antibody TABBY1.1 (“TABBY1.1”), antibody TABBY3 (“TABBY3”), antibody TABBY5 (“TABBY5”), antibody TABBY6 (“TABBY6”), antibody TABBY9 (“TABBY9”), and antibody TABBY10 (“TABBY10”). In one embodiment, the reference antibody is TABBY106. In another embodiment, the reference antibody is TABBY107. In some embodiments, the reference antibody is a humanized version of TABBY106, TABBY107, or TABBY108. In a specific embodiment, the reference antibody is hu106-1-hIgG.sub.1 having a heavy chain according to SEQ ID NO:330 or 331, and a light chain according to SEQ ID NO:334. In another specific embodiment, the reference antibody is hu107-1-hIgG.sub.1 having a heavy chain according to SEQ ID NO:332 or 333, and a light chain according to SEQ ID NO:335.

    [0165] In some embodiments, a bispecific binding protein of the disclosure comprises an immunomodulatory binding region comprising a V.sub.H sequence selected from the following sequences (CDR sequences in bold):

    TABLE-US-00010 V.sub.H Sequence (N.fwdarw.C) Identifier TABBY101 QIQLVQSGPELKKPGESVKISCKASGYTFTDFAIHWVKQAPGKG (SEQ ID NO: 61) V.sub.H LKWMGWINTYTGKPTYADDFKGRFVFSLEASASTANLQISNLK NEDTATYFCSRGAPRPTNWGQGTLVTVSS TABBY102 QVQLQQSGAELAKPGSSVKISCKASGYTLTSYYLNWIKQTTGQG (SEQ ID NO: 62) V.sub.H LEYIGYIDTGSGGSHYNEKFKGKATLTVDKSSSTAFMQLSSLTP VDSAVYYCARGGYYDGFFDYWGQGVMVTVSS TABBY103 QVQLQQSGAELVKPGSSVKISCKASDYTFTSNFLHWIKQQPGNG (SEQ ID NO: 63) V.sub.H LEWIGWINPGDGDTYYNQKFNGKATLTADKSSTTAYMQLSSLT SEDSAVYFCAGGNYYAAHYPPGPWYFDFWGPGTMVTVSS TABBY104 QVTLKESGPGILQPSQTLSLTCTFSGFSLSTDGLGVTWIRQPSGK (SEQ ID NO: 64) V.sub.H GLEWLANIWWDDDKDYNPSLKNRLTISKDTSNPQAFLKITNVD TADTATYYCARIVPNSGHEDYWGQGVMVIVSS TABBY105 EVQLVESGGGLVQPGRSMKLSCAASGFTFNNYDMAWVCQAPK (SEQ ID NO: 65) V.sub.H RGLEWVATISYDGSTTYYRDSVKGRFTFSRDNAKSTLYLQMDS LRSEDTATYYCARVGAGDFDYWGQGVMVTVSS TABBY106 QVQLQQSGAELAKPGTSVKLSCKASGYTFTSYYIYWVKQRPGQ (SEQ ID NO: 66) V.sub.H GLEWIGNIWPGNGGTFYGEKFMGKATFTADTSSSTAYMLLGSL TPEDSAYYFCARRPDYSGDDYFDYWGQGVLVTVSS TABBY107 QVKLVQSGAALVKPGASVKMSCKASDYTFNDYWVSWVKQRH (SEQ ID NO: 67) V.sub.H GESLEWIGEIYPNSGATNFNGKFRGKATLTVDNPTSTAYMELSR LTSEDSAIYYCTREYTRDWFAYWGQGTLVTVSS TABBY108 EIQLQESGPGLVRPSQSLSLACSVTGYTITSAYDWSWIRKFPGNK (SEQ ID NO: 68) V.sub.H MEWMGYIAYIGFTNSNPSLKSRISITRDTSKNQFFLQLKSVTTED TATYYCARWSSYIPRYFDFWGPGTMVTVSS
    and the amino acid sequence of the corresponding V.sub.L sequence is selected from the following sequences (CDR sequences in bold):

    TABLE-US-00011 V.sub.L Sequence (N.fwdarw.C) Identifier TABBY101 DIQMTQSPASLSASLGETVSIECLASEDIYNNLAWYQQKPGKSPQ (SEQ ID NO: 81) V.sub.L LLIYYESRLQDGVPTRFSGSGSGTQYSLKINSLESEDAATYFCLQ DSEYPYTFGAGTKLELK TABBY102 DIQMTQSPASLSASLGETVSIECLASEGISNDLAWYQQKSGKSPQ (SEQ ID NO: 82) V.sub.L FLIYAASRLQDGVPSRFSGSGSGTRYSLKISGMQPEDEADYFCQQ SYKYPPTFGSGTKLEIK TABBY103 DTVLTQSPALAVSLGQRVTISCRASKSVSIYMHWYQQKSGQQPK (SEQ ID NO: 83) V.sub.L FLIYTASNLESGVPSRFSGSGSGTDFTLTIDPVEADDIANYYCQQS NELPFTFGSGTKLEIK TABBY104 DIQMTQSPSFLSASVGDRVTINCKASQNINRYLNWYQQKLGEAP (SEQ ID NO: 84) V.sub.L KLLMYNTNSMQTGIPSRFSGSGSGTDFTLTISSLQPEDVATYFCL QHNSWPRTFGGGTKLELK TABBY105 DIRMTQSPVSLSTSLGETVNIECLASEDIYSDLAWYQQKPGKSPQ (SEQ ID NO: 85) V.sub.L LLIYSTNTLQNGVPSRFSGSGSGTQYSLKINSLQSEDVATYFCQQ NNNYPYTFGAGTKLELK TABBY106 QVVLTQPKSVSTSLKSTVKLSCKLNSGNIGSYYVHWYQQHAGR (SEQ ID NO: 86) V.sub.L SPTTMIYRDDKRPDGVPDRFSGSIDSSSNSAFLTINNVQTEDDAIY FCHSYDSTITPVFGGGTKLTVL TABBY107 DVVLTQTPSILSATIGQSVSISCRSSQSLLDSDGNTYLYWFLQRPG (SEQ ID NO: 87) V.sub.L QSPQRLIYLVSNLGSGVPNRFSGSGSGTDFTLKISGVEAEDLGIYY CMQPTHAPYTFGAGTKLELK TABBY108 QAVLTQPNSVSTSLGSTVKLSCTITSGNIEDNFVHWYQHYEGRS (SEQ ID NO: 88) V.sub.L PTTMIHNDDKRPDGVPDRFSGSIDSSSNSAFLTINNVEIEDEAIYFC HSYVSSINIFGGGTKLTVL

    [0166] In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:61 and a V.sub.L according to SEQ ID NO:81. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:62 and a V.sub.L according to SEQ ID NO:82. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:63 and a V.sub.L according to SEQ ID NO:83. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:64 and a V.sub.L according to SEQ ID NO:84. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:65 and a V.sub.L according to SEQ ID NO:85. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:66 and a V.sub.L according to SEQ ID NO:86. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:67 and a V.sub.L according to SEQ ID NO:87. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:68 and a V.sub.L according to SEQ ID NO:88.

    [0167] In some embodiments, a bispecific binding protein of the disclosure comprises an immunomodulatory binding region comprising a V.sub.H sequence selected from the following sequences (CDR sequences in bold):

    TABLE-US-00012 V.sub.H Sequence (N.fwdarw.C) Identifier TABBY1.1 EVQLVESGGDLVKPGGSQKLSCAASGFTFSSYGMSWVRQTPDRR (SEQ ID NO: 73) V.sub.H LEWVAAIISGGSYTYYPDSVKGRFTISRDNAKNTLYLQMNSLKSE DTAMYYCARHGGYDGNYDYYAMDYWGQGTSVTVSS TABBY3 GVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWFRQAPEKG (SEQ ID NO: 74) V.sub.H LEWVAYISSGSSTIYYADTLKGRFTISRDNPKNTLFLQMTSLRSED TAMYYCARDWVDYWGQGTTLTVSS TABBY5 EVQLQQSGAELVRPGASVKLSCTASGFNIKDYYMHWVKQRPEQ (SEQ ID NO: 75) V.sub.H GLEWIGRIDPEDGDTEYVPKFQGKATMTADTSSNTAYLQLSSLT SEDTAVYYCTPYSNYVYWYFDVWGTGTTVTVSS TABBY6 EVQLQQSGAELVRPGASVKLSCTASGFNIKDYYMHWVKQRPEQ (SEQ ID NO: 76) V.sub.H GLEWIGRIDPEDGDTEYAPKFQGKATMTADTSSNTAYLQLSTLT SEDTAVYYCTPYSNYVYWYFDVWGTGTTVTVSS TABBY9 QVQLKQSGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQSPGKGL (SEQ ID NO: 77) V.sub.H EWLGMIWSGGSTDYNAAFISRLSISKDNSKSQVFFKMNSLQADD TALYFCASYGGFYETMDYWGQGTSVTVSS TABBY10 QIQLVQSGPELKKPGETVKISCKASGYTFTTYGMSWVKQAPGKG (SEQ ID NO: 78) V.sub.H LKWMGWINTYSGVPTYADDFKGRFAFSLETSASTAYLQINNLKN EDTATYFCARGNDGNYYGWFAHWGQGTLVTVSA
    and the amino acid sequence of the corresponding V.sub.L sequence is selected from the following sequences (CDR sequences in bold):

    TABLE-US-00013 V.sub.L Sequence (N.fwdarw.C) Identifier TABBY1.1 DVLMTQTPLSLPVSLGDQASISCRSSQSIVDSDGITYLEWYLQKP (SEQ ID NO: 96) V.sub.L GQSPKWYKVSNRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGLY YCFQVSHVPWTFGGGTKLEIK TABBY3 DIVITQDELSNPVTSGESASISCRSSKSLLYKDGKTYLNWFLQRP (SEQ ID NO: 97) V.sub.L GQSPQLLIYLMSTRASGVSDRFTGSGSGTDFTLEISRVKAEDVGV YYCQQPVEYPYTFGGGTKLEIK TABBY5 DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQR (SEQ ID NO: 98) V.sub.L PGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLG VYYCWQGTHFPHTFGGGTKLEIK TABBY6 DVVMTQTPLTLSVTIGQAASISCKSSQSLLDSDGKTYLNWLLQR (SEQ ID NO: 99) V.sub.L PGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLG VYYCWQGTHFPHTFGGGTKLEIK TABBY9 DIQMTQTTSSLSASLGDRITISCRASQDISNYLNWYQRKPDGTVK (SEQ ID NO: 100) V.sub.L LLIYYTSRLHSGVPSRFSGSGSGRDYSLTISNLEQEDIATYFCQQG NTLPYTFGGGTKLEIK TABBY10 DIQMTQSPSSLSASLGGKVTITCKASQDIHNYISWYQHKPGKGPR (SEQ ID NO: 101) V.sub.L LVIHYTSTLQPGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQY DNLYTFGGGTKLEIK

    [0168] In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:73 and a V.sub.L according to SEQ ID NO:96. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:74 and a V.sub.L according to SEQ ID NO:97. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:75 and a V.sub.L according to SEQ ID NO:98. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:76 and a V.sub.L according to SEQ ID NO:99. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:77 and a V.sub.L according to SEQ ID NO: 100. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:78 and a V.sub.L according to SEQ ID NO:101.

    [0169] In some embodiments, a bispecific binding protein of the disclosure, e.g., a protein of formula (I), is suitable for administration to humans. In a specific embodiment, the bispecific binding protein comprises humanized immunomodulatory protein binding domains. In certain embodiments, a bispecific binding protein of the disclosure comprises an immunomodulatory binding region comprising a V.sub.H sequence selected from the following sequences (CDR sequences in bold):

    TABLE-US-00014 V.sub.H Sequence (N.fwdarw.C) Identifier hu106.1x V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYYIYWVRQAP (SEQ ID NO: 69) GQGLEWIGNIWPGNGGTFYGEKFMGRATFTADTSTSTAYM ELSSLRSEDTAVYYCARRPDYSGDDYFDYWGQGTLVTVSS hu106.1y V.sub.H EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYYIYWVRQAPG (SEQ ID NO: 70) KGLEWIGNIWPGNGGTFYGEKFMGRATFSADTSKNTAYLQ MNSLRAEDTAVYYCARRPDYSGDDYFDYWGQGTLVTVSS hu107.1x V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASDYTFNDYWVSWVRQA (SEQ ID NO: 71) PGQGLEWIGEIYPNSGATNFNGKFRYWGQGTLVTVSS ELSSLRSEDTAVYYCTREYTRDWFAYWGQGTLVTVSS hu107.1y V.sub.H EVQLVESGGGLVQPGGSLRLSCAASGYTFNDYWVSWVRQAP (SEQ ID NO: 72) GKGLEWIGEIYPNSGATNFNGKFRGRATLSVDNSKNTAYLQ MNSLRAEDTAVYYCTREYTRDWFAYWGQGTLVTVSS
    and the amino acid sequence of the corresponding V.sub.L sequence is selected from the following sequences (CDR sequences in bold):

    TABLE-US-00015 V.sub.L Sequence (N.fwdarw.C) Identifier hu106.1x NVMLTQPHSVSESPGKTVTISCKLNSGNIGSYYVHWYQQRPGSSPT (SEQ ID NO: 89) V.sub.L TMIYRDDKRPDGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCHS YDSTITPVFGGGTKLTVL hu106.2x QVVLTQPPSASGTPGQRVTISCKLNSGNIGSYYVHWYQQLPGTAP (SEQ ID NO: 90) V.sub.L KTMIYRDDKRPDGVPDRFSGSSSSNSASLAISGLQSEDEADYYCHS YDSTITPVFGGGTKLTVL hu106.3x SVELTQPPSVSVSPGQTARITCKLNSGNIGSYYVHWYQQKPGQAP (SEQ ID NO: 91) V.sub.L VTMIYRDDKRPDGIPERFSGSSDSSSNSAFLTISGVQAEDEADYYC HSYDSTITPVFGGGTKLTVL hu106.4x EVVLTQPPSLSASPGASARLTCKLNSGNIGSYYVHWYQQKPGSPPR (SEQ ID NO: 92) V.sub.L TMIYRDDKRPDGVPSRFSGSKDSSSNSAFLLISGLQSEDEADYYCH SYDSTITPVFGGGTKLTVL hu106.5x DVQLTQSPSSLSASVGDRVTITCKLNSGNIGSYYVHWYQQKPGKA (SEQ ID NO: 93) V.sub.L PKTMIYRDDKRPDGVPSRFSGSGDSSSNSAFLTISSLQPEDFATYYC HSYDSTITPVFGQGTKVEIK hu107.1x DVVLTQSPLSLPVTLGQPASISCRSSQSLLDSDGNTYLYWFQQRPG (SEQ ID NO: 94) V.sub.L QSPRRLIYLVSNLGSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYY CMQPTHAPYTFGQGTKLEIK hu107.1y DVQLTQSPSSLSASVGDRVTITCRSSQSLLDSDGNTYLYWFQQKPG (SEQ ID NO: 95) V.sub.L KAPKRLIYLVSNLGSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC MQPTHAPYTFGQGTKVEIK

    [0170] In some embodiments, the bispecific binding protein has a 4-1BB binding domain with amino acid sequences of the CDRs of:

    TABLE-US-00016 CDR Sequence (N.fwdarw.C) Identifier V.sub.H CDR#1 GYTFTSYYIY (SEQ ID NO: 280) V.sub.H CDR#2 NIWPGNGGTFYGEKFMG (SEQ ID NO: 281) V.sub.H CDR#3 RPDYSGDDYFDY (SEQ ID NO: 282) V.sub.L CDR#1 KLNSGNIGSYYVH (SEQ ID NO: 283) V.sub.L CDR#2 RDDKRPD (SEQ ID NO: 284) V.sub.L CDR#3 HSYDSTITPV (SEQ ID NO: 285)

    [0171] In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to any one of SEQ ID NO:69-72 and a V.sub.L according to any one of SEQ ID NO:89-95. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:69 and a V.sub.L according to SEQ ID NO:89. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:69 and a V.sub.L according to SEQ ID NO:90. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:70 and a V.sub.L according to SEQ ID NO:90. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:69 and a V.sub.L according to SEQ ID NO:91. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:69 and a V.sub.L according to SEQ ID NO:92. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:69 and a V.sub.L according to SEQ ID NO:93. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:70 and a V.sub.L according to SEQ ID NO:89. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:70 and a V.sub.L according to SEQ ID NO:91. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:70 and a V.sub.L according to SEQ ID NO:92. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:70 and a V.sub.L according to SEQ ID NO:93. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:71 and a V.sub.L according to SEQ ID NO:94. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:71 and a V.sub.L according to SEQ ID NO:95. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:72 and a V.sub.L according to SEQ ID NO:94. In some embodiments, the bispecific binding protein has a 4-1BB binding domain comprising a V.sub.H according to SEQ ID NO:72 and a V.sub.L according to SEQ ID NO:95.

    [0172] Certain mutations of a V.sub.H or V.sub.L sequence in an immunomodulatory binding region described in Section 7.3.2 herein would be understood by a person of skill to afford bispecific binding proteins within the scope of the disclosure. Mutations may include amino acid substitutions, additions, or deletions from a V.sub.H or V.sub.L sequence as disclosed herein while retaining significant activity toward an immunomodulatory protein. Accordingly, in some embodiments, a bispecific binding protein comprises a V.sub.H sequence having at least 85%, at least 90%, at least 93%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any one of the V.sub.H sequences shown in Section 7.3.2. A bispecific binding protein can comprise a V.sub.H sequence having up to 8, up to 7, up to 6, up to 5, up to 4, up to 3, or up to 2 mutations compared with any one of the V.sub.H sequences shown in Section 7.3.2. In some embodiments, a bispecific binding protein can comprise a V.sub.H sequence having 5 or fewer, 4 or fewer, 3 or fewer, or 2 or fewer mutations compared with any one of the V.sub.H sequences shown in Section 7.3.2. In some embodiments, a bispecific binding protein comprises a V.sub.L sequence having at least 85%, at least 90%, at least 93%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any one of the V.sub.L sequences shown in Section 7.3.2. A bispecific binding protein can comprise a V.sub.L sequence having up to 8, up to 7, up to 6, up to 5, up to 4, up to 3, or up to 2 mutations compared with any one of the V.sub.L sequences shown in Section 7.3.2. In some embodiments, a bispecific binding protein can comprise a V.sub.L sequence having 5 or fewer, 4 or fewer, 3 or fewer, or 2 or fewer mutations compared with any one of the V.sub.L sequences shown in Section 7.3.2.

    [0173] 7.3.3. Tumor Antigen Binding Proteins

    [0174] In another aspect, the bispecific binding protein of the disclosure selectively binds to a tumor antigen. Cell-surface tumor antigens are expressed on the cell membranes of solid tumors, including any of the solid tumors described herein. Appropriate tumor antigens include CSF1R, Ly86, MS4A7, CD74, CCR5, COL7A1, LOX, LRRC15, SERPINE1, TGFBR1, VEGF-A, VEGFR, ANGPTL4, EGLN, IFI6, KISS1R, PDK1, CADM1, COL6A3, KRT33A, LUM, WNT5A, MMP14, CDCP1, PDGFRA, ADGRE1, MHC-Class II, HLA-DR, TCRαβ, TCRγδ, PD-1, PD-L1, CTLA-4, MUC1, MUC16, CA15-3, CA19-9, CA-195, CA-549, cathepsin-D, CEACAM5, CEACAM6, ERBB2, EGFR, ENO2, ALPP, PLP1, DLL3, SLC34A2, PTK7, B7-H3, LIV-1, STEAP1, TACSTD2, GPNMB, 5T4, CD142, TIM1, CDH3, LGR5, LYPD3, TGDF1, B7-H4, mesothelin, nectin-4, and PSMA. In specific embodiments, a tumor antigen is selected from mesothelin, B7-H4, nectin-4, PSMA, PD-L1, EGFR and VEGFR. In certain embodiments, a tumor antigen is selected from mesothelin, B7-H4, nectin-4, PSMA and EGFR.

    [0175] For some uses, it is desirable to have bispecific binding proteins with high affinity to a tumor antigen. For certain uses, such as therapeutic uses, an affinity, e.g., K.sub.D, of at least about 100 nM is desirable. For applications in which specific affinities are desired, bispecific binding proteins specifically bind a tumor antigen with an affinity of at least about 100 nM, or even higher, for example, at least about 90 nM, 80 nM, 70 nM, 60 nM, 50 nM, 40 nM, 30 nM, 25 nM, 20 nM, 15 nM, 10 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.1 nM, 0.01 nM, or greater. In some embodiments, the K.sub.D to a tumor antigen is in a range bounded by any two of the foregoing values, e.g., from about 0.1 to about 100 nM, such as 1 to 100, 0.1 to 50, 2 to 90, or about 0.1 to 80 nM.

    [0176] In a specific embodiment, a bispecific binding protein of the disclosure has affinity to and agonizes CD40, and has high affinity to mesothelin. In another specific embodiment, a bispecific binding protein of the disclosure has affinity to and agonizes CD40, and has high affinity to prostate-specific membrane antigen (PSMA). In yet another specific embodiment, a bispecific binding protein of the disclosure has affinity to and agonizes CD40, and has high affinity to epidermal growth factor receptor (EGFR). In an additional specific embodiment, a bispecific binding protein of the disclosure has affinity to and agonizes CD40, and has high affinity to nectin-4. In another embodiment, a bispecific binding protein disclosed herein has affinity to and agonizes 4-1BB, and has high affinity to mesothelin. In another embodiment, a bispecific binding protein disclosed herein has affinity to and agonizes 4-1BB, and has high affinity to B7-H4. In another embodiment, a bispecific binding protein disclosed herein has affinity to and agonizes 4-1BB, and has high affinity to PSMA.

    [0177] Affinity of binding proteins that bind an immunomodulatory protein and a tumor antigen can be determined using techniques well known in the art or described herein, such as for example, ELISA, isothermal titration calorimetry (ITC), surface plasmon resonance, or fluorescent polarization assay.

    [0178] In a specific embodiment, the bispecific binding proteins of the disclosure binds to CD40 and mesothelin. In another specific embodiment, a bispecific binding protein of the disclosure binds to CD40 and prostate-specific membrane antigen (PSMA). In yet another specific embodiment, a bispecific binding protein of the disclosure binds to CD40 and epidermal growth factor receptor (EGFR). In an additional specific embodiment, a bispecific binding protein of the disclosure binds to CD40 and nectin-4. In another specific embodiment, the bispecific binding protein binds to 4-1BB and mesothelin. In another specific embodiment, the bispecific binding protein binds to 4-1BB and B7-H4. In yet another specific embodiment, the bispecific binding protein binds to 4-1BB and PSMA.

    [0179] In an illustrative embodiment, when the immunomodulatory protein is CD40 and X is scFv.sup.X, the bispecific binding protein of formula (I) comprises scFv.sup.X binding CD40 and scFv.sup.Y binding mesothelin. In certain embodiments, when the immunomodulatory protein is CD40 and X is scFv.sup.X, the bispecific binding protein of formula (I) comprises scFv.sup.X binding mesothelin and scFv.sup.Y binding CD40. In certain embodiments, when the immunomodulatory protein is CD40 and X is Fab, the bispecific binding protein of formula (I) comprises Fab binding mesothelin and scFv.sup.Y binding CD40.

    [0180] In an illustrative embodiment, when the immunomodulatory protein is CD40, the polypeptide of formula (II) comprises scFv.sup.X binding CD40 and scFv.sup.Y binding mesothelin. In certain embodiments, when the immunomodulatory protein is CD40, the polypeptide of formula (II) comprises scFv.sup.X binding mesothelin and scFv.sup.Y binding CD40.

    [0181] In an illustrative embodiment, when the immunomodulatory protein is CD40, the polypeptide of formula (III) comprises Fab binding mesothelin and scFv.sup.Y binding CD40.

    [0182] In an illustrative embodiment, when the immunomodulatory protein is CD40, the polypeptide of formula (IV) comprises V.sub.H-CH1, when combined with a peptide comprising V.sub.L-CL, binding mesothelin, and scFv.sup.Y binding CD40.

    [0183] In some embodiments, the bispecific binding proteins compete for binding human mesothelin on cells expressing mesothelin in in vitro assays with a reference antibody. The reference antibody may be any of the anti-mesothelin antibodies described herein or known in the art. In some embodiments, the reference antibody is an antibody provided in TABLE 2-1. In specific embodiments, the reference antibody is selected from antibody HuAb17 (“HuAb17”); antibody HuAM1 (“HuAM1”); antibody HuAM2 (“HuAM2”); antibody HuAM3 (“HuAM3”); antibody HuAM4 (“HuAM4”); antibody HuAM5 (“HuAM5”); antibody HuAM6 (“HuAM6”); antibody HuAM7 (“HuAM7”); antibody HuAM8 (“HuAM8”); antibody HuAM9 (“HuAM9”); antibody HuAM11 (“HuAM11”); antibody HuAM12 (“HuAM12”); antibody HuAM13 (“HuAM13”); antibody HuAM14 (“HuAM14”); antibody HuAM15 (“HuAM15”); antibody HuAM17 (“HuAM17”); antibody HuAM18 (“HuAM18”); antibody HuAM19 (“HuAM19”); and antibody HuAM21 (“HuAM21”). In a specific embodiment, the reference antibody is HuAM15.

    [0184] In some embodiments, a bispecific binding protein of the disclosure, e.g., a protein of formula (I), is suitable for administration to humans. In a specific embodiment, the bispecific binding protein comprises human tumor antigen-binding domains. In another specific embodiment, the bispecific binding protein comprises a tumor antigen binding region comprising a V.sub.H sequence selected from the following sequences (CDR sequences in bold):

    TABLE-US-00017 V.sub.H Sequence (N.fwdarw.C) Identifier HuAb17 V.sub.H EVQLVQSGAEVKEPGASVKVSCKASGDTFNRYYVHWARQAPG (SEQ ID NO: 107) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTPTNTVYMELGS LRPEDTAVYFCAESRGSGYNYFAMDVWGQGTLVTVSS HuAM1 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFKRYYVQWVRQAPG (SEQ ID NO: 108) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAESRGSGYNYFAMDVWGQGTLVTVSS HuAM2 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGYTFKRYYVHWVRQAPG (SEQ ID NO: 109) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAESRGSGYNYFAMDVWGQGTLVTVSS HuAM3 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFKRYYVHWVRQAPG (SEQ ID NO: 110) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAESRGSGYNYFAMDVWGQGTLVTVSS HuAM4 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPG (SEQ ID NO: 111) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAESRIPGYNNFAMDVWGQGTLVTVSS HuAM5 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPG (SEQ ID NO: 112) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAEVRGSGYNYFAMDVWGQGTLVTVSS HuAM6 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPG (SEQ ID NO: 113) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAESRVPGYNNFAMDVWGQGTLVTVSS HuAM7 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPG (SEQ ID NO: 114) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAEVRGSGYNYFGMDVWGQGTLVTVSS HuAM8 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPG (SEQ ID NO: 115) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAESRGSGYNYFAMDVWGQGTLVTVSS HuAM9 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVQWVRQAPG (SEQ ID NO: 116) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAETRGSGYNYFGMDVWGQGTLVTVSS HuAM11 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFKRYYMHWVRQAPG (SEQ ID NO: 117) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAEVRGSGFNYFGMDVWGQGTLVTVSS HuAM12 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFHRYYVHWVRQAPG (SEQ ID NO: 118) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAEVRGSGFNYFGMDVWGQGTLVTVSS HuAM13 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVQWVRQAPG (SEQ ID NO: 119) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAETRGSGFNYFGMDVWGQGTLVTVSS HuAM15 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFKRYYVHWVRQAPG (SEQ ID NO: 120) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAEVRGSGFNYFGMDVWGQGTLVTVSS HuAM17 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVQWVRQAPG (SEQ ID NO: 121) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAESRVPGYNIFAMDVWGQGTLVTVSS HuAM18 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPG (SEQ ID NO: 122) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAETRGSGYNYFGMDVWGQGTLVTVSS HuAM19 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFKRYYAHWVRQAPG (SEQ ID NO: 123) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAESRLPGYNAFAMDVWGQGTLVTVSS HuAM21 V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVQWVRQAPG (SEQ ID NO: 124) QGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSS LRSEDTAVYYCAETRGPGFNYFGMDVWGQGTLVTVSS HuAM15 EVQLVQSGAGLVQPGGSVRVSCAASGFTFKRYYVHWVRQAPG (SEQ ID NO: 125) Stab2 V.sub.H KGLEWMGIINPSGVSTTYAQKFQGRVTISRDNSKNTLYMQLNS LRAEDTAVYYCARVRGSGFNYFGMDVWGQGTLVTVSS HuAM15 EVQLVESGAGLVKPGESVKVSCAASGFTFKRYYVHWVRQAPG (SEQ ID NO: 126) Stab3 V.sub.H KGLEWMGIINPSGVSTTYAQKFQGRVTISRDNSTNTLYMELNSL RAEDTAVYYCARVRGSGFNYFGMDVWGQGTLVTVSS HuAM15 EVQLVESGAGVVKPGESVKVSCAASGFTFKRYYVHWVRQAPG (SEQ ID NO: 127) Stab4 V.sub.H KGLEWMGIINPSGVSTTYAQKFQGRVTMSRDTSTSTVYMELNS LRAEDTAVYYCARVRGSGFNYFGMDVWGQGTLVTVSS HuAM15 EVQLVESGGGLVQPGGSLRLSCAASGFTFKRYYVHWVRQAPGK (SEQ ID NO: 128) Stab VH3 V.sub.H GLEWVGIINPSGVSTTYAQKFQGRFTISRDNSKNTLYLQMNSLR AEDTAVYYCARVRGSGFNYFGMDVWGQGTLVTVSS MSLN76923 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGK (SEQ ID NO: 129) V.sub.H GLEWVSAISGGGGRTYYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAVYYCAREEMAFRAYRFDIWGQGTLVTVSS
    and the amino acid sequence of the corresponding V.sub.L sequence is selected from the following sequences (CDR sequences in bold):

    TABLE-US-00018 V.sub.L Sequence (N.fwdarw.C) Identifier HuAb17 V.sub.L SYELTQPPSVSVSPGQTADITCSGDKLGDKYASWYQQKPGQSPV (SEQ ID NO: 136) LVIYQDNRRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQA WDSDTYVFGPGTKVTVL HuAM1 V.sub.L SYELTQPPSVSVSPGQTASITCSGDKLGDKYASWYQQKPGQSPV (SEQ ID NO: 137) LVIYQDNRRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQA WDSDTYVFGTGTKVTVL HuAM8 V.sub.L SYELTQPPSVSVSPGQTASITCSGDNLGYKYVSWYQQKPGQSPV (SEQ ID NO: 138) LVIYQDHRRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQA WDTDTYVFGTGTKVTVL HuAM11 V.sub.L SYELTQPPSVSVSPGQTASITCSGDKLGDKYASWYQQKPGQSPV (SEQ ID NO: 139) LVIYQDNRRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQV WDSDTYVFGTGTKVTVL HuAM19 V.sub.L SYELTQPPSVSVSPGQTASITCSGDMLGYQYGSWYQQKPGQSPV (SEQ ID NO: 140) LVIYQDNRRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQA WDGDAFVFGTGTKVTVL HuAM15 SYELTQPPSVSVAPGQTARISCSGDKLGDKYASWYQQKPGQAPV (SEQ ID NO: 141) Stab VL3 V.sub.L LVIYQDNRRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCQA WDSDTYVFGGGTKLTVL HuAM15 DIQMTQSPSSLSASVGDRVTITCSGDKLGDKYASWYQQKPGKAP (SEQ ID NO: 142) Stab VK V.sub.L KLLIYQDNRRPSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQA WDSDTYVFGQGTKVEIK MSLN76923 DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPK (SEQ ID NO: 143) V.sub.L LLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQS YITPLTFGGGTKVEIK

    [0185] In some embodiments, the bispecific binding protein has a mesothelin binding domain with amino acid sequences of the CDRs of:

    TABLE-US-00019 CDR Sequence (N.fwdarw.C) Identifier V.sub.H CDR#1 GDTFKRYYVH (SEQ ID NO: 241) V.sub.H CDR#2 IINPSGVSTTYAQKFQG (SEQ ID NO: 242) V.sub.H CDR#3 VRGSGFNYFGMDV (SEQ ID NO: 243) V.sub.L CDR#1 SGDKLGDKYAS (SEQ ID NO: 244) V.sub.LCDR#2 QDNRRPS (SEQ ID NO: 245) V.sub.L CDR#3 QAWDSDTYV (SEQ ID NO: 246)

    [0186] In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO:107 and a V.sub.L according to SEQ ID NO:136. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO:108 and a V.sub.L according to SEQ ID NO:137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 109 and a V.sub.L according to SEQ ID NO: 137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO:110 and a V.sub.L according to SEQ ID NO: 137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO:111 and a V.sub.L according to SEQ ID NO:137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 112 and a V.sub.L according to SEQ ID NO: 137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 113 and a V.sub.L according to SEQ ID NO:137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 114 and a V.sub.L according to SEQ ID NO: 137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 115 and a V.sub.L according to SEQ ID NO: 138. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 116 and a V.sub.L according to SEQ ID NO:137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 117 and a V.sub.L according to SEQ ID NO: 139. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 118 and a V.sub.L according to SEQ ID NO:137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 119 and a V.sub.L according to SEQ ID NO: 139. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 117 and a V.sub.L according to SEQ ID NO: 137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 120 and a V.sub.L according to SEQ ID NO:137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 119 and a V.sub.L according to SEQ ID NO: 137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO:120 and a V.sub.L according to SEQ ID NO:141. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 121 and a V.sub.L according to SEQ ID NO: 137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 122 and a V.sub.L according to SEQ ID NO: 137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 123 and a V.sub.L according to SEQ ID NO: 140. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO: 124 and a V.sub.L according to SEQ ID NO: 137. In some embodiments, the bispecific binding protein has a mesothelin binding domain comprising a V.sub.H according to SEQ ID NO:129 and a V.sub.L according to SEQ ID NO:143.

    [0187] In some embodiments, the bispecific binding proteins compete for binding human nectin-4 on cells expressing nectin-4 in in vitro assays with a reference antibody. The reference antibody may be any of the anti-nectin-4 antibodies described herein or known in the art.

    [0188] In some embodiments, a bispecific binding protein of the disclosure comprises a nectin-4 binding region comprising a V.sub.H sequence of (CDR sequences in bold):

    TABLE-US-00020 V.sub.H Sequence (N.fwdarw.C) Identifier 66.3 V.sub.H QVQLQQSGPELVKPGASVRISCKASGYTFTTYYIHWVKQRPGQG (SEQ ID NO: 151) LEWIGWIYPGNVNTNYNEKFKGKATLTADKSSSTAYMQLTSLTS EDSAVYFCARGVYYFDYWGQGTILTVSS
    and a V.sub.L sequence of (CDR sequences in bold):

    TABLE-US-00021 V.sub.L Sequence (N.fwdarw.C) Identifier 66.3 V.sub.L SIVMTQTPKFLLVSAGDRVTITCKASQSVNNDVSWFQQKPGQSPT (SEQ ID NO: 161) LLIYYASNRYTGVPDRFTGSGYGTDFTFTISTVQAEDLAVYFCQQ DYSSPYTFGGGTKLEIK

    [0189] In some embodiments, the bispecific binding proteins compete for binding human epidermal growth factor receptor (EGFR) on cells expressing epidermal growth factor receptor in in vitro assays with a reference antibody. The reference antibody may be any of the anti-EGFR antibodies described herein or known in the art.

    [0190] In some embodiments, a bispecific binding protein of the disclosure comprises an EGFR binding region comprising a V.sub.H sequence of (CDR sequences in bold):

    TABLE-US-00022 V.sub.H Sequence (N.fwdarw.C) Identifier Hu225- EVQLVESGGGLVQPGGSLRLSCAASGFSLTNYGVHWVRQAP (SEQ ID NO: 171) G30Y V.sub.H GKGLEWLGVIWSGGNTDYNTPFTSRLTINKDNSKNTVYLQM NSLRAEDTAVYYCARALTYYDYEFAYWGQGTLVTVSS
    and a V.sub.L sequence of (CDR sequences in bold):

    TABLE-US-00023 V.sub.L Sequence (N.fwdarw.C) Identifier Hu225- DILLTQSPGTLSLSPGERATLSCRA (SEQ ID NO: 181) G30Y V.sub.L SQSIYTNIHWYQQKPGQAPRLLIKY ASESISGIPDRFSGSGSGTDFTLTI SRLEPEDFAVYYCQQNNNWPTTF GQGTKLEIK

    [0191] In some embodiments, the bispecific binding proteins compete for binding human prostate-specific membrane antigen (PSMA) on cells expressing prostate-specific membrane antigen in in vitro assays with a reference antibody. The reference antibody may be any of the anti-PSMA antibodies described herein or known in the art. In some embodiments, the reference antibody is a humanized version of an anti-PSMA antibody as described herein, e.g., an antibody having the V.sub.H and V.sub.L sequences shown in FIGS. 10A, 10J, and 10K.

    [0192] In some embodiments, a bispecific binding protein of the disclosure comprises a PSMA binding region comprising a V.sub.H sequence selected from the following sequences (CDR sequences in bold):

    TABLE-US-00024 V.sub.H Sequence (N.fwdarw.C) Identifier SAM3.1 V.sub.H DVQLQESGPGLVKPSQSLSLTCSVTGYSITSGYYWNWIRQFR (SEQ ID NO: 191) GSKLEWMGYISYDGNNNYNPSLKNRISITRDTSKNQFFLKLN SVTTEDTATYYCARERYYDYDGYAVDYWGQGTSVTVSS SAM103 V.sub.H EVKLVESEGGLVQPGSSMKLSCTASGFTESDYYMAWVRQVR (SEQ ID NO: 192) EKGLEWVANINYDGTTTYYLDSLKSRFIISRDNSKNILYLQM SSLKSEDTATYYCARVLDGYYGYFDYWGQGTTLSVSS SAM4.1 V.sub.H DVKLVESGEGLVKPGGSLKLSCAASGFTESSYAMSWVRQTPE (SEQ ID NO: 193) KRLEWVAYISSGGDYIYYADTMKGRFTISRDNARNTLYLQM SSLKSEDTAMYYCTRVFDGYYARFLYWGQGTLVTVSA SAM5.1 V.sub.H QVTLKESGPGILQSSQTLSLTCSFSGESLSTSGMGVSWIRQPSG (SEQ ID NO: 194) KGLEWLAHIYWDDDQRYNPSLKSRLTISKDASGNQVFLKITS VDTADTATYYCTRRGGYGSSKGYYYVMDYWGQGTSVTVSS SAM13.1 V.sub.H QVQLQQRGAELVKPGASVKVSCKASGYTFTNYWMHWVKQ (SEQ ID NO: 195) RPGQGLEWIGRIHPSDSDTNYNQRFKGKATLTVDKSSTTAY MQLSSLTSEDSAVYYCAIEDYSNYVDFDVWGTGTTVTVSS SAM16.2 V.sub.H QTQLVQSGPELKKPGETVKISCKASGYTETTYGVSWVKQAPG (SEQ ID NO: 196) KGLKWMGWINTYSGVPTYADDFKGRFAFSLETSASTAYLQI TNLKNEDTATYFCARQEAFYNRTMDYWGQGTSVTVSS SAM17.1 V.sub.H EVQLQQSGPVLVKPGASVKMSCKASGYTFTDYYMNWVKQS (SEQ ID NO: 197) HGKSLEWIGLINPNSGGINYNQKFKVKATLTVDKSSSTAYME LNSLTSEDSAVYYCARRDYGTSGDYWGQGTSVTVSS
    and the amino acid sequence of the corresponding V.sub.L sequence is selected from the following sequences (CDR sequences in bold):

    TABLE-US-00025 V.sub.L Sequence (N.fwdarw.C) Identifier SAM3.1 V.sub.L DIQMTQSPASLSVSVGETVTITCRASENIYSNLAWYQQKQGK (SEQ ID NO: 201) SPQLLVYGATNLADGVTSRFSGSGSGTQYSLKINSLQSEDFGS YYCQNFWGTTWTFGGGTKLEIK SAM103 V.sub.L QIVLTQSPAIMSASPGEKVTISCSASSSVSYMYWYQQKPGSSP (SEQ ID NO: 202) KPWIYRTYNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYY CQQSHTYPPTFGGGTKLEIK SAM4.1 V.sub.L DIVMTQSQKFMSTSVGDRVSVTCKASQNVDTNVAWYQQKP (SEQ ID NO: 203) GQSPKALIYSTSYRYSGVPDRFTGSGSGTDFTLTINNVQSEDL AEYFCQQYNNYPLTFGTGTKLELK SAM5.1 V.sub.L DIQMTQSPSSLSASLGERVSLTCRASQHIGTRLNWLQQEPDG (SEQ ID NO: 204) TIKRLIYATSSLDSGVPKRFSGSRSGSVYSLTISSLESEDFVDYY CVQYASSPYTFGGGTKLEIK SAM13.1 V.sub.L DILLTQSPASLAVSLGQRATISCRASESVDTYGITFIHWYQQK (SEQ ID NO: 205) PGQPPKWYRASNLESGIPARFSGSGSKTDFTLTINPVETDDV ATYYCQQNNKDPRTFGGGTKLEIR SAM16.2 V.sub.L ENVLTQSPAIMSASPGEKVTMTCRASSSVSSSYLHWYQQKSG (SEQ ID NO: 206) ASPKLWIYSRSTLASGVPARFSGSGSGTSYSLTISSVEAEDAAT YYCQQYRGYPLTFGSGTKLEIK SAM17.1 V.sub.L DIQMNQSPSSLSASLGDTITITCHASQNINVWLSWYQQKPGNI (SEQ ID NO: 207) PKWYKASNLHTGVPSRFSGSGSGTGFTLTISSLQPEDIATYY CQQGQSYPLTFGAGTKLELK

    [0193] In some embodiments, the bispecific binding protein has a PSMA binding domain comprising a V.sub.H according to SEQ ID NO:191 and a V.sub.L according to SEQ ID NO:201. In some embodiments, the bispecific binding protein has a PSMA binding domain comprising a V.sub.H according to SEQ ID NO: 192 and a V.sub.L according to SEQ ID NO:202. In some embodiments, the bispecific binding protein has a PSMA binding domain comprising a V.sub.H according to SEQ ID NO: 193 and a V.sub.L according to SEQ ID NO:203. In some embodiments, the bispecific binding protein has a PSMA binding domain comprising a V.sub.H according to SEQ ID NO: 194 and a V.sub.L according to SEQ ID NO:204. In some embodiments, the bispecific binding protein has a PSMA binding domain comprising a V.sub.H according to SEQ ID NO: 195 and a V.sub.L according to SEQ ID NO:205. In some embodiments, the bispecific binding protein has a PSMA binding domain comprising a V.sub.H according to SEQ ID NO: 196 and a V.sub.L according to SEQ ID NO:206. In some embodiments, the bispecific binding protein has a PSMA binding domain comprising a V.sub.H according to SEQ ID NO: 197 and a V.sub.L according to SEQ ID NO:207.

    [0194] In some embodiments, the bispecific binding proteins compete for binding B7-H4 on cells expressing B7-H4 in in vitro assays with a reference antibody. The reference antibody may be any of the anti-B7-H4 antibodies described herein or known in the art. In some embodiments, the reference antibody is a humanized version of an anti-B7-H4 antibody as described herein, e.g., an antibody having the V.sub.H and V.sub.L sequences shown in FIGS. 10E-10G.

    [0195] In some embodiments, a bispecific binding protein of the disclosure comprises a B7-H4 binding region comprising a V.sub.H sequence selected from the following sequences (CDR sequences in bold):

    TABLE-US-00026 V.sub.H Sequence (N.fwdarw.C) Identifier mu182.19.1 QVQLRQPGAELVKPGASVKLSCKTSGYTFTSYWMHWVKQRP (SEQ ID NO: 211) V.sub.H GQGLEWIGEIDPSDSYINYNQKFKGEATLTVDKSSSTAYMQLS SLTSEDSAVYYCARGPRDYWGQGTTLTVSS mu182.17.1 QVQLQQSGAELARPGASVKLSCKASGYTFTTYWMQWVKQRP (SEQ ID NO: 212) V.sub.H GQGLEWIGAIYPGDGDTRYTQKFKGKATLTADKSSSTAYMQL SSLASEDSAVYYCARGRDYSGSSWTWFAYWGQGTLVTVSA hu182.19.1 EVQLVQSGAEVKKPGSSVKVSCKTSGYTFTSYWMHWVRQAP (SEQ ID NO: 213) 1a V.sub.H GQGLEWIGEIDPSDSYINYNQKFKGRATLTVDKSTSTAYMELS SLRSEDTAVYYCARGPRDYWGQGTTVTVSS hu182.17.1 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTTYWMQWVRQAP (SEQ ID NO: 214) 1b V.sub.H GQGLEWMGAIYPGDGDTRYTQKFKGRVTLTADKSTSTAYME LSSLRSEDTAVYYCARGRDYSGSSWTWFAYWGQGTLVTVSS hu182.19.1 EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAP (SEQ ID NO: 215) 1b V.sub.H GQGLEWMGEIDPSDSYINYNQKFKGRVTLTVDKSTSTAYMEL SSLRSEDTAVYYCARGPRDYWGQGTTVTVSS mu182.10.21 EVKLVESGGGLVQPGGSVRLSCATSGFTFSDYYMSWVRQPPGK (SEQ ID NO: 216) V.sub.H ALELLGFIRNKANGYTREYSASVKGRFTMSRDNSQSVLYLQM NTLRAEDSATYYCARDSHRTYFDYWGQGTTLTVSS hu182.10.21 EVQLVESGGGLVQPGGSLRLSCATSGFTFSDYYMSWVRQAPG (SEQ ID NO: 217) b. 1a V.sub.H KGLELLGFIRNKANGYTREYSASVKGRFTMSRDNSKNSLYLQ MNSLKTEDTAVYYCARDSHRTYFDYWGQGTTVTVSS mu182.23.1 DVQLQESGPGLVKPAQSLSLTCSVTGYSITSGYYWNWNRQFPG (SEQ ID NO: 218) V.sub.H IKLEWMGYITYEGTNNYNPSLKNRISITRDTSKNQFFLKLNSVT IEDTATYYCAREALWRAMDYWGQGTSVTVSS hu181.23.1 EVQLQESGPGLVKPSGTLSLTCAVTGYSITSGYYWNWNRQFPG (SEQ ID NO: 219) 1a V.sub.H KGLEWMGYITYEGTNNYNPSLKNRISISRDKSKNQFSLKLSSVT AADTAVYYCAREALWRAMDYWGQGTTVTVSS
    and the amino acid sequence of the corresponding V.sub.L sequence is selected from the following sequences (CDR sequences in bold):

    TABLE-US-00027 V.sub.L Sequence (N.fwdarw.C) Identifier mu182.19.1 DIQMTQTTSSLSASLGDRVTISCSASQGISNYLNWYQQKPDGT (SEQ ID NO: 221) V.sub.L VKLLIYYTSRLHSGVPSRFSGSGSGTDFSLTISNLEPEDIATYY CQQYSKLPYTFGGGTKLEVK mu182.17.1 DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKSYLAWY (SEQ ID NO: 222) V.sub.L QQKPGQSPKVLIYWASSRESGVPDRFTGSGSGTDFTLTISSVQ PEDLAVYYCKQSYNLYTFGGGTKLEIK hu182.19.1 DIQMTQSPSSLSASVGDRVTITCSASQGISNYLNWYQQKPGK (SEQ ID NO: 223) 1a V.sub.L AVKLLIYYTSRLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATY YCQQYSKLPYTFGGGTKVEIK hu182.17.1 DIVMTQSPDSLAVSLGERATINCKSSQSLLNSRTRKSYLAWY (SEQ ID NO: 224) 1b V.sub.L QQKPGQPPKVLIYWASSRESGVPDRFSGSGSGTDFTLTISSLQ AEDVAVYYCKQSYNLYTFGGGTKVEIK mu182.10.21 QIVLSQSPAILSASPGEKVTMTCRASSSVSSMHWYQQKPGSSP (SEQ ID NO: 225) V.sub.L KPWIYATSNLASGVPTRFSGSGSGTSYSLTISRVEAEDAATYY CQQWSSNPPMYTFGGGTKLEIK hu182.10.21 EIVLTQSPDFQSVTPKEKVTITCRASSSVSSMHWYQQKPDQSP (SEQ ID NO: 226) 1a V.sub.L KPWIYATSNLASGVPSRFSGSGSGTDYTLTINSLEAEDAATYY CQQWSSNPPMYTFGGGTKVEIK hu182.10.21 DIQLTQSPSFLSASVGDRVTITCRASSSVSSMHWYQQKPGKSP (SEQ ID NO: 227) 2a V.sub.L KPWIYATSNLASGVPSRFSGSGSGTEYTLTISSLQPEDFATYYC QQWSSNPPMYTFGGGTKVEIK mu182.23.1 ENVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTS (SEQ ID NO: 228) V.sub.L PKLWIYDTSKLASGVPGRFSGSGSGNSYSLTISSMEAEDVATY YCFQGSGYPLTFGAGTKLELK hu181.23.1 DNQLTQSPSFLSASVGDRVTITCSASSSVSYMHWYQQKPGKS (SEQ ID NO: 229) 1a V.sub.L PKLWIYDTSKLASGVPSRFSGSGSGTEYSLTISSLQPEDFATYY CFQGSGYPLTFGQGTKLEIK hu181.23.1 DNQLTQSPSFLSASVGDRVTITCSASSSVSYMHWYQQKPGKA (SEQ ID NO: 230) 1b V.sub.L PKLWIYDTSKLASGVPSRFSGSGSGTEYTLTISSLQPEDFATYY CFQGSGYPLTFGQGTKLEIK

    [0196] In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:211 and a V.sub.L according to SEQ ID NO:221. In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:212 and a V.sub.L according to SEQ ID NO:222. In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:216 and a V.sub.L according to SEQ ID NO:225. In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:218 and a V.sub.L according to SEQ ID NO:228.

    [0197] In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:213, 214, 215, 217, or 219, and a V.sub.L according to SEQ ID NO:223, 224, 226, 227, 229, or 230. In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:213 and a V.sub.L according to SEQ ID NO:223. In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:214 and a V.sub.L according to SEQ ID NO:224. In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:215 and a V.sub.L according to SEQ ID NO:223. In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:217 and a V.sub.L according to SEQ ID NO:226. In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:217 and a V.sub.L according to SEQ ID NO:227. In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:219 and a V.sub.L according to SEQ ID NO:229. In some embodiments, the bispecific binding protein has a B7-H4 binding domain comprising a V.sub.H according to SEQ ID NO:219 and a V.sub.L according to SEQ ID NO:230.

    [0198] Certain mutations of a V.sub.H or V.sub.L sequence in a tumor antigen binding region described in Section 7.3.3 herein would be understood by a person of skill to afford bispecific binding proteins within the scope of the disclosure. Mutations may include amino acid substitutions, additions, or deletions from a V.sub.H or V.sub.L sequence as disclosed herein while retaining significant activity toward a tumor antigen. Accordingly, in some embodiments, a bispecific binding protein comprises a V.sub.H sequence having at least 85%, at least 90%, at least 93%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any one of the V.sub.H sequences shown in Section 7.3.3. A bispecific binding protein can comprise a V.sub.H sequence having up to 8, up to 7, up to 6, up to 5, up to 4, up to 3, or up to 2 mutations compared with any one of the V.sub.H sequences shown in Section 7.3.3. In some embodiments, a bispecific binding protein can comprise a V.sub.H sequence having 5 or fewer, 4 or fewer, 3 or fewer, or 2 or fewer mutations compared with any one of the V.sub.H sequences shown in Section 7.3.3. In some embodiments, a bispecific binding protein comprises a V.sub.L sequence having at least 85%, at least 90%, at least 93%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any one of the V.sub.L sequences shown in Section 7.3.3. A bispecific binding protein can comprise a V.sub.L sequence having up to 8, up to 7, up to 6, up to 5, up to 4, up to 3, or up to 2 mutations compared with any one of the V.sub.L sequences shown in Section 7.3.3. In some embodiments, a bispecific binding protein can comprise a V.sub.L sequence having 5 or fewer, 4 or fewer, 3 or fewer, or 2 or fewer mutations compared with any one of the V.sub.L sequences shown in Section 7.3.3.

    [0199] Additional post-translational modifications of a bispecific binding protein may include glycosylation. Common biantennary complexes can be composed of a core structure having two N-acetylglucosamine (GlcNAc), three mannose, and two GlcNAc residues that are β-1,2 linked to α-6 mannose and α-3 mannose to form two antennae. One or more fucose (Fuc), galactose (Gal), high mannose glycans Man-5 or Man-9, bisecting GlcNAc, and sialic acid including N-acetylneuraminic acid (NANA) or N-glycolylneuraminic acid (NGNA) residues may be attached to the core. N-linked glycoforms may include G0 (protein having a core biantennary glycosylation structure), G0F (fucosylated G0), G0F GlcNAc, G1 (protein having a core glycosylation structure with one galactose residue), G1F (fucosylated G1), G2 (protein having a core glycosylation structure with two galactose residues), and/or G2F (fucosylated G2).

    7.4. Nucleic Acids and Expression Systems

    [0200] The present disclosure encompasses nucleic acid molecules encoding immunoglobulin light and heavy chain genes for bispecific binding proteins, polypeptide fragment or component thereof, vectors comprising such nucleic acids, and host cells capable of producing the bispecific binding proteins of the disclosure.

    [0201] A bispecific binding protein of the disclosure can be prepared by recombinant expression of immunoglobulin light and heavy chain genes in a host cell. To express a binding protein recombinantly, a host cell is transfected with one or more recombinant expression vectors carrying DNA fragments encoding the immunoglobulin light and/or heavy chains of the binding protein such that the light and/or heavy chains are expressed in the host cell and, optionally, secreted into the medium in which the host cells are cultured, from which medium the binding proteins can be recovered. Standard recombinant DNA methodologies are used to obtain binding protein heavy and/or light chain genes, incorporate these genes into recombinant expression vectors and introduce the vectors into host cells, such as those described in Molecular Cloning; A Laboratory Manual, Second Edition (Sambrook, Fritsch and Maniatis (eds), Cold Spring Harbor, N. Y., 1989), Current Protocols in Molecular Biology (Ausubel, F. M. et al., eds., Greene Publishing Associates, 1989) and in U.S. Pat. No. 4,816,397.

    [0202] To generate nucleic acids encoding such bispecific binding proteins, DNA fragments encoding the light and heavy chain variable regions are first obtained. These DNAs can be obtained by amplification and modification of germline DNA or cDNA encoding light and heavy chain variable sequences, for example using the polymerase chain reaction (PCR). Germline DNA sequences for human heavy and light chain variable region genes are known in the art (See, e.g., the “VBASE” human germline sequence database; see also Kabat, E. A. et al., 1991, Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Tomlinson et al., 1992, J. Mol. Biol. 22T: 116-198; and Cox et al., 1994, Eur. J. Immunol. 24:827-836; the contents of each of which are incorporated herein by reference).

    [0203] Once DNA fragments encoding bispecific binding protein-related V.sub.H and V.sub.L segments are obtained, these DNA fragments can be further manipulated by standard recombinant DNA techniques, for example to convert the variable region genes to full-length binding protein chain genes, to Fab fragment genes or to a scFv gene. In these manipulations, a V.sub.L- or V.sub.H-encoding DNA fragment is operatively linked to another DNA fragment encoding another protein, such as a binding protein constant region or a flexible linker. The term “operatively linked,” as used in this context, is intended to mean that the two DNA fragments are joined such that the amino acid sequences encoded by the two DNA fragments remain in-frame.

    [0204] The isolated DNA encoding the V.sub.H region can be converted to a full-length heavy chain gene by operatively linking the V.sub.H-encoding DNA to another DNA molecule encoding heavy chain constant regions (CH1, CH2, CH3, and, optionally, CH4). The sequences of human heavy chain constant region genes are known in the art (See, e.g., Kabat, E. A., et al., 1991, Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification. The heavy chain constant region can be an IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, IgA, IgE, IgM or IgD constant region, but in certain embodiments is an IgG.sub.1, IgG.sub.2, or IgG.sub.4 constant region. For a Fab fragment heavy chain gene, the V.sub.H-encoding DNA can be operatively linked to another DNA molecule encoding only the heavy chain CH1 constant region.

    [0205] The isolated DNA encoding the V.sub.L region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the V.sub.L-encoding DNA to another DNA molecule encoding the light chain constant region, CL. The sequences of human light chain constant region genes are known in the art (See, e.g., Kabat, et al., 1991, Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification. The light chain constant region can be a kappa or lambda constant region, but in certain embodiments is a kappa constant region. To create a scFv gene, the V.sub.H- and V.sub.L-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gly.sub.4-Ser).sub.3 (SEQ ID NO:301), such that the V.sub.H and V.sub.L sequences can be expressed as a contiguous single-chain protein, with the V.sub.L and V.sub.H regions joined by the flexible linker (See, e.g., Bird et al., 1988, Science 242:423-426; Huston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; McCafferty et al., 1990, Nature 348:552-554).

    [0206] To express the bispecific binding protein of the disclosure, DNAs encoding partial or full-length light and heavy chains, obtained as described above, are inserted into expression vectors such that the genes are operatively linked to transcriptional and translational control sequences. In this context, the term “operatively linked” is intended to mean that a binding protein gene is ligated into a vector such that transcriptional and translational control sequences within the vector serve their intended function of regulating the transcription and translation of the binding protein gene. The expression vector and expression control sequences are chosen to be compatible with the expression host cell used. The binding protein light chain gene, if present, and the binding protein heavy chain gene can be inserted into separate vectors or, more typically, both genes are inserted into the same expression vector.

    [0207] The bispecific binding protein genes are inserted into the expression vector by standard methods (e.g., ligation of complementary restriction sites on the binding protein gene fragment and vector, or blunt end ligation if no restriction sites are present). Prior to insertion of the bispecific binding protein-related light or heavy chain sequences, the expression vector can already carry binding protein constant region sequences. For example, one approach to converting the bispecific binding protein-related V.sub.H and V.sub.L sequences to full-length binding protein genes is to insert them into expression vectors already encoding heavy chain constant and light chain constant regions, respectively, such that the V.sub.H segment is operatively linked to the CH segment(s) within the vector and the V.sub.L segment is operatively linked to the CL segment within the vector. Additionally or alternatively, the recombinant expression vector can encode a signal peptide that facilitates secretion of the binding protein chain from a host cell. The binding protein chain gene can be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the binding protein chain gene. The signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide (i.e., a signal peptide from a non-immunoglobulin protein).

    [0208] In addition to the binding protein chain genes, the recombinant expression vectors of the disclosure carry regulatory sequences that control the expression of the binding protein chain genes in a host cell. The term “regulatory sequence” is intended to include promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the binding protein chain genes. Such regulatory sequences are described, for example, in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif., 1990. It will be appreciated by those skilled in the art that the design of the expression vector, including the selection of regulatory sequences may depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc. Suitable regulatory sequences for mammalian host cell expression include viral elements that direct high levels of protein expression in mammalian cells, such as promoters and/or enhancers derived from cytomegalovirus (CMV) (such as the CMV promoter/enhancer), Simian Virus 40 (SV40) (such as the SV40 promoter/enhancer), adenovirus, (e.g., the adenovirus major late promoter (AdMLP)) and polyoma. For further description of viral regulatory elements, and sequences thereof, see, e.g., U.S. Pat. No. 5,168,062 by Stinski, U.S. Pat. No. 4,510,245 by Bell et al., and U.S. Pat. No. 4,968,615 by Schaffner et al.

    [0209] In addition to the bispecific binding protein chain genes and regulatory sequences, the recombinant expression vectors of the disclosure can carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes. The selectable marker gene facilitates selection of host cells into which the vector has been introduced (See, e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and 5,179,017, all by Axel et al.). For example, typically the selectable marker gene confers resistance to drugs, such as G418, hygromycin or methotrexate, on a host cell into which the vector has been introduced. Suitable selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in DHFR.sup.− host cells with methotrexate selection/amplification) and the neo gene (for G418 selection). For expression of the light and heavy chains, the expression vector(s) encoding the heavy and light chains is transfected into a host cell by standard techniques. The various forms of the term “transfection” are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, lipofection, calcium-phosphate precipitation, DEAE-dextran transfection and the like.

    [0210] It is possible to express the bispecific binding proteins of the disclosure in either prokaryotic or eukaryotic host cells. In certain embodiments, expression of binding proteins is performed in eukaryotic cells, e.g., mammalian host cells, of optimal secretion of a properly folded and immunologically active binding protein. Exemplary mammalian host cells for expressing the recombinant binding proteins of the disclosure include Chinese Hamster Ovary (CHO cells) (including DHFR.sup.− CHO cells, described in Urlaub and Chasin, 1980, Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp, 1982, Mol. Biol. 159:601-621), NSO myeloma cells, COS cells and SP2 cells. When recombinant expression vectors encoding binding protein genes are introduced into mammalian host cells, the bispecific binding proteins are produced by culturing the host cells for a period of time sufficient to allow for expression of the bispecific binding protein in the host cells or secretion of the binding protein into the culture medium in which the host cells are grown. Binding proteins can be recovered from the culture medium using standard protein purification methods. Host cells can also be used to produce portions of intact binding proteins, such as Fab fragments or scFv molecules. It is understood that variations on the above procedure are within the scope of the present disclosure. For example, it can be desirable to transfect a host cell with DNA encoding either the light chain or the heavy chain (but not both) of a bispecific binding protein of this disclosure.

    [0211] Recombinant DNA technology can also be used to remove some or all of the DNA encoding either or both of the light and heavy chains that is not necessary for binding to the immunomodulatory protein and/or the tumor antigen. The molecules expressed from such truncated DNA molecules are also encompassed by the binding proteins of the disclosure.

    [0212] For recombinant expression of a bispecific binding protein of the disclosure, the host cell can be co-transfected with two expression vectors of the disclosure, the first vector encoding a heavy chain derived polypeptide and the second vector encoding a light chain derived polypeptide. The two vectors can contain identical selectable markers, or they can each contain a separate selectable marker. Alternatively, a single vector can be used which encodes both heavy and light chain polypeptides.

    [0213] Once a nucleic acid encoding one or more portions of a bispecific binding protein, further alterations or mutations can be introduced into the coding sequence, for example to generate nucleic acids encoding binding proteins with different CDR sequences, binding proteins with reduced affinity to the Fc receptor, or binding proteins of different subclasses.

    [0214] The bispecific binding proteins of the disclosure can also be produced by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2.sup.nd ed., 1984 The Pierce Chemical Co., Rockford, Ill.). Variant binding proteins can also be generated using a cell-free platform (See, e.g., Chu et al., Biochemia No. 2, 2001 (Roche Molecular Biologicals) and Murray et al., 2013, Current Opinion in Chemical Biology, 17:420-426).

    7.5. Purification of Bispecific Binding Proteins

    [0215] Once a polypeptide of the disclosure has been produced by recombinant expression, it can be purified by any method known in the art for purification of a protein, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for antigen after Protein A or Protein G selection, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins, or any combination of techniques thereof. Further, the polypeptides of the present disclosure or fragments thereof can be fused to heterologous polypeptide sequences described herein or otherwise known in the art to facilitate purification. The polypeptides may be purified as a monomer or as a dimer, e.g., as a bispecific binding protein comprising two polypeptides. For example, a polypeptide may be purified by a series of steps comprising clarification, Protein A chromatography, and viral inactivation.

    [0216] Once isolated, a bispecific binding protein can, if desired, be further purified, e.g., by high performance liquid chromatography (See, e.g., Fisher, Laboratory Techniques In Biochemistry And Molecular Biology (Work and Burdon, eds., Elsevier, 1980)), size-exclusion chromatography, hydrophobic interaction chromatography (e.g., with an aliphatic cross-linked agarose medium such as Butyl Sepharose High Performance (GE Healthcare Life Sciences)), hydroxyapatite chromatography (e.g., using a CaPure-HA (Tosoh Bioscience LLC) or CHT Ceramic Hydroxyapatite Type I (Bio-Rad Laboratories, Inc.) support) or gel filtration chromatography (e.g., using a Superdex™ 75 column (Pharmacia Biotech AB, Uppsala, Sweden)). A variety of chromatographic techniques known in the art, for example, flow through or bind-and-elute mode, gradient elution, can be used to purify the preparation of the bispecific binding protein. In a specific embodiment, a bispecific binding protein that binds CD40 and mesothelin is purified by hydroxyapatite chromatography, wherein the pH is maintained at 6.7±0.1.

    [0217] A bispecific binding protein of the disclosure may also be purified through one or more filtrations, for example, comprising activated carbon filtration, membrane filtration (e.g., sterile filtration through a porous hydrophilic polymer such as polyethersulfone, Q membrane filtration, or S membrane filtration). For instance, activated carbon filtration uses the large surface area or pore sizes within activated carbon to adsorb impurities from the flow stream. Q membrane filtration uses an anion exchange membrane bearing quaternary ammonium ions on its surface in order to retain highly negatively charged species. In contrast, S membrane filtration uses a cation exchange membrane bearing sulfate ions to retain highly positively charged impurities.

    [0218] Standard final finishing techniques such as nanofiltration and diafiltration, or any combination in series of any final finishing techniques, may be used for additional purification to afford a purified bispecific binding protein.

    7.6. Pharmaceutical Compositions

    [0219] The bispecific binding proteins described herein may be in the form of compositions comprising the protein and one or more carriers, excipients and/or diluents. The compositions may be formulated for specific uses, such as for veterinary uses or pharmaceutical uses in humans. The form of the composition (e.g., dry powder, liquid formulation, etc.) and the excipients, diluents and/or carriers used will depend upon the intended uses of the binding protein and, for therapeutic uses, the mode of administration.

    [0220] For therapeutic uses, the compositions may be supplied as part of a sterile, pharmaceutical composition that includes a pharmaceutically acceptable carrier. This composition can be in any suitable form (depending upon the desired method of administering it to a subject, e.g., a human subject, i.e., patient). The pharmaceutical composition can be administered to a subject by a variety of routes such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intratumorally, intrathecally, topically or locally. The most suitable route for administration in any given case will depend on the particular bispecific binding protein, the subject, and the nature and severity of the disease and the physical condition of the subject. Typically, the pharmaceutical composition will be administered intravenously or subcutaneously.

    [0221] Pharmaceutical compositions can be conveniently presented in unit dosage forms containing a predetermined amount of a bispecific binding protein described herein per dose. The quantity of binding protein included in a unit dose will depend on the disease being treated, as well as other factors as are well known in the art. Such unit dosages may be in the form of a lyophilized dry powder containing an amount of binding protein suitable for a single administration, or in the form of a liquid. Dry powder unit dosage forms may be packaged in a kit with a syringe, a suitable quantity of diluent and/or other components useful for administration. Unit dosages in liquid form may be conveniently supplied in the form of a syringe pre-filled with a quantity of binding protein suitable for a single administration.

    [0222] The pharmaceutical compositions may also be supplied in bulk form containing quantities of bispecific binding protein suitable for multiple administrations.

    [0223] Pharmaceutical compositions may be prepared for storage as lyophilized formulations or aqueous solutions by mixing a bispecific binding protein having the desired degree of purity with optional pharmaceutically-acceptable carriers, excipients or stabilizers typically employed in the art (all of which are referred to herein as “carriers”), i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives. See, Remington's Pharmaceutical Sciences, 16th edition (Osol, ed. 1980). Such additives should be nontoxic to the recipients at the dosages and concentrations employed.

    7.7. Methods of Use

    [0224] 7.7.1. Therapeutic Benefit

    [0225] As discussed previously, for a variety of solid tumors, one or more tumor antigens are expressed on the surface of the tumor cell, but not expressed or minimally expressed on the surface of non-cancerous cells. Data provided herein demonstrate that bispecific binding proteins described herein that agonize an immunomodulatory protein and bind a cell-surface tumor antigen exert potent anti-tumor activity against these solid tumors in vivo. Accordingly, the bispecific binding proteins and/or pharmaceutical compositions comprising the bispecific binding proteins may be used therapeutically to treat solid tumors.

    [0226] Generally, the methods involve administering to a human patient having a solid tumor an effective amount of a bispecific binding protein that agonizes an immunomodulatory protein and binds a cell-surface tumor antigen to provide therapeutic benefit. Solid tumors that may be treated with the binding proteins include, but are not limited to, adrenal cancer, bladder cancer, bone cancer, brain cancer (e.g., glioma), breast cancer, cervical cancer, colorectal cancer, endometrial cancer, esophageal cancer, eye cancer, gastric cancer, head and neck cancer, kidney cancer, liver cancer, lung cancer (e.g., non-small cell lung cancer such as non-squamous non-small cell lung cancer, lung adenocarcinoma, mesothelioma), lymphoma (e.g., B cell lymphoma), melanoma (e.g., advanced malignant melanoma), oral cancer, ovarian cancer (e.g., platinum-resistant ovarian cancer, fallopian tube cancer, primary peritoneal cancer), pancreatic cancer, penile cancer, prostate cancer, skin cancer, testicular cancer, thyroid cancer, uterine cancer, and vaginal cancer. In some embodiments, the solid tumor is selected from brain cancer, breast cancer, gastric cancer, lung cancer, melanoma, ovarian cancer, pancreatic cancer and prostate cancer. The cancers may be comprised of tumor cells that express a tumor antigen, cancers comprised of tumor cells that do not express a tumor antigen, or cancers comprised of tumor cells, some of which express a tumor antigen and some of which do not. In some embodiments, the solid tumor is an advanced solid tumor that has progressed on a standard therapy known to provide clinical benefit (e.g., a platinum-based therapy) or the patient cannot otherwise be treated with a standard therapy (e.g., the patient is allergic to an active ingredient in a standard therapy). In certain embodiments, a bispecific protein binding mesothelin is used to treat mesothelin-positive advanced solid tumors that have progressed on standard therapy known to provide clinical benefit or in a patient who cannot otherwise be treated with a standard therapy. In certain embodiments, a bispecific protein binding mesothelin is used to treat lung adenocarcinoma, mesothelioma, pancreatic cancer or ovarian cancer. In certain embodiments, a bispecific protein binding mesothelin is used to treat non-squamous non-small cell lung cancer, mesothelioma, pancreatic cancer or ovarian cancer. In certain embodiments, a bispecific protein binding mesothelin is used to treat ovarian cancer with locally advanced or metastatic disease that has progressed on standard therapy known to provide clinical benefit or in a patient who cannot otherwise be treated with a standard therapy. In certain embodiments, a bispecific protein binding mesothelin is used to treat non-small cell lung cancer with locally advanced or metastatic disease that has progressed on standard therapy known to provide clinical benefit or in a patient who cannot otherwise be treated with a standard therapy. In certain embodiments, a bispecific protein binding mesothelin is used to treat non-squamous non-small cell lung cancer with locally advanced or metastatic disease that has progressed after receiving a platinum-based therapy (or an epidermal growth factor receptor (EGFR) inhibitor, a tyrosine kinase (TK) inhibitor, or an anaplastic lymphoma kinase (ALK) inhibitor for tumors containing EGFR-activating or TK-activating mutations, or ALK rearrangement, respectively). In certain embodiments, a bispecific protein binding mesothelin is used to treat non-squamous non-small cell lung cancer with locally advanced or metastatic disease that has progressed after receiving immunotherapy, such as an anti-PD-1 or anti-PD-L1 antagonist monoclonal antibody as a single agent, in combination with chemotherapy, or in combination with an anti-CTLA-4 antagonist antibody. In certain embodiments, a bispecific protein binding EGFR is used to treat colorectal cancer, head and neck cancer, non-small cell lung cancer, or glioblastoma. In certain embodiments, a bispecific protein binding PSMA is used to treat prostate cancer. In certain embodiments, a bispecific protein binding B7-H4 is used to treat breast cancer or ovarian cancer.

    [0227] The cancer may be newly diagnosed and naïve to treatment, or may be resistant, relapsed, refractory, or relapsed and refractory, or a metastatic form of a solid tumor. In vivo data in mouse xenograft models (FIGS. 17A-17B) as well as in a murine syngeneic tumor model (FIG. 18) show that the bispecific binding proteins exhibit a significant antitumor effect. Additionally, biochemical biomarkers in FIGS. 19 and 20 show a reduced liver toxicity and lower cytokine release on administration of a bispecific binding protein as compared to the same dose of known murine antibody 1C10.

    [0228] As discussed above, the presently disclosed bispecific binding proteins activate an immunological response. Accordingly, patients having altered immune systems may be excluded from treatment. In some embodiments, a patient is excluded after meeting one or more of the following criteria: (1) Active or prior documented autoimmune disease (including, but not limited to, inflammatory bowel disease, celiac disease, Wegener syndrome) within the past 2 years. (Subjects with childhood atopy or asthma, vitiligo, alopecia, Hashimoto syndrome, Grave's disease, or psoriasis not requiring systemic treatment (within the past 2 years) are not excluded); (2) History of primary immunodeficiency, bone marrow transplantation, chronic lymphocytic leukemia, solid organ transplantation, or previous clinical diagnosis of tuberculosis; (3) History of a coagulopathy or a platelet disorder; (4) Confirmed positive test results for human immunodeficiency virus (HIV), or subjects with chronic or active hepatitis B or C. (Subjects who have a history of hepatitis B or C who have documented cures after anti-viral therapy may be enrolled); (5) Prior grade ≧3 immune-mediated neurotoxicity or pneumonitis while receiving immunotherapy (including but not limited to agents directed against CTLA-4, PD-L1, or PD-1), or any other prior grade ≧3 immune-mediated adverse event while receiving immunotherapy that has not resolved or become asymptomatic within 3 months; (6) Receipt of live, attenuated vaccine within 28 days prior to the first dose of the bispecific binding protein.

    [0229] A bispecific binding protein of the disclosure may be administered alone (monotherapy) or adjunctive to, or with, other anti-cancer therapies and/or targeted or non-targeted anti-cancer agents. When administered as bispecific binding protein monotherapy, one or more bispecific binding proteins may be used. Whether administered as monotherapy or adjunctive to, or with, other therapies or agents, an amount of bispecific binding protein is administered such that the overall treatment regimen provides therapeutic benefit.

    [0230] By therapeutic benefit is meant that the use of a bispecific binding protein to treat cancer in a patient results in any demonstrated clinical benefit compared with no therapy (when appropriate) or to a known standard of care. Clinical benefit can be assessed by any method known to one of ordinary skill in the art. In one embodiment, clinical benefit is assessed based on objective response rate (ORR) (determined using RECIST version 1.1), duration of response (DOR), progression-free survival (PFS), and/or overall survival (OS). In some embodiments, a complete response indicates therapeutic benefit. In some embodiments, a partial response indicates therapeutic benefit. In some embodiments, stable disease indicates therapeutic benefit. In some embodiments, an increase in overall survival indicates therapeutic benefit. In some embodiments, therapeutic benefit may constitute an improvement in time to disease progression and/or an improvement in symptoms or quality of life. In other embodiments, therapeutic benefit may not translate to an increased period of disease control, but rather a markedly reduced symptom burden resulting in improved quality of life. As will be apparent to those of skill in the art, a therapeutic benefit may be observed using the bispecific binding proteins alone (monotherapy) or adjunctive to, or with, other anti-cancer therapies and/or targeted or non-targeted anti-cancer agents.

    [0231] Typically, therapeutic benefit is assessed using standard clinical tests designed to measure the response to a new treatment for cancer. To assess the therapeutic benefits of the bispecific binding proteins described herein one or a combination of the following tests can be used: (1) the Response Evaluation Criteria In Solid Tumors (RECIST) version 1.1, (2) immune-related RECIST (irRECIST), (3) the Eastern Cooperative Oncology Group (ECOG) Performance Status, (4) immune-related response criteria (irRC), (5) disease evaluable by assessment of tumor antigens, (6) validated patient reported outcome scales, and/or (7) Kaplan-Meier estimates for overall survival and progression free survival.

    [0232] Assessment of the change in tumor burden is an important feature of the clinical evaluation of cancer therapeutics. Both tumor shrinkage (objective response) and time to the development of disease progression are important endpoints in cancer clinical trials. Standardized response criteria, known as RECIST (Response Evaluation Criteria in Solid Tumors), were published in 2000. An update (RECIST 1.1) was released in 2009. RECIST criteria are typically used in clinical trials where objective response is the primary study endpoint, as well as in trials where assessment of stable disease, tumor progression or time to progression analyses are undertaken because these outcome measures are based on an assessment of anatomical tumor burden and its change over the course of the trial. TABLE 3 provides the definitions of the response criteria used to determine objective tumor response to a study drug, such as the bispecific binding proteins described herein.

    TABLE-US-00028 TABLE 3 Response Criteria Complete Disappearance of all target lesions. Response (CR) Any pathological lymph nodes (whether target or non-target) must have reduction in short axis to <10 mm. Partial Response At least a 30% decrease in the sum of (PR) diameters of target lesions, taking as reference the baseline sum diameters. Progressive At least a 20% increase in the sum of Disease (PD) diameters of target lesions, taking as reference the smallest sum on study (this includes the baseline sum if that is the smallest on study). In addition to the relative increase of 20%, the sum must also demonstrate an absolute increase of at least 5 mm. (Note: the appearance of one or more new lesions is also considered progression). Stable Disease Neither sufficient shrinkage to qualify (SD) for PR nor sufficient increase to qualify for PD, taking as reference the smallest sum diameters while on study.

    [0233] Secondary outcome measures that can be used to determine the therapeutic benefit of the bispecific binding proteins described herein include, Objective Response Rate (ORR), Progression Free Survival (PFS), Overall Survival (OS), Duration of Overall Response (DOR), and Depth of Response (DpR). ORR is defined as the proportion of the participants who achieve a complete response (CR) or partial response (PR). PFS is defined as the time from the first dose date of a bispecific binding protein to either disease progression or death, whichever occurs first. OS is defined as the length of time from either the date of diagnosis or the start of treatment for a disease, such as cancer, that patients diagnosed with the disease are still alive. DOR is defined as the time from the participant's initial CR or PR to the time of disease progression. DpR is defined as the percentage of tumor shrinkage observed at the maximal response point compared to baseline tumor load. Clinical endpoints for both ORR and PFS can be determined based on RECIST 1.1 criteria described above.

    [0234] Additional criteria that may be used for clinical evaluation specific to cancer patients undergoing immune therapy treatment include the standardized immune-related RECIST (irRECIST) criteria. See, e.g., Nishino, M. et al. Eur. J. Radiol., 84(7), pages 1259-1268 (2015 July). These guidelines modified the RECIST 1.1 criteria above with consideration of potential immunomodulatory effects. TABLE 4 provides the definitions of the response criteria used to determine objective tumor response to an immunomodulatory drug, such as the bispecific binding proteins described herein.

    TABLE-US-00029 TABLE 4 Response Criteria Complete Response Complete disappearance of all measurable (irCR) and non-measurable lesions. Lymph nodes must decrease to <10 mm in short axis. Partial Response Decrease of ≧30% in total measured (irPR) tumor burden relative to baseline, non-target lesions are irNN, and no unequivocal progression of new non- measurable lesions Progressive Disease At least a 20% increase and at least (irPD) 5 mm absolute increase in TMTB compared to nadir, or irPD for non-target or new non-measurable lesions. Confirmation of progression is recommended at least 4 weeks after the first irPD assessment. Non-irCR or No target disease was identified at baseline non-irPD (irNN) and at follow-up the patient fails to meet criteria for irCR or irPD Stable Disease Neither sufficient shrinkage to qualify for (irSD) irPR nor sufficient increase to qualify for irPD, taking as reference the smallest sum diameters while on study. irNE Used in exceptional cases where insufficient data exists.

    [0235] The ECOG Scale of Performance Status shown in TABLE 5 is used to describe a patient's level of functioning in terms of their ability to care for themselves, daily activity, and physical ability. The scale was developed by the Eastern Cooperative Oncology Group (ECOG), now part of the ECOG-ACRIN Cancer Research Group, and published in 1982.

    TABLE-US-00030 TABLE 5 Grade ECOG Performance Status 0 Fully active, able to carry on all pre-disease performance without restriction 1 Restricted in physically strenuous activity but ambulatory and able to carry out work of a light or sedentary nature, e.g., light house work, office work 2 Ambulatory and capable of all selfcare but unable to carry out any work activities; up and about more than 50% of waking hours 3 Capable of only limited selfcare; confined to bed or chair more than 50% of waking hours 4 Completely disabled; cannot carry on any selfcare; totally confined to bed or chair 5 Dead

    [0236] Another set of criteria that can be used to characterize fully and to determine response to immunotherapeutic agents, such as antibody-based cancer therapies, is the immune-related response criteria (irRC), which was developed for measurement of solid tumors in 2009, and updated in 2013. See, e.g., Wolchok, et al. Clin. Cancer Res. 2009; 15(23): 7412-7420 and Nishino, et al. Clin. Cancer Res. 2013; 19(14): 3936-3943. The updated irRC criteria are typically used to assess the effect of an immunotherapeutic agent, such as a bispecific binding protein described herein, on tumor burden, and defines response according to TABLE 6.

    TABLE-US-00031 TABLE 6 Response Criteria Complete Disappearance of all target lesions in two Response (CR) consecutive observations not less than 4 weeks apart Partial At least a 30% decrease in the sum of the Response (PR) longest diameters of target lesions, taking as reference the baseline sum diameters. Progressive At least a 20% increase in the sum of Disease (PD) diameters of target lesions, taking as reference the smallest sum on study (this includes the baseline sum if that is the smallest on study). (Note: the appearance of one or more new lesions is not considered progression. The measurement of new lesions is included in the sum of the measurements). Stable Disease Neither sufficient shrinkage to qualify for (SD) PR nor sufficient increase to qualify for PD, taking as reference the smallest sum diameters while on study.

    [0237] One exemplary therapeutic benefit resulting from the use of bispecific binding proteins described herein to treat solid tumors, whether administered as monotherapy or adjunctive to, or with, other therapies or agents, is a complete response. Another exemplary therapeutic benefit resulting from the use of bispecific binding proteins described herein to treat solid tumors, whether administered as monotherapy or adjunctive to, or with, other therapies or agents, is a partial response.

    [0238] Validated patient reported outcome scales can also be used to denote response provided by each patient through a specific reporting system. Rather than being disease focused, such outcome scales are concerned with retained function while managing a chronic condition. One non-limiting example of a validated patient reported outcome scale is PROMIS® (Patient Reported Outcomes Measurement Information System) from the United States National Institutes of Health. For example, PROMIS® Physical Function Instrument for adult cancer patients can evaluate self-reported capabilities for the functioning of upper extremities (e.g., dexterity), lower extremities (e.g., walking or mobility), and central regions (e.g., neck, back mobility), and includes routine daily activities, such as running errands.

    [0239] Kaplan-Meier curves (Kaplan and Meier, J. Am. Stat. Assoc. 1958; 53(282): 457-481) can also be used to estimate overall survival and progression free survival for cancer patients undergoing bispecific binding protein therapy in comparison to standard of care.

    [0240] 7.7.2. Adjunctive Therapies

    [0241] The bispecific binding proteins may be used adjunctive to, or with, other agents or treatments having anti-cancer properties. When used adjunctively, the bispecific binding protein and other agent(s) may be formulated together in a single, combination pharmaceutical formulation, or may be formulated and administered separately, either on a single coordinated dosing regimen or on different dosing regimens. Agents administered adjunctive to or with the bispecific binding proteins will typically have complementary activities to the bispecific binding proteins such that the binding proteins and other agents do not adversely affect each other.

    [0242] Agents that may be administered adjunctive to or with a bispecific binding protein include, but are not limited to, alkylating agents, angiogenesis inhibitors, antibodies, antimetabolites, antimitotics, antiproliferatives, antivirals, aurora kinase inhibitors, apoptosis promoters (for example, Bcl-2 family inhibitors), activators of death receptor pathway, Bcr-Abl kinase inhibitors, BiTE (Bi-Specific T cell Engager) antibodies, antibody drug conjugates, biologic response modifiers, cyclin-dependent kinase inhibitors, cell cycle inhibitors, cyclooxygenase-2 inhibitors, DVDs, leukemia viral oncogene homolog (ErbB2) receptor inhibitors, growth factor inhibitors, heat shock protein (HSP)-90 inhibitors, histone deacetylase (HDAC) inhibitors, hormonal therapies, immunologicals, inhibitors of inhibitors of apoptosis proteins (IAPs), intercalating antibiotics, kinase inhibitors, kinesin inhibitors, Jak2 inhibitors, mammalian target of rapamycin (mTor) inhibitors, microRNAs, mitogen-activated extracellular signal-regulated kinase inhibitors, non-steroidal anti-inflammatory drugs (NSAIDs), poly ADP (adenosine diphosphate)-ribose polymerase (PARP) inhibitors, platinum chemotherapeutics, Bruton's tyrosine kinase (BTK) inhibitors (e.g., ibrutinib, acalabrutinib), polo-like kinase (Plk) inhibitors, phosphoinositide-3 kinase (PI3K) inhibitors, proteasome inhibitors, purine analogs, pyrimidine analogs, receptor tyrosine kinase inhibitors, retinoids/deltoids plant alkaloids, small inhibitory ribonucleic acids (siRNAs), topoisomerase inhibitors, ubiquitin ligase inhibitors, as well as combinations of one or more of these agents.

    [0243] Examples of immunologicals include, but are not limited to, interferons, immune checkpoint inhibitors, and other immune-enhancing agents. Interferons include interferon alpha, interferon alpha-2a, interferon alpha-2b, interferon beta, interferon gamma-1a, ACTIMMUNE® (interferon gamma-1b) or interferon gamma-n1, combinations thereof and the like. Immune check point inhibitors include antibodies that target PD-1 (e.g., pembrolizumab and nivolumab), PD-L1 (e.g., durvalumab, atezolizumab, avelumab, MEDI4736, MSB0010718C and MPDL3280A), and CTLA4 (cytotoxic lymphocyte antigen 4; e.g., ipilimumab, tremelimumab). Immune-enhancing agents include anti-OX40 agonist antibodies that activate T cells.

    [0244] A bispecific binding protein may also be used to enhance the efficacy of radiation therapy. Examples of radiation therapy include external beam radiation therapy, internal radiation therapy (i.e., brachytherapy) and systemic radiation therapy.

    7.8. Dosages and Administration Regimens

    [0245] The amount of bispecific binding protein administered will depend upon a variety of factors, including but not limited to, the particular type of solid tumor treated, the stage of the solid tumor being treated, the mode of administration, the frequency of administration, the desired therapeutic benefit, and other parameters such as the age, weight and other characteristics of the patient, etc. Determination of dosages effective to provide therapeutic benefit for specific modes and frequency of administration is within the capabilities of those skilled in the art.

    [0246] Dosages effective to provide therapeutic benefit may be estimated initially from in vivo animal models or clinical trials. Suitable animal models for a wide variety of diseases are known in the art.

    [0247] The bispecific binding proteins disclosed herein may be administered by any route appropriate to the condition to be treated. A bispecific binding protein will typically be administered parenterally, i.e., infusion, subcutaneous, intramuscular, intravenous (IV), intradermal, intrathecal, bolus, intratumor injection or epidural ((Shire et al., 2004, J. Pharm. Sciences 93(6): 1390-1402)). In one embodiment, a bispecific binding protein is provided as a lyophilized powder in a vial. Prior to administration, the lyophilized powder is reconstituted with sterile water for injection (SWFI) or other suitable medium to provide a solution containing the bispecific binding protein. The resulting reconstituted solution is further diluted with saline or other suitable medium and administered via an IV infusion twice every 7 days, once every 7 days, once every 14 days, once every 21 days, once every 28 days, once every 35 days, once every 42 days, once every 49 days, or once every 56 days. In some embodiments, for the first cycle, the infusion occurs over 90 minutes. In some embodiments, subsequent infusions are over 60 minutes.

    [0248] In some embodiments, an anti-mesothelin bispecific binding protein that agonizes CD40 comprises two polypeptides, each comprising an amino acid sequence of any one of SEQ ID NOS: 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 419, 420, and 421.

    [0249] In one exemplary embodiment, an anti-mesothelin bispecific binding protein that agonizes CD40 is administered once every 28 days at 0.005 mg/kg, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.08 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1.0 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, 2.6 mg/kg, 2.8 mg/kg, 3.0 mg/kg, 3.2 mg/kg, 3.4 mg/kg, 3.6 mg/kg, 3.8 mg/kg, 4.0 mg/kg, 4.4 mg/kg, 4.8 mg/kg, or 5.0 mg/kg.

    [0250] In another exemplary embodiment, an anti-mesothelin bispecific binding protein that agonizes CD40 is administered once every 21 days at 0.005 mg/kg, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.08 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1.0 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, 2.6 mg/kg, 2.8 mg/kg, 3.0 mg/kg, 3.2 mg/kg, 3.4 mg/kg, 3.6 mg/kg, 3.8 mg/kg, 4.0 mg/kg, 4.4 mg/kg, 4.8 mg/kg, or 5.0 mg/kg.

    [0251] In yet another exemplary embodiment, an anti-mesothelin bispecific binding protein that agonizes CD40 is administered once every 14 days at 0.005 mg/kg, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.08 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1.0 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, 2.6 mg/kg, 2.8 mg/kg, 3.0 mg/kg, 3.2 mg/kg, 3.4 mg/kg, 3.6 mg/kg, 3.8 mg/kg, 4.0 mg/kg, 4.4 mg/kg, 4.8 mg/kg, or 5.0 mg/kg.

    [0252] In yet another exemplary embodiment, an anti-mesothelin bispecific binding protein that agonizes CD40 is administered once every 7 days at 0.005 mg/kg, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.08 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1.0 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, 2.6 mg/kg, 2.8 mg/kg, 3.0 mg/kg, 3.2 mg/kg, 3.4 mg/kg, 3.6 mg/kg, 3.8 mg/kg, 4.0 mg/kg, 4.4 mg/kg, 4.8 mg/kg, or 5.0 mg/kg.

    [0253] When administered adjunctive to, or with, other agents, such as other chemotherapeutic agents, the bispecific binding proteins may be administered on the same schedule as the other agent(s), or on a different schedule. When administered on the same schedule, the bispecific binding protein may be administered before, after, or concurrently with the other agent. In some embodiments where a bispecific binding protein is administered adjunctive to, or with, standards of care, the bispecific binding protein may be initiated prior to commencement of the standard therapy, for example a day, several days, a week, several weeks, a month, or even several months before commencement of standard of care therapy.

    [0254] In one exemplary embodiment, a bispecific binding protein is used adjunctive to nivolumab (OPDIVO®) to treat non-small cell lung cancer. In some embodiments, the bispecific binding protein binds CD40 and mesothelin. In specific embodiments, the bispecific binding protein is any one of SEQ ID NOS: 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 419, 420, and 421, e.g., a bispecific binding protein comprising two polypeptides having the same amino acid sequence chosen from the listed SEQ ID NOS. The bispecific binding protein is administered via IV infusion once every 14 days at 0.005 mg/kg, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.08 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1.0 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, 2.6 mg/kg, 2.8 mg/kg, 3.0 mg/kg, 3.2 mg/kg, 3.4 mg/kg, 3.6 mg/kg, 3.8 mg/kg, 4.0 mg/kg, 4.4 mg/kg, 4.8 mg/kg, or 5.0 mg/kg. Nivolumab is administered by intravenous infusion at a dose of 3 mg/kg over 60 minutes once every two weeks. The adjunctive bispecific binding protein/nivolumab therapy is continued until disease progression or no longer tolerated by the patient.

    [0255] In another exemplary embodiment, a bispecific binding protein is used adjunctive to nivolumab (OPDIVO®) to treat non-small cell lung cancer. In some embodiments, the bispecific binding protein binds CD40 and mesothelin. In specific embodiments, the bispecific binding protein is any one of SEQ ID NOS: 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 419, 420, and 421, e.g., a bispecific binding protein comprising two polypeptides having the same amino acid sequence chosen from the listed SEQ ID NOS. The bispecific binding protein is administered via IV infusion once every 21 days at 0.005 mg/kg, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.08 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1.0 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, 2.6 mg/kg, 2.8 mg/kg, 3.0 mg/kg, 3.2 mg/kg, 3.4 mg/kg, 3.6 mg/kg, 3.8 mg/kg, 4.0 mg/kg, 4.4 mg/kg, 4.8 mg/kg, or 5.0 mg/kg. Nivolumab is administered by intravenous infusion at a dose of 3 mg/kg over 60 minutes once every two weeks. The adjunctive bispecific binding protein/nivolumab therapy is continued until disease progression or no longer tolerated by the patient.

    [0256] In another exemplary embodiment, a bispecific binding protein is used adjunctive to nivolumab (OPDIVO®) to treat non-small cell lung cancer. In some embodiments, the bispecific binding protein binds CD40 and mesothelin. In specific embodiments, the bispecific binding protein is any one of SEQ ID NOS: 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 419, 420, and 421, e.g., a bispecific binding protein comprising two polypeptides having the same amino acid sequence chosen from the listed SEQ ID NOS. The bispecific binding protein is administered via IV infusion once every 28 days at 0.005 mg/kg, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.08 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1.0 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, 2.6 mg/kg, 2.8 mg/kg, 3.0 mg/kg, 3.2 mg/kg, 3.4 mg/kg, 3.6 mg/kg, 3.8 mg/kg, 4.0 mg/kg, 4.4 mg/kg, 4.8 mg/kg, or 5.0 mg/kg. Nivolumab is administered by intravenous infusion at a dose of 3 mg/kg over 60 minutes once every two weeks. The adjunctive bispecific binding protein/nivolumab therapy is continued until disease progression or no longer tolerated by the patient.

    [0257] In another exemplary embodiment, a bispecific binding protein is used adjunctive to pembrolizumab (Keytruda®) to treat non-small cell lung cancer. In some embodiments, the bispecific binding protein binds CD40 and mesothelin. In specific embodiments, the bispecific binding protein is any one of SEQ ID NOS: 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 419, 420, and 421, e.g., a bispecific binding protein comprising two polypeptides having the same amino acid sequence chosen from the listed SEQ ID NOS. The bispecific binding protein is administered via IV infusion once every 14 days at 0.005 mg/kg, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.08 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1.0 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, 2.6 mg/kg, 2.8 mg/kg, 3.0 mg/kg, 3.2 mg/kg, 3.4 mg/kg, 3.6 mg/kg, 3.8 mg/kg, 4.0 mg/kg, 4.4 mg/kg, 4.8 mg/kg, or 5.0 mg/kg. Pembrolizumab is administered by intravenous infusion at a dose of 2 mg/kg over 30 minutes once every three weeks. The adjunctive bispecific binding protein/pembrolizumab therapy is continued until disease progression or no longer tolerated by the patient.

    [0258] In another exemplary embodiment, a bispecific binding protein is used adjunctive to pembrolizumab (Keytruda®) to treat non-small cell lung cancer. In some embodiments, the bispecific binding protein binds CD40 and mesothelin. In specific embodiments, the bispecific binding protein is any one of SEQ ID NOS: 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 419, 420, and 421, e.g., a bispecific binding protein comprising two polypeptides having the same amino acid sequence chosen from the listed SEQ ID NOS. The bispecific binding protein is administered via IV infusion once every 21 days at 0.005 mg/kg, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.08 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1.0 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, 2.6 mg/kg, 2.8 mg/kg, 3.0 mg/kg, 3.2 mg/kg, 3.4 mg/kg, 3.6 mg/kg, 3.8 mg/kg, 4.0 mg/kg, 4.4 mg/kg, 4.8 mg/kg, or 5.0 mg/kg. Pembrolizumab is administered by intravenous infusion at a dose of 2 mg/kg over 30 minutes once every three weeks. The adjunctive bispecific binding protein/pembrolizumab therapy is continued until disease progression or no longer tolerated by the patient.

    [0259] In another exemplary embodiment, a bispecific binding protein is used adjunctive to pembrolizumab (Keytruda®) to treat non-small cell lung cancer. In some embodiments, the bispecific binding protein binds CD40 and mesothelin. In specific embodiments, the bispecific binding protein is any one of SEQ ID NOS: 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 419, 420, and 421, e.g., a bispecific binding protein comprising two polypeptides having the same amino acid sequence chosen from the listed SEQ ID NOS. The bispecific binding protein is administered via IV infusion once every 28 days at 0.005 mg/kg, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.08 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1.0 mg/kg, 1.1 mg/kg, 1.2 mg/kg, 1.3 mg/kg, 1.4 mg/kg, 1.5 mg/kg, 1.6 mg/kg, 1.7 mg/kg, 1.8 mg/kg, 1.9 mg/kg, 2.0 mg/kg, 2.2 mg/kg, 2.4 mg/kg, 2.6 mg/kg, 2.8 mg/kg, 3.0 mg/kg, 3.2 mg/kg, 3.4 mg/kg, 3.6 mg/kg, 3.8 mg/kg, 4.0 mg/kg, 4.4 mg/kg, 4.8 mg/kg, or 5.0 mg/kg. Pembrolizumab is administered by intravenous infusion at a dose of 2 mg/kg over 30 minutes once every three weeks. The adjunctive bispecific binding protein/pembrolizumab therapy is continued until disease progression or no longer tolerated by the patient.

    [0260] As will be appreciated by those of skill in the art, the recommended dosages for the various agents described above may need to be adjusted to optimize patient response and maximize therapeutic benefit.

    8. EXAMPLES

    [0261] The following Examples, which highlight certain features and properties of the exemplary embodiments of the bispecific binding proteins described herein are provided for purposes of illustration, and not limitation.

    Example 1—Generation and Characterization of Anti-CD40 Antibodies

    [0262] 8.1.1. Generation of Mouse Anti-Human CD40 Hybridoma

    [0263] Monoclonal antibodies were generated by immunizing Balb/C mice or SJL mice intraperitoneally with mouse 3T12 cells overexpressing human CD40. Spleens were harvested, and splenocytes were fused with the multiple myeloma cell line NSO. Hybridomas were selected using aminopterin. Selected hybridomas expressing anti-CD40 antibodies with agonistic activities were screened and subcloned to isolate individual clones.

    [0264] 8.1.2. CD40 Assays

    [0265] To screen for antibodies with agonistic activity, a panel of functional assays was developed, including NF-kB pathway stimulation, monocytes activation, DC activation and human CD40 ligand (SEQ ID NO:272) (CD40L) competition. In these assays, anti-human CD40 G28-5 (mouse IgG.sub.1) (Biolegend) was included as positive control and an isotype matched mouse antibody (muIgG.sub.1) as negative control.

    [0266] 8.1.2.1. HEK-Blue™ CD40 NF-κB Reporter Assay

    [0267] HEK-Blue™ 293 CD40 cell line (InVivogen) stably expressing human CD40 and a NF-κB reporter gene were maintained in DMEM, 10% heat-inactivated fetal bovine serum (FBS), supplemented with 30 μg/mL Blasticidin and 100 μg/mL Zeocin. Activation of CD40 on the surface of HEK-Blue™ CD40 cells triggers a signaling cascade leading to the activation of NF-κB and the subsequent secretion of embryonic alkaline phosphatase (SEAP). Incubation of hybridoma supernatants containing agonistic anti-CD40 with 2.5×10.sup.5/mL of HEK-Blue™ CD40 cells stimulated production of SEAP which could be measured by a colorimetic enzyme assay. The level of SEAP thus corresponded to the activity of anti-CD40 in the hybridoma supernatants.

    [0268] 8.1.2.2. Monocyte Activation Assay

    [0269] The monocyte activity assay was performed using the monocytic cell line THP1-XBlue cells (InVivogen). This cell line stably expresses an NF-κB and AP-1-inducible SEAP reporter gene and was maintained in RPMI 1640 with 10% heat-inactivated FBS and 200 μg/mL Zeocin. In the assay, 5×10.sup.5/mL THP1-XBlue cells were first primed with 40 ng/mL IFNγ for 24 hours, and were subsequently incubated with testing samples for an additional 24 hours. Agonistic anti-CD40 induced SEAP activity was monitored by enzymatic assay. Screening results and exemplary activity are summarized in Table 1-1.

    [0270] 8.1.2.3. Primary DC IL-12p70 Production Assay

    [0271] Anti-CD40 clones were also screened for their ability to activate monocyte-derived dendritic cell (moDC). Activation was monitored by IL-12p70 production. Briefly, whole blood from healthy human donors, diluted with an equal volume of PBS, was added to a Leucosep (Greiner Bio One) tube, containing Ficoll-Paque Plus below the frit (15 mL). The blood was then centrifuged at 1,000 g for 15 minutes without brake. PBMC were collected and washed once with PBS, centrifuged at 1,300 rpm for 5 minutes at room temperature, and washed once with RPMI 1640. Cells were re-suspended in culture medium (RPMI1640+10% heat-inactivated FBS). Monocytes were subsequently isolated from PBMC with an enrichment kit from StemCell and were cultured in StemSep serum free medium supplemented with 10 ng/mL GM-CSF and 20 ng/mL IL-4 at 37° C., 5% CO.sub.2 for 6 days. Fresh GM-CSF and IL-4 were added to the culture at day 3 to help maintaining DC differentiation. After 6 days culture, monocyte-derived immature DC were subject to FACS analysis to verify immature DC phenotype: Lin−, CD80/CD86+, HLA-DR+, CD11c+. Immature moDC were primed with IFNγ and stimulated with samples containing anti-CD40 for 48 hours in StemSep serum free medium supplemented with GM-CSF and IL-4. The culture supernatant was harvest and assayed for IL-12p70 production by a commercially available ELISA kit. The screening results and representative activity are summarized in Table 1-1.

    TABLE-US-00032 TABLE 1-1 Summary of agonistic anti-CD40 clone screen Monocyte activation.sup.1 moDC activation Clone (THP1-Xblue, OD.sub.655) (IL-12p70, pg/mL) AD163.7.2 0.13 905.3 AD163.9.3 0.19 2216.3 AD163.10.7 0.16 1318.8 AD163.27.12 0.12 1514.5 AD163.162.1 0.11 2155.5 AD164.14.6 0.15 878 AD164.76.3 0.16 769.8 AD165.1.2 0.14 719.8 AD166.4.4 0.24 0 AD175.14.11 0.2 0 G28-5 0.12 138.8 muIgG.sub.1 0.06 0 .sup.1Monocyte activation is SEAP activity released from THP1-XBlue cells recorded at OD.sub.655

    [0272] 8.1.3. Variable Region Sequencing and Humanization of Murine Anti-CD40 Antibodies

    [0273] The cDNA sequences encoding the heavy and light chain variable regions of ten monoclonal antibodies (Table 1-2) were cloned from hybridomas AD163.9.3, AD166.4.4, AD175.14.11, AD163.10.7, AD165.1.2, AD163.162.1, AD163.27.12, AD163.7.2, AD 164.14.6, and AD164.76.3, respectively, using standard PCR techniques and were sequenced using standard DNA sequencing techniques. The full amino acid sequences are shown in FIGS. 3A-3C.

    TABLE-US-00033 TABLE 1-2 Murine anti-CD40 antibodies Antibody Clone V.sub.H Identifier V.sub.L Identifier muAb1 AD163.9.3 SEQ ID NO: 1 SEQ ID NO: 31 muAb2 AD166.4.4 SEQ ID NO: 2 SEQ ID NO: 32 muAb3 AD175.14.11 SEQ ID NO: 3 SEQ ID NO: 33 muAb4 AD163.10.7 SEQ ID NO: 4 SEQ ID NO: 34 muAb5 AD165.1.2 SEQ ID NO: 5 SEQ ID NO: 35 muAb6 AD163.162.1 SEQ ID NO: 6 SEQ ID NO: 36 muAb7 AD163.27.12 SEQ ID NO: 6 SEQ ID NO: 37 muAb8 AD163.7.2 SEQ ID NO: 7 SEQ ID NO: 38 muAb9 AD164.14.6 SEQ ID NO: 8 SEQ ID NO: 39 muAb10 AD164.76.3 SEQ ID NO: 9 SEQ ID NO: 40

    [0274] Humanization of the antibody V region was carried out as outlined by Queen, C. et al. (Proc. Natl. Acad. Sci. USA, 1989; 86:10029-10033), and the sequences of the resulting antibodies are summarized in Table 1-3. The canonical structures of the CDRs were determined according to Huang et al. (Methods, 2005; 36:35-42). Human variable germline sequences with the same or most similar CDR canonical structures were identified, and appropriate human V.sub.H, V.sub.L, and J segment sequences were selected to provide the frameworks for the anti-CD40 variable region. At framework positions in which the computer model suggested significant contact with the CDRs, the amino acids from the murine anti-CD40 V regions were substituted for the original human framework amino acids (back-mutations). Full amino acid sequences are shown in FIGS. 3D-3G.

    TABLE-US-00034 TABLE 1-3 Humanized anti-CD40 antibodies Corresponding Antibody Murine Clone V.sub.H Identifier V.sub.L Identifier huAb6-1 AD163.162.1 SEQ ID NO: 10 SEQ ID NO: 41 huAb6-2 AD163.162.1 SEQ ID NO: 11 SEQ ID NO: 41 huAb6-3 AD163.162.1 SEQ ID NO: 12 SEQ ID NO: 41 huAb8-1 AD163.7.2 SEQ ID NO: 13 SEQ ID NO: 42 huAb8-2 AD163.7.2 SEQ ID NO: 14 SEQ ID NO: 42 huAb8-3 AD163.7.2 SEQ ID NO: 15 SEQ ID NO: 42 huAb9-1 AD164.14.6 SEQ ID NO: 16 SEQ ID NO: 43 huAb9-2 AD164.14.6 SEQ ID NO: 17 SEQ ID NO: 43 huAb9-3 AD164.14.6 SEQ ID NO: 18 SEQ ID NO: 43 huAb9-4 AD164.14.6 SEQ ID NO: 16 SEQ ID NO: 44 huAb9-5 AD164.14.6 SEQ ID NO: 17 SEQ ID NO: 44 huAb9-6 AD164.14.6 SEQ ID NO: 18 SEQ ID NO: 44 huAb9 A2I AD164.14.6 SEQ ID NO: 17 SEQ ID NO: 50 huAb9 A2V AD164.14.6 SEQ ID NO: 17 SEQ ID NO: 51

    [0275] Anti-CD40 clone AD163.162.1 was humanized according to the method described above. The humanized versions of AD163.162.1 were huAb6-1, huAb6-2 and huAb6-3. Antibody huAb6-1 had a V.sub.H (SEQ ID NO:10) with framework back-mutations M481, V67A, 169L, and A71V. Antibody huAb6-2 had a V.sub.H (SEQ ID NO: 11) with framework back-mutations M481 and A71V. Antibody huAb6-3 had a V.sub.H (SEQ ID NO: 12) with framework back-mutations M481 and A71V, as well as V.sub.H CDR germlining changes N60A, K64Q and D65G to improve identity to human germline sequence. Antibodies huAb6-1, huAb6-2 and huAb6-3 had a V.sub.L (SEQ ID NO:41) with framework back-mutations A43S, L46R, L47W and F71Y.

    [0276] The humanized versions of anti-CD40 clone 163.7.2 were huAb8-1, huAb8-2 and huAb8-3 (FIGS. 3D, 3E). Antibody huAb8-1 had a V.sub.H (SEQ ID NO: 13) with framework back-mutations M481, V67A, 169L, A71V, K73R, Y91F, and R94S. Antibody huAb8-2 had a V.sub.H (SEQ ID NO:14) with framework back-mutations M481, V67A, 169L, A71V, K73R, Y91F, and R94S, as well as the V.sub.H CDR C59S mutation. Antibody huAb8-3 had a V.sub.H (SEQ ID NO:15) with framework back-mutations M481, A71V and R94S. Antibodies huAb8-1, huAb8-2 and huAb8-3 all had a V.sub.L (SEQ ID NO:42) with the framework back-mutations A43 S and Y87F.

    [0277] Anti-CD40 clone AD164.14.6 was humanized to provide huAb9-1, huAb9-2, huAb9-3, huAb9-4, huAb9-5 and huAb9-6. Antibodies huAb9-1 and huAb9-4 displayed a V.sub.H (SEQ ID NO: 16) with framework back-mutations: 148M, V671 and V71R. Antibodies huAb9-2 and huAb9-5 had a V.sub.H (SEQ ID NO: 17) with framework back-mutations 148M and V71R. Antibodies huAb9-3 and huAb9-6 had a V.sub.H (SEQ ID NO: 18) with framework back-mutations: 148M and V71R, as well as additional two CDR germline changes T30S and N65S to improve identity to human germline sequence. Antibodies huAb9-1, huAb9-2 and huAb9-3 had a V.sub.L (SEQ ID NO: 43) with framework back-mutations 12A, Y36F and Y87F. Antibodies huAb9-4, huAb9-5 and huAb9-6 had a V.sub.L (SEQ ID NO: 44) with the framework back-mutation 12A.

    [0278] Clone AD164.14.6 was further modified to remove a signal peptide cleavage site found at the second position of the light chain, by reverting the framework back-mutation 12A of the V.sub.L. Antibodies huAb9 A2I (SEQ ID NO:50) and huAb9 A2V (SEQ ID NO:51) containing framework mutations A2I and A2V, respectively, prevented the formation of an undesired cleavage product.

    [0279] Humanized antibodies in the present Example were generated with a human IgG1 heavy chain constant region and kappa light chain constant region. The C-terminal lysine may be partially cleaved by post-translational processing after protein expression of the human IgG1 heavy chain. Accordingly, huAb9-5 had a heavy chain according to SEQ ID NOS:310 or 311 and a light chain according to SEQ ID NO:320. Antibody huAb9-5 also was produced with V273E and V273Y amino acid mutations in the heavy chain constant region, corresponding to a heavy chain according to SEQ ID NOS:312 or 313 and SEQ ID NOS:314 or 315, respectively, and a light chain according to SEQ ID NO:320. Antibodies huAb9 A2I and huAb9 A2V were generated with a human IgG1 V273E heavy chain constant region. Accordingly, huAb9 A2I had a heavy chain according to SEQ ID NOS:312 or 313 and a light chain according to SEQ ID NO:321. Analogously, huAb9 A2V had a heavy chain according to SEQ ID NOS:312 or 313 and a light chain according to SEQ ID NO:322.

    [0280] 8.1.4. NF-κB Activation, CD40 Binding Kinetics, Species Cross-Reactivity and Epitope Class of the Humanized Antibodies

    [0281] NF-κB activation by humanized anti-CD40 antibody of the invention was evaluated in HEK-Blue™ 293 CD40 NFκB reporter cells. The activation was represented as SEAP (secreted embryonic alkaline phosphatase) reporter gene activity measured at OD.sub.655. The maximal OD.sub.655 measured and the concentration for half-maximal activation (EC.sub.50) are summarized in Table 1-4.

    TABLE-US-00035 TABLE 1-4 NF-κB activation in HEK293 CD40 NFκB reporter cells Antibody EC.sub.50 (μg/mL) Maximal activation (OD.sub.655) huAb6-1 1.09 0.26 huAb6-2 1.21 0.20 huAb6-3 4.31 0.32 huAb8-1 0.14 0.45 huAb8-3 0.07 0.46 huAb9-1 0.19 0.26 huAb9-2 0.29 0.27 huAb9-3 0.18 0.27 huAb9-4 5.55 0.61 huAb9-5 1.13 0.67 huAb9-6 5.95 0.54

    [0282] The binding affinities of humanized anti-CD40 antibodies of the invention were analyzed by both surface plasmon resonance and FACS analysis.

    [0283] CD40 binding kinetics was analyzed by surface plasmon resonance assay with a Biacore T200 instrument (Table 1-5). Briefly, a goat anti-mouse Fc antibody (Pierce) or goat anti-human Fc (Pierce) was immobilized on a CM5 sensor chip, followed by capture of the anti-CD40 antibodies on the test surface. Subsequently, the soluble form of the extracellular domain of human CD40 (Creative BioMart) or cynomolgus (cyno) CD40 (Creative BioMart) was injected, and the binding and dissociation were measured.

    [0284] Surface plasmon resonance data indicated that humanized huAb8-1 and huAb9-5 antibody retained similar binding affinities (K.sub.D) as that of their parental clones AD163.7.2 or clone AD164.14.6, respectively, and showed similar binding to human and cynomolgus CD40 (Table 1-5).

    TABLE-US-00036 TABLE 1-5 Affinity measured by surface plasmon resonance* clone or Human CD40 Cynomolgus CD40 antibody k.sub.a (1/M-s) k.sub.d (1/s) K.sub.D (M) k.sub.a (1/M-s) k.sub.d (1/s) K.sub.D (M) AD163.162.1 7.6E+04 4.8E−03 6.3E−08 — — — AD163.27.12 7.5E+04 4.8E−03 6.4E−08 — — — AD163.7.2 1.0E+06 4.2E−03 4.1E−09 — — — AD175.14.11 6.9E+04 1.2E−02 1.7E−07 — — — AD163.9.3 4.7E+05 1.6E−02 3.5E−08 — — — AD166.4.4 2.8E+06 9.6E−03 3.5E−09 — — — AD163.10.7 2.3E+06 1.7E−01 7.6E−08 — — — AD165.1.2 2.3E+06 2.0E−03 8.8E−10 — — — AD 164.76.3 2.6E+06 3.4E−02 1.3E−08 — — — AD164.14.6 2.8E+06 5.2E−02 1.9E−08 — — — huAb8-1 7.7E+05 2.3E−03 3.0E−09 1.0E+06 7.1E−03 7.1E−09 huAb9-5 1.7E+06 2.6E−02 1.5E−08 1.8E+06 2.4E−02 1.3E−08 *Numbers refer to exponential notation, e.g., 3.0E−09 = 3.0 × 10.sup.−9.

    [0285] The humanized anti-CD40 antibodies were also evaluated for binding to cell-surface CD40 on HEK293 cells stably transfected with human or cynomolgus CD40, as well as B cells derived from cynomolgus or human PBMC. Humanized anti-CD40 antibodies were incubated with HEK293 transfectants for 15 minutes on ice, and the binding was detected with a fluorescence-conjugated anti-human secondary antibody (Jackson ImmunoResearch). FACS analysis of the cells confirmed that the humanized antibodies bound to human and cynomolgus CD40 stable cell lines. No binding was observed in experiments performed with mouse or dog CD40.

    [0286] The anti-CD40 antibodies were also assessed for their ability to bind to primary human and cynomolgus CD40-expressing cells. PBMCs isolated from human or cynomolgus blood were incubated with anti-CD40 antibodies conjugated to the fluorescence dye CF640R. After FACS analysis, the data were analyzed by FlowJo (FlowJo, LLC) software. These results demonstrated that the humanized antibodies bound to primary CD40-positive cells derived from both human and cynomolgus PBMC.

    [0287] Epitope classification of the humanized antibodies of the invention was confirmed by an ELISA assay measuring the binding of anti-CD40 and CD40 complex to plate-bound human CD40L (SEQ ID NO:272). Increasing amounts of humanized anti-CD40 antibodies or human IgG.sub.1 control antibody were incubated with 1 μg/mL CD40-huFc fusion protein, and added to a plate coated with CD40L. The signal from an uncoated plate was defined as background. Humanized antibodies huAb8-3 and huAb8-1 blocked the interaction of CD40 and CD40L; and huAb6-1 and huAb6-2 showed minimal impact on CD40-CD40L interaction. Data for huAb9-5 and huAb9-6 suggested that the antibodies enhanced CD40 binding to CD40L.

    [0288] 8.1.5. Enhancing FcγRIIB Binding by Modifying Fc Regions of Anti-CD40 Antibodies

    [0289] Greater agonistic activity of CD40 can be achieved through modifying the Fc region to enhance FcγRIIB binding (Li and Ravetch, Science, 2011; 333:1030-1034; and White, et al., J. Immunol, 2011; 187:1754-1763). Two mutations, V273E and V273Y, at position 273 in the human IgG.sub.1 constant region were introduced into the humanized anti-CD40 antibodies. The impact of the Fc mutations on binding to Fcγ receptors was monitored by FACS analysis and by antibody-dependent cell-mediated cytotoxicity (ADCC).

    [0290] Increasing amounts of anti-CD40 human IgG.sub.1 antibodies and their Fc variants were incubated with CHO cells stably expressing different human Fcγ receptors, including FcγRI (CD64), FcγRIIA (CD32A), FcγRIIB (CD32B), and FcγRIIIA with either F or V polymorphism. The binding was detected with a fluorescence-conjugated anti-human F(ab′).sub.2 specific secondary antibody (Jackson ImmunoResearch). The mutations V273E or V273Y reduced binding to FcγRIIIA while maintaining or enhancing FcγRIIB binding.

    [0291] The ADCC of the Fc variants of the humanized anti-CD40 antibodies was measured using a standard protocol (Law et al., 2005, Cancer Res. 65:8331-8). The mutations V273E or V273Y reduced ADCC activity mediated by human IgG.sub.1 Fc on CD40-expressing cells.

    [0292] 8.1.6. In Vitro Agonistic Activity of Anti-Human CD40 with Fc Modifications

    [0293] The agonistic activities of anti-CD40 Fc variants were evaluated for their ability to stimulate B cell proliferation, IL-12p70 production by DCs, and IFNγ production in an allogeneic DC and T cell mixed culture.

    [0294] 8.1.6.1. B Cell Proliferation

    [0295] Human B cells were enriched by B cell enrichment kit (StemCell Technologies) through negative selection. The purified B cells were seeded into 96 well plates at 5×10.sup.5/mL, 200 μL per well in AIM-V serum free medium (GIBCO). Serially diluted anti-CD40 antibodies were added and cultured with B cells for 6 days. In the last 16 hours of culture, 1 μCi of H.sup.3TdR were added to each well of the culture and B cell proliferation was determined by H.sup.3TdR incorporation. The radioactivity associated with H.sup.3TdR incorporation was recorded by a scintillation counter as count per minute (CPM). Compared to the corresponding human IgG.sub.1 wild-type antibodies, the anti-CD40 human IgG.sub.1 Fc variants V273E and V273Y showed enhanced B cell activation.

    [0296] 8.1.6.2. DC IL-12p70 Production

    [0297] Immature DCs were first derived from monocytes purified from human PBMC and treated with IL-4 and GM-CSF. DC maturation and IL-12p70 production were induced by anti-CD40 antibodies after priming with IFNγ. The wild-type human IgG.sub.1 versions of the anti-CD40 antibodies huAb6-1, huAb8-1, and huAb9-5 showed potent activity in stimulating DCs to produce IL-12p70. The V273E or V273Y Fc mutated versions maintained or enhanced their potency on DC activation.

    [0298] 8.1.6.3. Allogeneic DC and T Cell Co-Culture

    [0299] Dendritic cells (5×10.sup.3), derived from monocytes using the method described above, were mixed with 1×10.sup.5 T cells purified from a different donor. Various amounts of anti-CD40 antibodies huAb6-1, huAb8-1, huAb9-5 bearing either the wild-type human IgG1 constant region or an Fc variant were added to the DC and T cell co-culture. After 4 days incubation, supernatants were collected and IFNγ was measured by ELISA.

    [0300] Anti-CD40 antibodies huAb6-1, huAb8-1, and huAb9-5 increased IFNγ production in autologous DC and T cells co-cultures. The production of IFNγ represents the activation of T cells and potential T cell-mediated cytotoxicity. HuAb9-5 and huAb8-1 were more potent than huAb6-1 in stimulating T cells.

    [0301] 8.1.7. In Vivo Anti-Tumor Activity of Anti-Human CD40 Antibody

    [0302] The humanized anti-CD40 antibodies huAb6-1, huAb8-1, and huAb9-5, with wild-type human IgG1 and Fc variants were assessed for their ability to inhibit tumor growth in NSG mice bearing the prostate cancer xenograft, PC3.

    [0303] NSG mice were inoculated subcutaneously with a mixture of PC3 cells (1×10.sup.6), purified T cells (5×10.sup.5), and autologous DCs (1×10.sup.5). A single dose of the anti-CD40 antibodies or control antibodies at 2 mg/kg was injected intraperitoneally immediately after inoculation. Tumor volumes were measured every other day with calipers. Anti-CD40 antibodies including huAb6-1, huAb8-1, huAb9-5 and the corresponding V273E or V273Y Fc variants inhibited PC3 tumor growth.

    Example 2—Generation and Characterization of Anti-Mesothelin Antibodies

    [0304] 8.2.1. Generation of Fully Human Anti-Human Mesothelin Antibodies

    [0305] Fully human anti-mesothelin antibodies were generated through an in vitro RNA display technology (Hseh, C-M., Kutskova, Y. A. and Memmott, J. E., US Patent Appl. No. US2010/0105569) and subsequent affinity maturation to afford the anti-mesothelin antibody HuAb17.

    [0306] Sequence alignment showed that the mesothelin antibody HuAb17 shares the highest identity to human germlines VH1-46/JH4 and IGLV3-1/Jk2. To improve the affinity of HuAb17 to mesothelin, hypermutated CDR residues were identified from other human antibody sequences in the IgBLAST database that also shared high identity to germlines VH1-46 and IGLV3-1. The corresponding HuAb17 CDR residues were then subjected to limited mutagenesis by PCR with primers having low degeneracy at these hypermutated CDR positions to create three antibody libraries in the scFv format suitable for surface display. The first library contained mutations at residues 30, 31, 33, 34, 50, 53, 56 and 58 in V.sub.H CDR#1 and V.sub.H CDR#2 (Kabat numbering); the second library at residues 95 to 100 d in V.sub.H CDR#3; and the third library at residues 27, 30, 31, 33, 52, 53 and 93 to 96 in the three V.sub.L CDRs. For further mutations of HuAb17 to align it closer to the human germline framework sequences, a binary degeneracy at V.sub.H positions D27Y and V55G was introduced. Also, the following positions were germline: V.sub.H at positions 13, 37, 74, 76, 82a, 84, 91, and 94; and V.sub.L at positions 20 and 100. The HuAb17 libraries were displayed and selected against a low concentration of biotinylated mesothelin by magnetic then fluorescence activated cell sorting. The parental HuAb17 and its affinity matured variants are listed in Table 2-1. The amino acid sequences of the heavy or light chain variable region of each clone are shown in FIGS. 4A-4E.

    TABLE-US-00037 TABLE 2-1 Affinity matured human anti-mesothelin antibodies based on HuAb17 Antibody V.sub.H Identifier V.sub.L Identifier HuAb17 SEQ ID NO: 107 SEQ ID NO: 136 HuAM1 SEQ ID NO: 108 SEQ ID NO: 137 HuAM2 SEQ ID NO: 109 SEQ ID NO: 137 HuAM3 SEQ ID NO: 110 SEQ ID NO: 137 HuAM4 SEQ ID NO: 111 SEQ ID NO: 137 HuAM5 SEQ ID NO: 112 SEQ ID NO: 137 HuAM6 SEQ ID NO: 113 SEQ ID NO: 137 HuAM7 SEQ ID NO: 114 SEQ ID NO: 137 HuAM8 SEQ ID NO: 115 SEQ ID NO: 138 HuAM9 SEQ ID NO: 116 SEQ ID NO: 137 HuAM11 SEQ ID NO: 117 SEQ ID NO: 139 HuAM12 SEQ ID NO: 118 SEQ ID NO: 137 HuAM13 SEQ ID NO: 119 SEQ ID NO: 139 HuAM14 SEQ ID NO: 117 SEQ ID NO: 137 HuAM15 SEQ ID NO: 120 SEQ ID NO: 137 HuAM16 SEQ ID NO: 119 SEQ ID NO: 137 HuAM17 SEQ ID NO: 121 SEQ ID NO: 137 HuAM18 SEQ ID NO: 122 SEQ ID NO: 137 HuAM19 SEQ ID NO: 123 SEQ ID NO: 140 HuAM21 SEQ ID NO: 124 SEQ ID NO: 137

    [0307] 8.2.2. Mesothelin Binding Kinetics and Species Cross-Reactivity of Fully Human Anti-Mesothelin Antibodies

    [0308] The fully human anti-mesothelin antibodies were measured for binding affinity to human and cynomolgus mesothelin by surface plasmon resonance using the method described above. The binding kinetics of human anti-mesothelin parental antibody HuAb17 and its affinity matured variants for human and cynomolgus mesothelin are summarized in Table 2-2.

    TABLE-US-00038 TABLE 2-2 Exemplary binding kinetics of human anti-mesothelin antibodies* human mesothelin cynomolgus mesothelin Antibody k.sub.a (1/M-s) k.sub.d (1/s) K.sub.D (M) k.sub.a (1/M-s) k.sub.d (1/s) K.sub.D (M) HuAb17 1.2E+04 3.2E−05 2.6E−09 1.5E+04 1.3E−04 8.1E−09 HuAM1 1.9E+04 5.1E−05 2.7E−09 1.8E+04 2.0E−04 1.1E−08 HuAM5 2.3E+04 1.0E−05 4.6E−10 2.0E+04 1.0E−04 4.9E−09 HuAM6 2.4E+04 2.4E−05 1.0E−09 2.2E+04 8.5E−05 3.9E−09 HuAM7 2.6E+04 1.0E−05 3.9E−10 2.2E+04 1.1E−04 4.9E−09 HuAM15 4.4E+04 1.3E−05 3.1E−10 4.0E+04 1.8E−04 4.5E−09 HuAM16 5.2E+04 2.4E−05 4.6E−10 4.7E+04 1.9E−04 4.1E−09 HuAM17 2.9E+04 1.5E−05 5.3E−10 2.7E+04 9.1E−05 3.4E−09 HuAM18 1.6E+04 1.0E−05 6.6E−10 1.4E+04 1.3E−04 9.3E−09 *Numbers refer to exponential notation, e.g., 3.0E−09 = 3.0 × 10.sup.−9.

    [0309] 8.2.3. In Vitro Binding of Affinity Matured Human Anti-Mesothelin in the Presence of CA125

    [0310] Mesothelin is highly expressed on some solid tumors, including mesothelioma, ovarian cancer, and pancreatic cancer, and is often co-expressed with another tumor antigen, CA125 (MUC16). It has been reported that mesothelin can interact with CA125 to mediate cell adhesion (Rump A., et. al., J. Biol. Biochem. 2004, 279: 9190-9198). To determine whether the anti-mesothelin antibodies described herein can bind to mesothelin in a tumor microenvironment enriched with CA125, the binding of the anti-mesothelin affinity matured variants was measured on tumor cell lines with or without endogenous CA125 expression.

    [0311] The binding of anti-mesothelin affinity matured variants was measured by FACS on the ovarian cancer cell line OVCAR3, the pancreatic cancer cell line SW1990, and the renal cancer cell line SN12C. Both OVCAR3 and SW1990 express CA125, but CA125 expression on SN12C cells was not detected. The maximum binding and the concentration of half maximum binding on SN12C and OVCAR3 are summarized in Table 2-3, which shows the binding kinetics of human anti-mesothelin affinity matured antibodies on mesothelin positive tumor cell lines with endogenous mesothelin expression with CA125 expression (CA125+) or without (CA125-).

    TABLE-US-00039 TABLE 2-3 Binding kinetics of human anti-mesothelin affinity matured antibodies SN12C (CA125−) OVCAR3 (CA125+) Maximum EC.sub.50 Maximum EC.sub.50 Antibody binding (MFI) (μg/mL) binding (MFI) (μg/mL) HuAb17 10972 2.74 1641 2.9 HuAM5 10026 0.09 3693 0.7 HuAM11 7534 0.04 3434 0.7 HuAM12 9629 0.09 3268 0.8 HuAM13 9868 0.09 3672 0.7 HuAM14 9804 0.09 3371 0.7 HuAM15 9389 0.07 3551 0.7 HuAM16 9535 0.08 3612 0.6 HuIgG1 40 — 70 — control

    [0312] To measure the impact of soluble CA125 on anti-mesothelin antibody binding, antibodies at a sub-optimal concentration (0.5 μg/mL) were added to cancer cells pre-incubated with increasing amounts of soluble CA125. The mesothelin binding of antibodies in the presence of CA125 was detected with a fluorescence-conjugated goat-anti-human secondary antibody. As depicted in FIGS. 5A-5C, representative anti-mesothelin affinity matured variants showed consistent binding to different tumor cell lines in the presence of increasing amounts of soluble CA125. The binding curves of the anti-mesothelin affinity matured variants on OVCAR3 cells, as well as HEK293 cells stably expressing mesothelin, were also not significantly shifted in the presence of soluble CA125 (FIGS. 6A-6B).

    Example 3—Generation and Characterization of Anti-4-1BB Antibodies

    [0313] 8.3.1. Anti-4-1BB Antibodies Via Rat and Mouse Hybridoma Technology

    [0314] Rats and mice were immunized according to the methods known in the art (E. Harlow, D. Lane. Antibody: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1998)). Recombinant mouse 4-1BB-ECD-human Fc fusion or mouse 4-1BB-ECD-his proteins were used as immunogens. Human cell lines expressing human and mouse 4-1BB were used for determining anti-sera titer and for screening antigen-specific antibodies. Sprague-Dawley rats were immunized in the hock with dosages containing 10 μg protein per animal per injection in the presence of Gerbu MM adjuvant (Cooper-Casey Corporation) for both primary and boost immunizations. To increase immune response to the counter species 4-1BB, the animals were further boosted with a mixture of human and mouse 4-1BB-ECD-his proteins for the final boosts.

    [0315] 8.3.2. Hybridoma Fusion and Screening

    [0316] Cells of murine myeloma cell line NSO were cultured to reach the log phase stage right before fusion. Popliteal and inguinal lymph nodes were removed from each mouse and single cell suspensions were prepared in a sterile manner. Lymphocytes were fused with myeloma cells according the methods known in the art (E. Harlow, D. Lane. Antibody: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1998); Kohler G. and Milstein C., Nature, 256:495-497 (1975); BTX Harvard Apparatus (Holliston, Mass., US) ECM 2001 technical manual). Fused hybrid cells were dispensed into 96-well plates in DMEM/10% FBS/HAT media. Supernatants from surviving hybridoma colonies were subjected to cell-based screening using human cell lines expressing the recombinant human 4-1BB or mouse 4-1BB.

    [0317] Hits were expanded and binding specificity was confirmed by FACS using a human cell line expressing the human 4-1BB, cynomolgus 4-1BB, and mouse 4-1BB and Goat anti-rat IgG-PE (Jackson Immunochemicals) or Goat anti-mouse IgG-PE (Jackson Immunochemicals) for detection. A selection of hits were subcloned using the MoFlo (Beckman) by depositing a single cell per well into 96 well cell culture plates to ensure clonality of the cell line. The resulting colonies were screened for specificity by FACS using human cell lines expressing the human 4-1BB protein, cynomolgus 4-1BB or mouse 4-1BB. Isotype of each monoclonal antibody was determined using the Rat Monoclonal Isotyping kit (Serotec) or the Mouse Isotyping kit (Roche). Hybridoma clones producing antibodies of interest were purified and further characterized for affinity by surface plasmon resonance, potency (NFκB reporter assay), and ligand competition (ELISA). Amino acid sequences of V.sub.H and V.sub.L regions of exemplary murine antibodies TABBY1.1 to TABBY10, or rat antibodies TABBY101 to TABBY108 are shown in FIGS. 7A-7C, and 7F-7G.

    [0318] 8.3.3. 4-1BB Assays

    [0319] 8.3.3.1. 4-1BB NF-κB Reporter

    [0320] HEK293 cells previously transduced with the pLenti-NFκB-Luciferase vector was transfected with a plasmid expressing the human, cynomolgus, or mouse 4-1BB proteins using Lipofectamine 2000 (Invitrogen, Grand Island, N.Y., USA). Activation of 4-1BB on the surface of reporter cells triggers a signaling cascade leading to the activation of NF-κB and the subsequent expression of luciferase. Cells were thawed, resuspended at 5×10.sup.5 cells/mL, and directly plated into 96 well format white/clear bottom plates (Thermo Fisher) at 50 μL/well (25,000 cells per well). A dose titration of purified antibody preparations were added in duplicate at 30, 10, 3.33, 1.11, 0.37, or 0.12 μg/mL at 50 μL/well. Crosslinkers were added in duplicate at 120, 40, 13.33, 4.44, 1.48, or 0.49 μg/mL or media at 50 μL/well. The following reagents were used as crosslinkers: Goat anti-mouse IgG Fc (Jackson Immunochemicals), Goat anti-human IgG Fc (Jackson Immunochemicals), or Goat anti-rat IgG Fc (Jackson Immunochemicals). Recombinant human (Abbvie, 6 μg/mL) or mouse 4-1BB Ligand (R&D, 6 μg/mL), TNFα (R&D, 60 ng/mL) or growth media were add to control wells for maximum and minimum luciferase activities for each of the cell lines. Assay plates were incubated overnight at 37° C. and luciferase activity was measured by relative luminescence (RLU) of the BriteLite Substrate (Perkin Elmer) at 75 μL/well. Data was plotted as percent ligand activity as follows:


    % Relative activity=((RLU of sample−RLU of media)/(RLU of Ligand−RLU of media))×100.

    [0321] 8.3.3.2. 4-1BB FACS Binding

    [0322] To determine species specificity and relative binding affinities of the test antibodies, cell lines were generated to exogenously express 4-1BB on the membrane. HEK293 cells were transfected with a plasmid expressing the human, cynomolgus, or mouse 4-1BB proteins. Stable, high expressing populations were sorted on the MoFlo sorter (Beckman) and maintained in DMEM, 10% fetal bovine serum, containing 500 μg/mL G418. For the assay, cells were dissociated with trypsin, resuspended at 5×10.sup.6 cells/mL and transferred to the 500 μL polypropylene plate (Nunc) at 50 μL/well (250,000 cells/well). Test antibodies were added to appropriate wells of the assay plate at 20, 10, 5, 2.5, 1.25, 0.625, 0.312, 0.156, 0.078, 0.039, 0.0195, 0.00976 μg/mL (50 μL/well, singlets) and incubated at room temperature for 20 minutes. Cells were washed twice with 250 μL/PBS (Hyclone) per well. PE-labelled detection antibodies were added at 1:250 dilution of stock, 50 μL/well, and incubated for 20 minutes at room temperature. The following detection antibodies were used: Goat anti-Rat IgG-PE (Southern Biotech), Goat anti-Mouse IgG-PE (Southern Biotech) or Goat anti-Human IgG-PE (Southern Biotech). Cells were washed once and fixed with PBS containing 1% Formaldehyde. Plate was analyzed for fluorescence on the FACSCalibur (Becton Dickinson).

    [0323] 8.3.3.3. 4-1BB Ligand Competition

    [0324] To evaluate the ability of the anti-4-1BB antibodies to compete with the 4-1BB ligand (4-1BBL) for binding, an ELISA assay was developed. Immunlon 4 plates (Dynatec) were coated with Goat anti-human IgG Fc specific at 0.5 μg/mL (Jackson Immunochemicals) in Carbonate-Bicarbonate buffer (Pierce), overnight at room temperature. Plates were washed and either mouse (R&D Systems) or human 4-1BB-Fc (R&D Systems) proteins were added at 0.2 μg/mL and incubated for 1 hour at room temperature. Plates were washed and the test antibodies were added as follows: 10, 5, 2.5, 1.25, 0.625, 0.3125, 0.156, 0.078, 0.039, 0.0195, 0.00976, or 0 μg/mL in duplicate and incubated for 1 hour at room temperature. Solution was then removed from the wells. Either human 4-1BBL (SEQ ID NO:274) (R&D Systems, at 0.02 μg/mL) or mouse 4-1BBL (R&D Systems, at 0.04 μg/mL) was added to respective wells and incubated for 1 hour at room temperature. Plates were washed and either biotinylated anti-human 4-1BBL (R&D Systems) or biotinylated anti-mouse 4-1BBL (R&D Systems) reagents were added at 0.05 μg/mL to detect the presence of 4-1BBL in the assay plates. Plates were washed and the complex was detected with Avidin-HRP (Jackson Immunochemicals) at 1:5000 dilution, incubated for 30 minutes at room temperature. Plates were washed and TMB Substrate (BioFx) was added to each well 100 μL/well. After 5 minutes of incubation, TMB Stop buffer (BioFx) was added at 50 μL/well. Plates were read at 650 nM on the Spectramax (Molecular Devices). Data was plotted as Percent Maximum (4-1BBL) binding as follows:


    Max Binding=(OD.sub.650 of sample)/(OD.sub.650 at 0 μg/mL antibody)×100.

    [0325] 8.3.3.4. CD8+ T cell Assay with Crosslinker

    [0326] Human PBMC was purified from buffy coat by Ficoll-paque centrifugation and the CD8+ T cells were then purified from the PBMC using CD8+ T cells negative selection kit (StemCell Technologies). CD8+ T cells were resuspended in AIM-V medium. Antibodies were also prepared in this medium. A 96-well flat bottom plate was coated with 100 μL of 0.5 μg/mL OKT3 in PBS for 2 hr in the incubator, and the plate was washed twice with AIM-V. To the plate was added 50 μL CD8+ T cells (2×10.sup.5) per well, with 50 μL 4-1BB antibody (30 μg/mL or desired concentration gradient), and 50 μL goat anti-human IgG, Fcγ specific antibody (120 μg/mL or 4 times the amount of 4-1BB antibody used). The plates were incubated for 72 hr, after which 50 μL supernatant was taken for cytokine analysis by Luminex. To the plate was added 50 μL AIM-V/0.5 μCi .sup.3H per well and the mixtures incubated for 6 hr to measure thymidine incorporation (proliferation).

    [0327] Alternatively, with CHOK1-FcγR transfectants or PC3-MSLN as crosslinker, irradiated cells (2×10.sup.4/well) were placed in a 96-well plate in complete medium the day before experiment. CD8+ T cells and antibody gradient were prepared in AIM-V medium. The medium in the wells was replaced with 100 μL CD8+ T cells (2×10.sup.5/well) and 100 μL 4-1BB antibody containing 1 μg/mL OKT3. The plates were incubated, and analysis for cytokine release and proliferation was performed as above.

    [0328] 8.3.4. Binding Data of Rat Anti-4-1BB Antibodies

    [0329] Exemplary antibodies to 4-1BB were generated, and the amino acid sequences for the corresponding V.sub.H and V.sub.L sequences are shown in FIG. 7A-7C.

    [0330] The rat antibodies TABBY101 through TABBY108 all exhibited binding to murine 4-1BB as demonstrated by surface plasmon resonance (Biacore) as shown in Table 3-1.

    TABLE-US-00040 TABLE 3-1 Binding of rat antibodies to murine 4-1BB by Biacore Antibody Light chain mu4-1BB K.sub.D (nM) TABBY101-rIgG.sub.1 kappa 0.82 TABBY102-rIgG.sub.1 kappa 0.84 TABBY103-rIgG.sub.1 kappa 0.17 TABBY104-rIgG.sub.1 kappa 0.14 TABBY105-rIgG.sub.2a kappa 15 TABBY106-rIgG.sub.1 lambda 1.6 TABBY107-rIgG.sub.1 kappa 6.7 TABBY108-rIgG.sub.1 kappa 0.36

    [0331] Additionally, the murine antibodies TABBY1.1 through TABBY10 exhibited binding to human 4-1BB by Biacore as shown in Table 3-2.

    TABLE-US-00041 TABLE 3-2 Binding of murine antibodies to human 4-1BB by Biacore Antibody hu4-1BB K.sub.D (nM) TABBY1.1-mIgG.sub.1 2.0 TABBY3-mIgG.sub.2b 6.6 TABBY5-mIgG.sub.2b 0.3 TABBY6-mIgG.sub.1 1.9 TABBY10-mIgG.sub.1 3.1

    [0332] Binding of exemplary antibodies to endogenous human 4-1BB, as well as their respective EC.sub.50s, was determined by surface plasmon resonance analysis in an analogous manner as described in Example 1. Table 3-3 shows that the 4-1BB antibodies TABBY106-rIgG.sub.1 and TABBY107-rIgG.sub.1 (i.e., with rat IgG.sub.1 constant regions and with lambda and kappa light chains, respectively) exhibited a different binding profile than literature 4-1BB antibodies 3H3 and 1D8. In contrast to 3H3 and 1D8, the presently disclosed antibodies showed binding to human 4-1BB. Further, 4-1BB antibodies TABBY106-rIgG.sub.1 and TABBY107-rIgG.sub.1 bound to murine 4-1BB.

    TABLE-US-00042 TABLE 3-3 Binding kinetics of exemplary antibodies to human and mouse 4-1BB* Human 4-1BB Mouse 4-1BB Protein k.sub.a (1/M-s) k.sub.d (1/s) K.sub.D (M) k.sub.a (1/M-s) k.sub.d (1/s) K.sub.D (M) 3H3 Not detected 5.8E+06 5.7E−03 9.8E−10 1D8 Not detected 2.1E+06 8.0E−03 3.9E−09 TABBY 2.2E+06 2.6E−02 1.2E−08 8.1E+06 1.3E−02 1.6E−09 106- rIgG.sub.1 TABBY 4.5E+05 1.4E−04 3.2E−10 2.4E+05 1.6E−03 6.7E−09 107- rIgG.sub.1 *Values refer to exponential notation, e.g., 3.0E−09 = 3.0 × 10.sup.−9.

    [0333] Additionally, the exemplary 4-1BB murine antibodies TABBY106-rIgG.sub.1 and TABBY107-rIgG.sub.1 also bind to cynomolgus 4-1BB in contrast to the literature 4-1BB antibodies 3H3 and 1D8. The results are summarized in Table 3-4.

    TABLE-US-00043 TABLE 3-4 Binding kinetics of exemplary antibodies to cynomolgus 4-1BB* Cynomolgus 4-1BB Protein k.sub.a (1/M-s) k.sub.d (1/s) K.sub.D (M) 3H3 Not detected 1D8 Not detected TABBY106-rIgG.sub.1 1.2E+06 2.2E−02 1.8E−08 TABBY107-rIgG.sub.1 3.5E+05 1.3E−04 3.6E−10 *Values refer to exponential notation, e.g., 3.0E−09 = 3.0 × 10.sup.−9.

    [0334] The rat antibodies TABBY101 through TABBY108 were tested for competitive binding with human 4-1BB ligand against human 4-1BB according to the Biacore assay described above. None of the antibodies competed with human 4-1BB ligand for binding to human 4-1BB.

    Example 4—Design and In Vitro Evaluation of Bispecific Binding Proteins Binding CD40 and Mesothelin

    [0335] 8.4.1. Rationale and Molecular Design

    [0336] A tumor targeting anti-CD40 binding protein should ideally activate CD40 upon binding to tumor antigen that is on the membrane of tumor cells. The tumor antigen binding may provide crosslinking for activating CD40 multimerization and initiating downstream signaling. Such a binding protein should exhibit minimal CD40 agonistic activity when no tumor antigen is present. Upon binding cell surface tumor antigen, the binding protein would increase CD40 agonist activity. To this end, different bispecific binding protein formats were tested.

    [0337] One format was the dual variable domain immunoglobulin (DVD-Ig) (FIG. 2A), which contained two variable (V) domains in tandem, connected by a linker, followed by the constant regions of a conventional antibody. To construct CD40/tumor antigen DVD-Igs, the V-domain against a tumor antigen was placed in the outer domain, at the amino (N)-terminus of the molecule, while the V-domain against CD40 was placed in the inner domain. The two V-domains on the heavy (V.sub.H) chain and light (V.sub.L) chains in the DVD-Ig were linked by GS linkers, i.e., GGGGSGGGGS (SEQ ID NO:346) for V.sub.H and GGSGGGGSG (SEQ ID NO:347) for V.sub.L, or long (L) or short (S) linkers, designed based on the hinge regions naturally occurring in antibodies (Wu, C et. al., Nature Biotechnology, 25: 1290-1297 (2007)). The linkers have been previously described (e.g., in Jakob, et al. mAbs, 5(3): 358-363 (2013)). The heavy chain long linker has the amino acid sequence ASTKGPSVFPLAP (SEQ ID NO:342), and the short linker has the sequence ASTKGP (SEQ ID NO:343). For the light chain, the long linker has an amino acid sequence TVAAPSVFIFPP (SEQ ID NO:344), and the short linker has a sequence TVAAP (SEQ ID NO:345). Hence, the DVD proteins may be described with the linker combinations of the variable heavy chains and variable light chains, e.g., “LS” comprises a variable heavy “long” chain linker and a variable light “short” chain linker.

    [0338] Accordingly, a panel of DVD binding proteins, each with a different linker combination, DVD-LL, DVD-LS, DVD-SL, DVD-SS, DVD-GS, were generated on the human IgG.sub.2 or human IgG.sub.1 V273E constant regions with the anti-CD40 domains with V.sub.H and V.sub.L adapted from huAb8-1 or huAb9-5, and anti-MSLN domains with V.sub.H and V.sub.L adapted from the anti-MSLN antibody HuAM15.

    [0339] CO-DVD bispecific proteins according the structure of FIG. 2B were also constructed according to the PCT publication (WO 2013/101972, for a discussion of CO-DVD).

    [0340] A third bispecific format tested was the bispecific binding protein of formula (I) shown in FIG. 1A. In this format, antibody variable domains were represented by a single chain Fv (scFv) (an antigen binding domain where the V.sub.H and V.sub.L domains were connected by a flexible linker). One scFv was located at the N-terminus of the molecule and was followed by the hinge, CH2 region, and CH3 region of an IgG constant region. A second scFv was placed at the C-terminus, with a linker (SEQ ID NO:251) connecting the CH3 region and scFv. The scFv's against CD40 and the tumor antigen were placed at either the N- or C-terminus.

    [0341] Bispecific binding proteins of formula (I) were generated with CD40 scFv at either the amino (N-) or carboxyl (C-) terminus of the human IgG.sub.2, human IgG.sub.1 V273E or V273Y constant regions (TABLE 4-1). The amino acid sequences of the binding proteins in TABLE 4-1 are shown in FIG. 8A-8G.

    TABLE-US-00044 TABLE 4-1 Bispecific proteins of formula (I) binding CD40 and mesothelin N- C-terminal Protein terminal domain domain Linker Isotype Identifier h24 HuAb17 huAb6-1 SEQ ID NO: 251 huIgG.sub.1 SEQ ID NO: 401 (V.sub.H-V.sub.L) (V.sub.H.fwdarw.V.sub.L) V273Y h26 HuAb17 huAb6-1 SEQ ID NO: 251 huIgG.sub.1 SEQ ID NO: 402 (V.sub.H-V.sub.L) (V.sub.L.fwdarw.V.sub.H) V273Y B37 huAb8-1 HuAM15 SEQ ID NO: 251 huIgG.sub.1 SEQ ID NO: 403 (V.sub.H-V.sub.L) (V.sub.L-V.sub.H) V273E B38 huAb8-1 HuAM15 SEQ ID NO: 251 huIgG.sub.1 SEQ ID NO: 404 (V.sub.L-V.sub.H) (V.sub.L-V.sub.H) V273E B39 huAb9-5 HuAM15 SEQ ID NO: 251 huIgG.sub.2 SEQ ID NO: 405 (V.sub.H-V.sub.L) (V.sub.H-V.sub.L) B40 huAb9-5 HuAM15 SEQ ID NO: 251 huIgG.sub.1 SEQ ID NO: 406 (V.sub.H-V.sub.L) (V.sub.L-V.sub.H) V273E B41 huAb9-5 HuAM15 SEQ ID NO: 251 huIgG.sub.1 SEQ ID NO: 407 (V.sub.L-V.sub.H) (V.sub.H-V.sub.L) V273E B42 huAb9-5 HuAM15 SEQ ID NO: 251 huIgG.sub.1 SEQ ID NO: 408 (V.sub.L-V.sub.H) (V.sub.L-V.sub.H) V273E B43 HuAM15 huAb8-1 SEQ ID NO: 251 huIgG.sub.1 SEQ ID NO: 409 (V.sub.H-V.sub.L) (V.sub.L-V.sub.H) V273E B44 HuAM15 huAb8-1 SEQ ID NO: 251 huIgG.sub.1 SEQ ID NO: 410 (V.sub.L-V.sub.H) (V.sub.H-V.sub.L) V273E B45 HuAM15 huAb8-1 SEQ ID NO: 251 huIgG.sub.1 SEQ ID NO: 411 (V.sub.L-V.sub.H) (V.sub.L-V.sub.H) V273E B46 HuAM15 huAb9-5 SEQ ID NO: 251 huIgG.sub.1 SEQ ID NO: 412 (V.sub.L-V.sub.H) (V.sub.H-V.sub.L) V273E

    [0342] 8.4.2. Evaluation of Mesothelin-Dependent Activity of CD40 Bispecific Binding Proteins

    [0343] The molecules with conditional activation were designed to be selectively active in the presence of mesothelin with lower or minimal activity in its absence. For purposes of this example, the activity in the presence of mesothelin should exhibit at least five-fold enhancement in potency as well as in magnitude compared to that in the absence of mesothelin.

    [0344] To identify molecules with mesothelin-dependent conditional activity, the bispecific binding proteins in different formats were first tested for binding to CD40 and MSLN targets. Subsequently CD40/mesothelin bispecific binding proteins were assessed for their ability to activate B cells and dendritic cells when co-cultured with mesothelin-expressing HEK293 cells or parental 293 cells without mesothelin expression. As described above, B cell activation was monitored by B cell proliferation, and DC activation was monitored by IL-12p70 production. In addition, cell surface activation maker, such as CD23, CD83 and CD86, were also monitored by flowcytometory on B cells as well as on DC. In these experiments, anti-CD40 antibodies were used as positive control, and an isotype matched hIgG as negative control.

    [0345] The DVD-Ig bispecific proteins DVD-LL, DVD-LS, DVD-SL, DVD-SS, and DVD-GS constructed as discussed above were first tested for binding to CD40 or MSLN, and demonstrated binding affinity in binding assays. The DVD-Ig molecules were tested for in vitro immune cell activation in the presence or absence of mesothelin-positive cells. None of the DVD-Ig proteins showed mesothelin-dependent B cell or dendritic cells activation. In the presence of mesothelin, these molecules had little to no activity.

    [0346] Exemplary CO-DVD bispecific proteins were constructed with variable domains specific for CD40 and mesothelin as discussed above, but did not exhibit significant anti-mesothelin binding.

    [0347] Several bispecific binding proteins of formula (I) described in TABLE 4-1 demonstrated binding to both CD40 and MSLN (TABLE 4-2), and were evaluated for their ability to exhibit MSLN-dependent CD40 activation of DCs and B cells. The bispecific proteins of formula (I) stimulated little to no IL-12p70 release from DCs co-cultured with HEK293 cells without mesothelin, while the same proteins stimulated significant IL-12p70 release from DC co-cultures with HEK293 cells expressing mesothelin (FIG. 9A). Similarly, the bispecific binding proteins of formula (I) exhibited minimal activity in stimulating B cell proliferation as gauged by negative control human IgG when B cells were co-cultured with HEK293 parental cells. When co-cultured with HEK293 cells expressing mesothelin, the formula (I) proteins stimulated significant proliferation of B cells as compared with anti-CD40 antibody huAb8-1 or huAb9-5 (FIG. 9B).

    TABLE-US-00045 TABLE 4-2 Antigen binding of bispecific binding proteins of formula (I) Protein MSLN binding EC.sub.50 (μg/mL) CD40 binding EC.sub.50 (μg/mL) B37 4.4 0.5 B38 14.3 1.2 B39 7.4 0.5 B40 9.0 0.4 B41 11.9 0.5 B42 6.0 0.8 B43 7.3 3.3 B44 5.7 0.8 B45 5.6 1.2 B46 2.5 0.5 HuAM15 0.9 — huAb8-1 — 0.4 huAb9-5 — 0.2

    [0348] A summary of the activation enhancement of an exemplary bispecific binding protein of formula (I), B40 (SEQ ID NO:406), in immune cells in vitro is shown in Table 4-3. Upon binding to cell surface MSLN, B40 induced B-cell activation as measured by induction of activation markers (CD23 and CD86) and B cell proliferation, and induced monocyte-derived dendritic cell (moDC) activation, as measured by interleukin (IL)-12 p70 and CD83 expression. In the absence of MSLN, B40 was significantly less potent in inducing B-cell activation and had no detectable effect on moDCs compared to the agonistic anti-CD40 antibody huAb9 A2I. As seen in the B-cell assays, for example, with the CD86 assay readout, bispecific binding protein B40 showed a reduction of EC.sub.50 going from B-cells in the absence of mesothelin (“−MSLN”) (mesothelin EC.sub.50=1.4 nM) to B-cells co-cultured with HEK293 cells expressing cell-surface mesothelin (“+MSLN”) (mesothelin EC.sub.50=0.035 nM). Similarly, in monocyte-derived dendritic cells (“moDC”), with either assay readout, mesothelin EC.sub.50 went from undetectable (i.e., no measured activity) in the absence of mesothelin to subnanomolar potency [EC.sub.50=0.15 nM (CD83) and EC.sub.50=0.44 nM (IL-12p70)] in the presence of HEK293 cells expressing mesothelin.

    TABLE-US-00046 TABLE 4-3 Immune cell activation data for anti-CD40 antibody huAb9 A2I and bispecific binding protein B40 −MSLN (EC.sub.50, nM) +MSLN (EC.sub.50, nM) Agonistic assay Assay readout huAb9 A2I B40 huAb9 A2I B40 B-cell (n = 3) CD86 0.35 ± 0.13 1.4 ± 0.4 0.70 ± 0.36 0.035 ± 0.012 CD23 1.4 ± 0.9 10 ± 3  2.5 ± 0.7 0.12 ± 0.03 proliferation 4.5 ± 1.5 22 ± 10 12 ± 4  0.33 ± 0.25 CD40 4.1 ± 1.1 5.0 ± 1.3 Not determined Not determined Occupancy moDC (n = 3) CD83 2.0 ± 0.5 Not detectable 6.9 ± 5.0 0.15 ± 0.04 IL-12p70 12.4 ± 6.5  Not detectable  3.4 ± 0.58 0.44 ± 0.02

    [0349] Further exemplary bispecific binding proteins of formula (I) were constructed and evaluated. The variable domain structures of the proteins are given in Table 4-4. Exemplary proteins V6-2 (SEQ ID NO:419), V6-5 (SEQ ID NO:420) and V6-6 (SEQ ID NO:421) had full length amino acid sequences as shown in FIGS. 8G-8H. Additionally, the sequences for each of the two polypeptides composing proteins V6-3, V6-7, V6-11, and V6-14 were the amino acid sequences according to SEQ ID NOS: 422-425, respectively. In the illustrated examples, scFv.sup.X and scFv.sup.Y had the variable chain orientation (in N.fwdarw.C direction) as shown, and the linker between the constant region to scFv.sup.Y in each case was SEQ ID NO:262. In addition, the CH2 constant domains were IgG.sub.1 variants having either the V263L or V273E substitution.

    TABLE-US-00047 TABLE 4-4 Additional exemplary bispecific proteins of formula (I) binding CD40 and mesothelin Protein scFv.sup.X V.sub.H scFv.sup.X V.sub.L CH2 scFv.sup.Y V.sub.H scFv.sup.Y V.sub.L V5-2 SEQ ID NO: 17 SEQ ID NO: 44 IgG.sub.1 SEQ ID NO: 120 SEQ ID NO: 137 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V263L (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V6-1 SEQ ID NO: 17 SEQ ID NO: 44 IgG.sub.1 SEQ ID NO: 120 SEQ ID NO: 141 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V273E (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V6-2 SEQ ID NO: 17 SEQ ID NO: 44 IgG.sub.1 SEQ ID NO: 120 SEQ ID NO: 141 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V263L (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V6-3 SEQ ID NO: 17 SEQ ID NO: 49 IgG.sub.1 SEQ ID NO: 120 SEQ ID NO: 137 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V273E (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V6-4 SEQ ID NO: 17 SEQ ID NO: 49 IgG.sub.1 SEQ ID NO: 120 SEQ ID NO: 137 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V263L (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V6-5 SEQ ID NO: 17 SEQ ID NO: 49 IgG.sub.1 SEQ ID NO: 120 SEQ ID NO: 141 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V273E (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V6-6 SEQ ID NO: 17 SEQ ID NO: 49 IgG.sub.1 SEQ ID NO: 120 SEQ ID NO: 141 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V263L (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V6-7 SEQ ID NO: 17 SEQ ID NO: 49 IgG.sub.1 SEQ ID NO: 129 SEQ ID NO: 143 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V273E (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V6-8 SEQ ID NO: 17 SEQ ID NO: 49 IgG.sub.1 SEQ ID NO: 129 SEQ ID NO: 143 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V263L (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V6-9 SEQ ID NO: 17 SEQ ID NO: 49 IgG.sub.1 SEQ ID NO: 129 SEQ ID NO: 143 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V273E (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V6-10 SEQ ID NO: 17 SEQ ID NO: 49 IgG.sub.1 SEQ ID NO: 129 SEQ ID NO: 143 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V263L (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V6-11 SEQ ID NO: 129 SEQ ID NO: 143 IgG.sub.1 SEQ ID NO: 17 SEQ ID NO: 49 (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V273E (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V6-12 SEQ ID NO: 129 SEQ ID NO: 143 IgG.sub.1 SEQ ID NO: 17 SEQ ID NO: 49 (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V263L (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V6-13 SEQ ID NO: 129 SEQ ID NO: 143 IgG.sub.1 SEQ ID NO: 17 SEQ ID NO: 49 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V263L (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V6-14 SEQ ID NO: 120 SEQ ID NO: 141 IgG.sub.1 SEQ ID NO: 17 SEQ ID NO: 49 (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V273E (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V6-15 SEQ ID NO: 23 SEQ ID NO: 49 IgG.sub.1 SEQ ID NO: 129 SEQ ID NO: 143 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V273E (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H) V6-16 SEQ ID NO: 23 SEQ ID NO: 49 IgG.sub.1 SEQ ID NO: 129 SEQ ID NO: 143 (V.sub.H.fwdarw.V.sub.L) (V.sub.H.fwdarw.V.sub.L) V263L (V.sub.L.fwdarw.V.sub.H) (V.sub.L.fwdarw.V.sub.H)

    [0350] Binding data for the exemplary bispecific proteins binding mesothelin and CD40 were determined by surface plasmon resonance as shown in Table 4-5 and Table 4-6. Binding proteins V5-3, V6-6, and V6-8 demonstrated binding to CD40 and mesothelin derived from humans or cynomolgus monkeys.

    TABLE-US-00048 TABLE 4-5 Exemplary bispecific protein binding human CD40 and mesothelin* Human CD40 Human MSLN Protein k.sub.a(1/M-s) k.sub.d (1/s) K.sub.D (M) k.sub.a(1/M-s) k.sub.d (1/s) K.sub.D (M) V5-2 1.7E+06 2.5E−01 1.5E−07 1.4E+04 2.8E−05 2.0E−09 V6-6 1.1E+06 1.4E−02 1.3E−08 1.3E+04 3.0E−05 2.4E−09 V6-8 9.7E+05 1.4E−02 1.4E−08 1.3E+05 1.5E−03 1.1E−08 *Values refer to exponential notation, e.g., 3.0E−09 = 3.0 × 10.sup.−9.

    TABLE-US-00049 TABLE 4-6 Exemplary bispecific protein binding cynomolgus CD40 and mesothelin* cynoCD40 cynoMSLN Protein k.sub.a(1/M-s) k.sub.d (1/s) K.sub.D (M) k.sub.a(1/M-s) k.sub.d (1/s) K.sub.D (M) V5-2 9.4E+05 1.1E−01 1.2E−07 7.0E+04 5.9E−05 8.4E−10 V6-6 1.4E+06 1.3E−02 9.5E−09 6.1E+04 5.3E−05 8.7E−10 V6-8 1.3E+06 1.3E−02 1.1E−08 Fast kinetics 1.3E−06 *Values refer to exponential notation, e.g., 3.0E−09 = 3.0 × 10.sup.−9.

    [0351] The results of conditional activation of CD40 by the exemplary bispecific proteins of formula (I) in the dendritic cell assay described in Example 1, co-cultured with HEK293 cells expressing cell-surface mesothelin, are shown in Table 4-7. Bispecific binding proteins V6-2, V6-5, and V6-6 demonstrated activation of dendritic cells in the presence of mesothelin as measured by production of IL-12p70.

    TABLE-US-00050 TABLE 4-7 Dendritic cell activation of CD40 by bispecific proteins in presence of mesothelin Protein Max. IL-12p70 (pg/mL) V6-2 150 V6-5 300 V6-6 300

    [0352] 8.4.3. Design and Generation of Bispecific Binding Proteins Having a Fab and an scFv Region

    [0353] Exemplary bispecific binding proteins of formula (I) similar to the format illustrated in FIG. 1B, having a Fab region and an scFv region, were prepared and evaluated (Table 4-8). The Fab regions were derived from mesothelin antibodies HuAM15 (proteins CF1 through CF10) and MSLN76923 (proteins CF11 through CF20). Both CH2 constant region variants V273E and V263L were prepared. In all cases, the orientation of the scFv regions derived from a CD40 antibody was V.sub.H.fwdarw.V.sub.L (in N.fwdarw.C direction), and the linker between the Fc region to the scFv was SEQ ID NO: 262. Accordingly, the heavy chains for proteins CF1 through CF20 shown in Table 4-8 below comprised the amino acid sequences according to SEQ ID NOS: 351 through 370, respectively. The corresponding light chains for CF1 through CF10 comprised the sequence according to SEQ ID NO: 371, and for CF11 through CF20 the sequence according to SEQ ID NO: 372.

    TABLE-US-00051 TABLE 4-8 Bispecific binding proteins of formula (I) with a Fab region and an scFv region Pro- Fab region scFv V.sub.H scFv V.sub.L tein V.sub.H, V.sub.L CH2 domain Identifier Identifier CF1 HuAM15 IgG.sub.1-V273E SEQ ID NO: 17 SEQ ID NO: 44 CF2 HuAM15 IgG.sub.1-V263L SEQ ID NO: 17 SEQ ID NO: 44 CF3 HuAM15 IgG.sub.1-V273E SEQ ID NO: 22 SEQ ID NO: 48 CF4 HuAM15 IgG.sub.1-V263L SEQ ID NO: 22 SEQ ID NO: 48 CF5 HuAM15 IgG.sub.1-V273E SEQ ID NO: 22 SEQ ID NO: 49 CF6 HuAM15 IgG.sub.1-V263L SEQ ID NO: 22 SEQ ID NO: 49 CF7 HuAM15 IgG.sub.1-V273E SEQ ID NO: 23 SEQ ID NO: 48 CF8 HuAM15 IgG.sub.1-V263L SEQ ID NO: 23 SEQ ID NO: 48 CF9 HuAM15 IgG.sub.1-V273E SEQ ID NO: 23 SEQ ID NO: 49 CF10 HuAM15 IgG.sub.1-V263L SEQ ID NO: 23 SEQ ID NO: 49 CF11 MSLN76923 IgG.sub.1-V273E SEQ ID NO: 17 SEQ ID NO: 44 CF12 MSLN76923 IgG.sub.1-V263L SEQ ID NO: 17 SEQ ID NO: 44 CF13 MSLN76923 IgG.sub.1-V273E SEQ ID NO: 22 SEQ ID NO: 48 CF14 MSLN76923 IgG.sub.1-V263L SEQ ID NO: 22 SEQ ID NO: 48 CF15 MSLN76923 IgG.sub.1-V273E SEQ ID NO: 22 SEQ ID NO: 49 CF16 MSLN76923 IgG.sub.1-V263L SEQ ID NO: 22 SEQ ID NO: 49 CF17 MSLN76923 IgG.sub.1-V273E SEQ ID NO: 23 SEQ ID NO: 48 CF18 MSLN76923 IgG.sub.1-V263L SEQ ID NO: 23 SEQ ID NO: 48 CF19 MSLN76923 IgG.sub.1-V273E SEQ ID NO: 23 SEQ ID NO: 49 CF20 MSLN76923 IgG.sub.1-V263L SEQ ID NO: 23 SEQ ID NO: 49

    [0354] Exemplary binding data was determined using surface plasmon resonance for bispecific proteins having a Fab region binding mesothelin and an scFv region binding CD40. Data for human CD40 and human mesothelin are shown in Table 4-9, and for cynomolgus CD40 and cynomolgus mesothelin in Table 4-10. Proteins CF1, CF3, and CF19 afford significant binding affinity for both human CD40 and human mesothelin (K.sub.D<4.0×10.sup.−7 M). The three proteins also provide significant binding to cynomolgus CD40 (K.sub.D<1.5×10.sup.−7 M). Additionally, while the bispecific binding proteins derived from HuAM15 (CF1 and CF3) bound significantly to cynomolgus mesothelin (K.sub.D≦2.9×10.sup.−10 M), CF19 protein with the variable regions derived from antibody MSLN76923 did not bind cynomolgus mesothelin or only bound weakly.

    TABLE-US-00052 TABLE 4-9 Binding of exemplary bispecific proteins to human CD40 and mesothelin* Human CD40 Human MSLN Protein k.sub.a(1/M-s) k.sub.d (1/s) K.sub.D (M) k.sub.a(1/M-s) k.sub.d (1/s) K.sub.D (M) CF1 6.8E+05 2.6E−01 3.9E−07 5.2E+04 2.4E−05 4.7E−10 CF3 6.9E+05 9.6E−03 1.4E−08 5.2E+04 3.1E−05 5.9E−10 CF19 4.3E+05 1.7E−02 4.0E−08 3.0E+05 8.1E−03 2.8E−08 *Values refer to exponential notation, e.g., 3.0E−09 = 3.0 × 10.sup.−9.

    TABLE-US-00053 TABLE 4-10 Binding of exemplary bispecific proteins to cynomolgus CD40 and mesothelin* Cyno CD40 Cyno MSLN Protein k.sub.a(1/M-s) k.sub.d (1/s) K.sub.D (M) k.sub.a(1/M-s) k.sub.d (1/s) K.sub.D (M) CF1 Fast kinetics 1.5E−07 3.1E+05 7.1E−05 2.3E−10 CF3 1.3E+06 1.1E−02 8.3E−09 2.8E+05 8.2E−05 2.9E−10 CF19 8.1E+05 1.8E−02 2.2E−08 Weak or no binding *Values refer to exponential notation, e.g., 3.0E−09 = 3.0 × 10.sup.−9.

    [0355] The exemplary bispecific binding proteins with a Fab region and an scFv region also exhibit conditional activation of CD40 in the presence of cell-surface mesothelin in dendritic cells. Table 4-11 summarizes the data obtained with these exemplary bispecific binding proteins with a mesothelin Fab region and a CD40 scFv region, that show mesothelin-dependent activation of dendritic cells. Bispecific binding proteins CF1, CF3, CF4, CF5, and CF9 demonstrate conditional activation of dendritic cells as measured by production of IL-12p70.

    TABLE-US-00054 TABLE 4-11 Dendritic cell activity of bispecific proteins having a Fab and an scFv region Protein Max. IL-12p70 (pg/mL) CF1 100 CF3 75 CF4 50 CF5 60 CF9 120

    Example 5—Production and Purification of an Exemplary CD40/Mesothelin Bispecific Binding Protein

    [0356] The following protocol is applicable to the production and purification of exemplary bispecific binding proteins of formula (I) binding CD40 and mesothelin as described herein, for example, any one of SEQ ID NOS: 401-412. A frozen vial of the cell bank is thawed, diluted with growth medium, and centrifuged to remove the cryopreservation medium. The cells are then re-suspended in fresh growth medium, GIA-1 (a chemically defined media from Life Technologies Gibco), supplemented with 6 mM glutamine (Gln). The cell suspension is cultured under 5% CO.sub.2 at 36° C. The volume is adjusted by the addition of fresh medium at defined intervals in appropriately sized cell culture containers to sufficient biomass for the inoculation of a 110 L seed bioreactor. At a predetermined viable cell density, the culture from the seed bioreactor is used to inoculate the 3000 L short-fill bioreactor. In both the seed and the short-fill bioreactor, temperature and DO are controlled at set points of 36° C. and 40% respectively. Additionally, in both bioreactors, the pH set point of 6.9 is maintained through the addition of CO.sub.2 or sodium hydroxide. The culture remains in the short-fill stage until a predetermined viable cell density is reached.

    [0357] The production culture is performed in the 3000 L bioreactor as a fed-batch process. Production medium (GIA-1 supplemented with 6 mM Gln) is added to the short-fill culture to initiate the production stage. The temperature starts at the set point of 36° C. then shifts to 33° C. at the defined condition. DO is maintained at a set point of 40%. The pH set point of 6.9 is maintained through the addition of CO.sub.2 or sodium hydroxide. Antifoam is added as needed for foam mitigation.

    [0358] At a predetermined viable cell density, bolus additions of feed medium (1.5×JCL-5, a chemically defined feed medium from Life Technologies Gibco) are added to the bioreactor in predefined volumes according to a predefined feeding schedule. A 40% glucose feed solution is also added to the production bioreactor when the glucose concentration falls below predetermined concentrations. Harvest of the production bioreactor is initiated when the cell viability reaches ≦70% or 14 days after the start of the production bioreactor stage, whichever occurs first.

    [0359] The crude cell culture harvest undergoes clarification, Protein A chromatography, viral inactivation, Q membrane filtration, and hydroxyapatite chromatography. The partially purified material is then further purified by nanofiltration, ultrafiltration, and diafiltration to afford a drug substance that is formulated by addition of pharmaceutical excipients. The drug substance is then bottled and stored.

    [0360] The crude cell culture is cooled, and then pressure transferred through a continuous disc stack centrifuge. The centrate flows directly from the centrifuge into the depth filters and Sartorius Sartopore 2 polishing filters. After processing the culture fluid, the depth filters and final filters are flushed with buffered solution to collect the binding protein. The combined filtrate is collected, and is stored at from 2° C. to 12° C.

    [0361] Protein A chromatography is achieved with a MabSelect SuRe column. Prior to use, a post-storage rinse step is performed on the MabSelect SuRe column using equilibration buffer. The column is equilibrated and the chilled clarified harvest is loaded directly onto the column. A typical maximum column load per cycle is 40 g product per liter of resin. After loading, two washes are performed on the column, followed by elution with 50 mM acetic acid, pH 3.0. The collection of the elution starts and ends based on OD. Between cycles, the column is post elution washed and regenerated with equilibration buffer, and post regeneration washed with 0.2 M sodium hydroxide before equilibration for the next cycle.

    [0362] The pH of the Protein A eluate is adjusted to 3.5±0.1 using phosphoric acid and held for 30 to 60 minutes. The viral inactivated Protein A eluate is neutralized with arginine and Tris. The material is then passed through Millipore XOHC filters and CR40 Activated carbon filters, in series, followed by Sartorius Sartopore 2 filter. Q Membrane filter is placed in-line following the Sartorius Sartopore 2 filter. A second Sartorius Sartopore 2 is placed in line following the Q Membrane. Following the completion of the load, the filters are flushed with ≧128 CV of Q membrane of buffer to recover any product remaining on the filters. The Q filtrate and wash is collected, and is held at from 2° C. to 25° C.

    [0363] The CaPure hydroxyapatite column is operated in a bind-and-elute mode. The column is equilibrated with 10 mM sodium phosphate, pH 6.7 for 5 column volumes at 200 cm/hr linear flow rate. The Q filter flow-through pool comprising the bispecific binding protein is loaded directly onto the column at 100 cm/hr and at approximately 30 g/L capacity. After loading, the column is washed with 3 column volumes of the equilibration buffer, then eluted with elution buffer of 25 mM sodium phosphate, 114 mM sodium chloride, pH 6.7.

    [0364] Nanofiltration is performed using Sartorius Sartopore 2 0.1 μm pre-filters, followed by Planova 20N viral filter. The filter train is rinsed with water for injection and 10 mM sodium phosphate, pH 6.7, prior to viral filtration of product. The hydroxyapatite column eluate is then pumped through the filter train, targeting 14 psig inlet pressures on the Planova filter.

    [0365] The nanofiltrate is concentrated to a target concentration, followed by diafiltration with 30 kD Millipore Pellicon 3 Ultracel regenerated cellulose membranes performed at from 18° C. to 25° C. by 10 diavolumes of diafiltration buffer, 10 mM phosphate, pH 7.5. After diafiltration, the retentate is collected and the system is rinsed with the diafiltration buffer. The retentate is then diluted with excipient solution to a final formulation.

    Example 6—Design and In Vitro Evaluation of Bispecific Binding Proteins of Formula (I) Binding CD40 and Other Tumor Antigens

    [0366] Binding domains to additional tumor antigens were evaluated for their ability to direct CD40 activation in a bispecific binding protein of formula (I). CD40/nectin-4, CD40/PSMA, and CD40/EGFR bispecific binding proteins were constructed using domains against the tumor antigens nectin-4 (clone 66.3), PSMA (clone SAM3.1) and EGFR (clone G30Y), respectively. In all cases, the CD40 domain in the bispecific molecules was adapted from the anti-human CD40 humanized antibody huAb6-1 (clone AD163.162.1) (TABLE 6-1). In all the examples, the CD40 domain is huAb6-1 in V.sub.H.fwdarw.V.sub.L direction, the linker linking the CH3 domain to the scFv comprises SEQ ID NO:251, and the constant regions are derived from human IgG.sub.1 having the V273Y substitution. Orientation of the tumor antigen variable domains within the scFv are shown (in N.fwdarw.C direction). The amino acid sequences in TABLE 6-1 are shown in FIGS. 10B-10D.

    TABLE-US-00055 TABLE 6-1 Bispecific proteins binding CD40 and tumor antigens Tumor Tumor Protein domain Clone antigen Direction Identifier R87 Nectin-4 66.3 V.sub.H.fwdarw.V.sub.L SEQ ID NO: 413 R88 Nectin-4 66.3 V.sub.L.fwdarw.V.sub.H SEQ ID NO: 414 R89 PSMA SAM3.1 V.sub.H.fwdarw.V.sub.L SEQ ID NO: 415 R90 PSMA SAM3.1 V.sub.L.fwdarw.V.sub.H SEQ ID NO: 416 A16 EGFR G30Y V.sub.H.fwdarw.V.sub.L SEQ ID NO: 417 A17 EGFR G30Y V.sub.L.fwdarw.V.sub.H SEQ ID NO: 418

    [0367] In illustrative examples of a bispecific binding protein of formula (I), the enhancement of B cell activation is observed with the exemplary binding protein R87 that binds to CD40 and nectin-4 (FIG. 11A), as well as the exemplary bispecific protein R89 that binds to CD40 and PSMA (FIG. 11B). FIG. 11A illustrates that R87 induced minimal B cell proliferation similarly to isotype matched negative control when incubated with B cells alone (upper graph), or B cells cultured with HEK293 cells (middle graph). When B cells cultured with HEK293 cells expressing nectin-4 (lower graph), R87 enhanced B cell proliferation to the level significantly higher than that stimulated by anti-CD40 antibody huAb6-1. Similarly, in FIG. 11B, R89 effects little to no B cell proliferation in the co-cultures with 4T1 cells without PSMA, but significantly enhanced B cell proliferation when B cells co-cultured with 4T1 cells expressing PSMA.

    Example 7—Design and In Vitro Evaluation of Bispecific Proteins of Formula (I) Binding 4-1BB and Tumor Antigens

    [0368] Anti-4-1BB rat antibodies TABBY106 and TABBY107 were humanized according to methods known in the art to provide humanized antibodies having variable heavy and light chains shown in FIGS. 7D-7E. Antibody variable regions were humanized using a structure-guided method as described by Queen et al. (Proc. Natl. Acad. Sci. USA, 1989; 86:10029-10033). Human V region frameworks to be used as acceptors for rodent CDR regions were chosen based on sequence homology, and a homology model of the variable region was constructed in silico. Amino acids in the V regions predicted to have contact with the CDR regions were substituted with the corresponding residues of the rodent antibody where different.

    [0369] Antibody hu106-1 has a V.sub.H of SEQ ID NO:69 and a V.sub.L of SEQ ID NO:89, while hu107-1 has a V.sub.H of SEQ ID NO:71 and a V.sub.L of SEQ ID NO:94. Both hu106-1 and hu107-1 display human IgG.sub.1 constant regions with L234A and L235A variants. Humanized hu107-1 showed similar binding profiles by surface plasmon resonance (Table 7-1) compared with that of rat TABBY107 as described in Example 3.

    TABLE-US-00056 TABLE 7-1 Humanized 4-1BB antibody binding kinetics* Human 4-1BB Mouse 4-1BB Antibody k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) hu106-1 5.7E+05 7.4E−02 1.3E−07 2.2E+06 3.6E−02 1.7E−08 hu107-1 4.1E+05 6.5E−05 1.6E−10 2.4E+05 1.3E−03 5.2E−09 *Values refer to exponential notation, e.g., 3.0E−09 = 3.0 × 10.sup.−9.

    [0370] Exemplary proteins of formula (I) binding 4-1BB and mesothelin were generated from the V.sub.H and V.sub.L of the humanized anti-4-1BB antibodies along with the amino acid sequences for anti-mesothelin antibodies discussed above. Amino acid sequences for exemplary binding proteins are shown in FIG. 8I-8M.

    [0371] Exemplary binding data was determined using surface plasmon resonance for bispecific protein of formula (I) comprising humanized 4-1BB and humanized MSLN binding regions (Table 7-2). Cross-reactivity to human, cynomolgus monkey and mouse 4-1BB was retained as well as binding to human mesothelin.

    TABLE-US-00057 TABLE 7-2 Binding of exemplary bispecific proteins to 4-1BB and mesothelin* Species Receptor K.sub.D (M) human Cynomolgus mouse Protein 4-1BB 4-1BB 4-1BB human MSLN hu106MSLN-1 8.0E−07 4.2E−07 7.1E−08 4.7E−09 hu106MSLN-2 6.7E−07 6.6E−07 7.4E−08 4.5E−09 hu106MSLN-3 2.3E−06 4.1E−06 1.1E−07 1.4E−09 hu106MSLN-4 1.4E−06 9.4E−07 1.4E−07 1.4E−09 hu107MSLN-1 1.4E−09 5.5E−10 2.9E−08 3.6E−09 hu107MSLN-2 3.6E−09 1.4E−09 4.4E−08 3.1E−09 hu107MSLN-3 7.1E−09 4.5E−09 4.9E−08 1.5E−09 hu107MSLN-4 6.1E−09 3.3E−09 5.2E−08 1.4E−09 *Values refer to exponential notation, e.g., 3.0E−09 = 3.0 × 10.sup.−9.

    [0372] The binding activity of exemplary binding proteins to endogenous human 4-1BB and mesothelin, as well as their respective EC.sub.50s, were demonstrated with FACS binding to HEK293 cells transfected with human 4-1BB or mesothelin using test binding protein concentrations of 0.05 nM, 0.14 nM, 0.4 nM, 1.2 nM, 3.7 nM, 11 nM, 33 nM, and 100 nM. HEK293 cells expressing human 4-1BB (upper graph) or mesothelin (lower graph) were used (FIGS. 12A-12B). Anti-4-1BB antibodies hu106 IgG.sub.1 or hu106 V273E, sharing the V.sub.H and V.sub.L of hu106-1 with different huIgG1 constant regions (“106.1x1x,” upper left, either with human IgG.sub.1 or huIgG.sub.1 V273E variant, respectively), or hu107 V273E, sharing the V.sub.H and V.sub.L of hu107-1 with a different huIgG1 constant region (“107.1x1x,” lower graphs, with huIgG.sub.1 V273E), or mesothelin antibody HuAM15 (upper right) were used as controls. With both 4-1BB and mesothelin, the exemplary binding proteins of the disclosure demonstrate binding to the desired targets.

    [0373] In HEK293 cells transfected with human 4-1BB and luciferase reporter gene driven by NF-κB, exemplary bispecific binding proteins of formula (I) binding to 4-1BB and mesothelin showed 4-1BB agonist activity only in the presence of an Fc cross-linker to help clustering of the 4-1BB receptor (upper graph) and did not show activity in the absence of an Fc cross-linker, Goat anti-human Fcγ antibody (lower graph) (FIG. 13). The NF-κB HEK293 cell assay was performed according to the 4-1BB NF-κB reporter assay described in Example 3.

    [0374] The exemplary bispecific binding proteins of formula (I) that bind to 4-1BB and mesothelin demonstrate cell-surface human mesothelin-dependent activation of NF-κB. As shown in FIGS. 14A-14B, the bispecific binding proteins exhibited activation of NF-κB in HEK293 cells expressing cell-surface mesothelin (upper graphs), while little to no activation was observed in dosing the bispecific binding proteins in HEK293 cells treated with mock transfectant (lower graphs).

    [0375] Additionally, exemplary bispecific binding proteins of formula (I) binding to both 4-1BB and mesothelin can also induce 4-1BB-mediated specific activation of CD8+ T cells. As shown in FIGS. 15A-15B, activation of CD8+ T cells was measured by T-cell proliferation (FIG. 15A) or interferon-gamma production (FIG. 15B) according to the assays described in Example 3 demonstrates conditional activation of CD8+ T cells in the presence of CT26 cells expressing mesothelin but not in co-cultures containing CT26 cells that do not express mesothelin. In a similar manner, CD8+ T cells were stimulated by bispecific proteins binding 4-1BB and mesothelin in the presence of PC3 cells expressing mesothelin (upper graph) but not in PC3 cells alone (lower graph) (FIG. 15C).

    [0376] Exemplary bispecific proteins of formula (I) binding 4-1BB and PSMA were generated from the V.sub.H and V.sub.L of the humanized anti-4-1BB antibodies along with the amino acid sequences for anti-mouse PSMA antibodies. Amino acid sequences for anti-PSMA antibodies are shown in FIGS. 10A, 10J, and 10K, and for exemplary binding proteins in FIG. 10L.

    [0377] The bispecific binding proteins of formula (I) bind to both 4-1BB and PSMA and demonstrated cell-surface mouse PSMA-dependent activation of NF-κB. As shown in FIGS. 15D-15E, the bispecific binding proteins exhibited activation of NF-κB in HEK293 cells expressing cell-surface PSMA (FIG. 15D). Additionally, hu106mPSMA-1 and hu106mPSMA-2 showed activation in CD8+ T cells in the presence of CT26 cells expressing PSMA but not in co-cultures containing CT26 cells that do not express PSMA (FIG. 15E).

    [0378] Exemplary bispecific proteins of formula (I) binding 4-1BB and B7-H4 were generated from the V.sub.H and V.sub.L of the humanized anti-4-1BB antibodies along with the amino acid sequences for anti-B7-H4 antibodies. Amino acid sequences for anti-B7-H4 antibodies are shown in FIGS. 10E-10G, and for exemplary binding proteins in FIG. 10H-10I.

    [0379] A bispecific binding protein of the DVD-Ig format according to FIG. 2A was generated with the 4-1BB variable domains of hu106-1 and the mesothelin domains of HuAM15. However, the 4-1BB DVD-Ig bispecific protein did not show conditional activation of CD8+ T cells in CT26 expressing mesothelin co-cultured with CD8+ T cells, in contrast to the bispecific binding proteins of formula (I) described above.

    Example 8—CD40/Tumor Antigen Bispecific Proteins Show In Vitro Antitumor Activity in Cancer Cell Culture

    [0380] Exemplary bispecific binding proteins of formula (I) demonstrated a conditional immune activation that mediated killing of tumor cells in culture. An assay was performed which tested the ability of exemplary CD40/MSLN bispecific binding proteins in stimulating human autologous moDCs to drive T cells to kill a tumor cell line expressing MSLN. In this assay, PC3 tumor cells stably expressing MSLN and green fluorescent protein (GFP) were cultured with autologous DC and T cells, and treated with control or bispecific molecules. After being treated for 4 days, the live cells were quantified based on the green fluorescence. As shown in FIG. 16, the viable cell number was lower in the culture treated with exemplary bispecific binding proteins that bind both CD40 and mesothelin as compared to isotype matched negative control antibody, suggesting CD40/MSLN bispecific binding proteins of formula (I) exhibited in vitro antitumor activity.

    Example 9—CD40/Tumor Antigen Bispecific Proteins Show In Vivo Antitumor Activity in Prophylactic Cancer Models

    [0381] Bispecific proteins of formula (I) binding to CD40 and a tumor antigen have shown to prevent the growth of tumor cells expressing a cell-surface tumor antigen in prophylactic cancer animal models. Exemplary bispecific binding proteins were evaluated for their ability to inhibit the growth of PC3 xenograft tumors expressing the cognate tumor antigen. NSG mice were inoculated subcutaneously with a mixture of purified T cells (5×10.sup.5), autologous DCs (1×10.sup.5), and PC3-MSLN, PC3-Nectin-4, or PC3-PSMA cells (1×10.sup.6). A single dose of the anti-CD40 antibodies or control antibodies at 1 mg/kg, or a bispecific protein of formula (I) at 1 mg/kg, was injected intraperitoneally immediately after inoculation. Tumor volumes were measured every other day with calipers. Each data point represents the mean tumor volume of a group of eight animals.

    [0382] As shown in FIGS. 17A-17B, exemplary binding proteins binding to CD40 and either mesothelin (MSLN), PSMA or nectin-4 exhibited a more potent effect on preventing the growth of PC3 human prostate cancer tumors expressing the respective cell-surface antigens, as compared to an isotype control. In both the model with PC3 cells expressing MSLN (FIG. 17A, upper graph) and with PC3 cells expressing nectin-4 (FIG. 17B, upper graph), the bispecific proteins h24 and R87, respectively, showed better or similar antitumor activity as compared with anti-CD40 antibody huAb6-1. Bispecific protein B89 binding CD40 and PSMA afforded an antitumor activity better than that observed with its corresponding anti-CD40 antibody huAb6-1 (FIG. 17A, lower graph). By contrast, in PC3 cells that do not express mesothelin (FIG. 17B, lower graph), the bispecific binding protein h24 demonstrated effects that are not statistically different than an isotype control antibody.

    Example 10—Evaluation of Exemplary CD40/Mesothelin Bispecific Proteins in Mouse Syngeneic Tumor Model

    [0383] To test whether CD40/MSLN bispecific proteins could enhance the therapeutic window, a proof-of-concept formula (I) molecule LB-1 was generated targeting murine CD40 and MSLN. LB-1 contains N-terminal scFv (V.sub.H.fwdarw.V.sub.L) derived from 1C10 (an agonist anti-CD40 monoclonal antibody that binds to mouse CD40), followed by a murine IgG1 hinge, heavy chain CH2/CH3, and the C-terminal scFv domain (V.sub.H.fwdarw.V.sub.L) derived from anti-MSLN monoclonal antibody clone MOR06626 (see, US Patent Appl. No. 2011/0027268) with cross-reactivity to both human and murine MSLN. The amino acid sequence of LB-1 (SEQ ID NO:400) is shown in FIG. 8A.

    [0384] The binding data of mouse bispecific formula (I) protein LB-1 are summarized in Table 10-1. While LB-1 shows some attenuation of EC.sub.50 binding to CD40 and mesothelin as compared to antibodies 1C10 and MOR06626 with murine IgG1(mIgG1), respectively, maximum binding was preserved for each target.

    TABLE-US-00058 TABLE 10-1 Antigen binding of mouse bispecific binding protein LB-1 MSLN binding CD40 binding Maximum Maximum Binding Binding EC.sub.50 (% MOR06626 EC.sub.50 (% 1C10 Protein (μg/mL) binding) (μg/mL) binding) LB-1 1.39 100 2.75 100 anti-MSLN antibody 0.06 100 — — (MOR06626 mIgG1) anti-CD40 antibody — 0.21 100 (1C10 mIgG1)

    [0385] 8.10.1. CD40/Mesothelin Bispecific Protein LB-1 Shows In Vivo Antitumor Activity in Mouse Syngeneic Tumor Model

    [0386] A murine tumor cell line 4T1 stably expressing MSLN (4T1-MSLN) was used to establish tumors in syngeneic immunocompetent Balb/c mice. The efficacy and toxicity of exemplary bispecific binding protein of formula (I) LB-1 was compared with anti-CD40 1C10 mIgG1 in the 4T1-MSLN syngeneic mouse model. Mice bearing 4T1-MSLN tumors (50 mm.sup.3) were randomized into the following eight groups: a murine isotype control group at 5 mg/kg, an anti-MSLN antibody MOR06626 mIgG1 at 5 mg/kg, and groups for anti-CD40 antibody 1C10 mIgG1 and for bispecific protein LB-1, each with three dosing groups at 1.25, 2.5 and 5 mg/kg. Dosing started at randomization with 1qw (i.e., once weekly dosing) for 3 weeks. Blood samples were taken at 24 hours after the 2nd dose, and were subject to VetScan analysis for ALT level. Serum cytokines were measured by Luminex cytokine multiplex assay (Millipore).

    [0387] Both anti-CD40 antibody 1C10 mIgG1 and bispecific binding protein LB-1 inhibited 4T1-MSLN tumor growth in a dose-dependent manner, while the anti-MSLN antibody MOR06626 mIgG1 had comparable antitumor activity to antibody isotype (FIG. 18). At the 5 mg/kg doses, both bispecific binding protein LB-1 and anti-CD40 antibody 1C10 mIgG1 showed significantly higher inhibition of tumor growth compared with isotype control.

    [0388] 8.10.2. CD40/Mesothelin Bispecific Protein LB-1 Shows Reduced Toxicity In Vivo Compared with Literature Anti-CD40 Antibody 1C10

    [0389] In the experiment described above, the exemplary bispecific protein LB-1 that activated CD40 in the presence of cell-surface mesothelin showed an improved liver toxicity as compared with the anti-CD40 antibody 1C10 at the same dose. At the efficacious dose level of 5 mg/kg, anti-CD40 antibody 1C10 induced liver toxicity, as indicated by the elevated levels of the liver enzyme alanine aminotransferase (ALT) in circulation. At the same dose level, the bispecific formula (I) molecule LB-1 achieved anti-tumor efficacy without causing elevation of ALT in circulation. As shown in FIG. 19, the liver toxicity of bispecific protein LB-1 is lower than that of antibody 1C10 at 5 mg/kg, as measured by elevated ALT levels in mouse liver.

    [0390] Additionally, at 5 mg/kg of each, the bispecific binding protein LB-1 did not exhibit the elevated serum cytokine levels demonstrated upon administration of anti-CD40 antibody 1C10 at the same dose. As shown in FIG. 20, elevated cytokine levels of interleukin-6 (IL-6) and TNF-alpha (“TNFa”) (left), as well as keratinocyte chemoattractant (KC), interferon gamma-induced protein 10 (IP-10) and monokine induced by interferon-gamma (MIG) (right), were observed with 1C10 as compared with dosing of LB-1 or control mouse IgG1.

    [0391] Further pharmacodynamic analysis indicated that while both anti-CD40 antibody 1C10 and bispecific protein LB-1 activated circulating B cells, LB-1 was less potent in circulation and its activity appeared to be more localized to the tumor draining lymph node. Furthermore, bispecific protein LB-1 enhanced tumor specific T-cell responses (data not shown), likely due to the tumor-localized activation of antigen presenting cells.

    Example 11—Evaluation of Exemplary 4-1BB/PSMA Bispecific Proteins in Balb/c Mouse Tumor Model

    [0392] Exemplary bispecific proteins of formula (I) Hu106mPSMA-3 (SEQ ID NO:447) and Hu106mPSMA-4 (SEQ ID NO:448) each exhibited binding to both mouse 4-1BB and PSMA. As a result, they were selected for further evaluation in an in vivo experiment to demonstrate target engagement. The 4-1BB FACS binding data obtained according to the assay described in Section 8.3.3.2 is summarized in Table 11-1 below. Anti-4-1BB antibodies hu106-1 with the muIgG1 constant region (“hu106-1 mIgG1”) and hu106-1 mIgG1 bearing T252M in the constant region (“hu106-1 T252M mIgG1”), as well as anti-4-1BB binding proteins Hu106mPSMA-3 and Hu106mPSMA-4, all exhibited in vitro binding of about 1 nM.

    TABLE-US-00059 TABLE 11-1 Binding of Antibody or Bispecific Binding Protein to Mouse 4-1BB by FACS hu106-1 hu106-1 T252M Sample mIgG1 mIgG1 Hu106mPSMA-3 Hu106mPSMA-4 EC.sub.50 (nM) 0.69 0.95 1.1 1.0

    [0393] For the purpose of simplifying protein purification only, hu106-1 mIgG1 T252M, Hu106mPSMA-3, and Hu106mPSMA-4 all contained the T252M amino acid substitution in the CH2 domain to enhance affinity to protein A. See Nagaoka, M. et al. Protein Eng., vol. 16(4), pages 243-245 (2003). Hu106mPSMA-4 differed from Hu106mPSMA-3 in that the former binding protein possessed the additional amino acid substitution N297A. This mutation has previously been shown to decrease binding of anti-CD3 antibodies to mouse FcγR. See Chao, et al. Immunological Investigations, vol. 38, pages 76-92 (2009). As exemplified by the comparison of hu106-1 mIgG1 and hu106-1 T252M mIgG1 in Table 11-1 above, the mutation had a minimal effect on 4-1BB binding by FACS.

    [0394] The prototype bispecific proteins binding 4-1BB and PSMA also demonstrated anti-PSMA properties as measured by FACS and summarized in Table 11-2 below. The PSMA binding activity of the bispecific proteins Hu106mPSMA-3 and Hu106mPSMA-4 were comparable to that for PSMA antibody SAM103 having murine IgG2a isotype with the L234A/L235A double mutation (“mIgG2a AA”).

    TABLE-US-00060 TABLE 11-2 Binding of Antibody or Bispecific Binding Protein to Mouse PSMA by FACS Sample SAM103 mIgG2a AA Hu106mPSMA-3 Hu106mPSMA-4 EC.sub.50 (nM) 0.62 1.4 1.3

    [0395] A murine tumor cell line CT26 stably expressing PSMA (CT26-PSMA) was used to establish tumors in syngeneic immunocompetent Balb/c mice. The efficacy and toxicity of exemplary bispecific binding proteins of formula (I) Hu106mPSMA-3 and Hu106mPSMA-4 were compared with anti-4-1BB antibody hu106-1 mIgG1 T252M in the CT26-PSMA syngeneic mouse model. Mice bearing CT26-PSMA tumors (100 mm.sup.3) were randomized into the following groups (n=8 per group): a murine isotype control group at 10 mg/kg, an anti-4-1BB antibody hu106-1 mIgG1 T252M at 10 mg/kg, and groups for bispecific proteins Hu106mPSMA-3 and Hu106mPSMA-4, each at 10.7 mg/kg to account for the higher molecular weight of the bispecific protein. Dosing of antibody or binding protein was performed three times total at days 18, 20, and 22 post-inoculation. Blood samples were taken at 24 hours after the third dose, and were subject to VetScan analysis for ALT level. Serum cytokines were measured by Luminex® cytokine multiplex assay (Millipore).

    [0396] Subsequent to three doses at 10 mg/kg of the isotype antibody TIB191 mIgG1, the CT26-PSMA tumors continued to grow without significant change to the rate of tumor growth (FIG. 21). By contrast, the groups of mice treated with anti-4-1BB antibody hu106-1 mIgG1 T252M, or with the bispecific binding protein Hu106mPSMA-3 or Hu106mPSMA-4, all exhibited in vivo efficacy as measured by a decrease in the rate of tumor growth as compared to treatment with isotype. Data from individual animals showed a uniform lack of efficacy for the isotype treated animals (FIG. 22A, upper graph), but reduction in the rate of tumor growth in mice treated with antibody hu106-1 mIgG1 T252M (FIG. 22A, lower graph) or the bispecific protein Hu106mPSMA-3 (FIG. 22B, upper graph). Additionally, six out of eight animals exhibited attenuation in the rate of tumor growth after treatment with bispecific protein Hu106mPSMA-4 (FIG. 22B, lower graph).

    [0397] Proinflammatory cytokine release was measured by serum levels of monocyte chemoattractant protein-1 (“MCP-1”), granulocyte macrophage colony-stimulating factor (“GM-CSF”), interleukin-6 (“IL-6”), and keratinocyte chemoattractant (“KC”) after the third and final dose of antibody or binding protein (FIGS. 23A and 23B). The levels of serum MCP-1, GM-CSF, IL-6, and KC were lower after treatment of bispecific protein Hu106mPSMA-3 or Hu106mPSMA-4 as compared with treatment of antibody hu106-1 mIgG1 T252M. For these proinflammatory cytokines, the serum cytokine levels after bispecific protein treatment were comparable to serum levels of the cytokine after treatment with isotype.

    [0398] Mouse liver samples were also evaluated for CD45+ immune cell infiltration as an indication of potential liver toxicity. Liver samples from mice were harvested and fixed in 10% formalin overnight to be processed and embedded in paraffin blocks. Slides were cut from the blocks and stained with a rat anti-mouse CD45 Ab (Becton Dickenson, #550539) by immunohistochemistry. Stained slides were scanned and CD45 positive immune cells on each scanned image were quantitated by HALO image analysis (Indica Labs, Corrales, N. Mex., USA).

    [0399] The livers (n=7-9 per group) were collected on day 26 to evaluate immune cell infiltration that may suggest toxicity. Compared to the group treated with antibody hu106-1 mIgG1 T252M, there was decreased CD45+ immune cell infiltration in the livers of the mice treated with Hu106mPSMA-3 and Hu106mPSMA-4 (FIG. 23C).

    9. EMBODIMENTS

    [0400] 1. A bispecific binding protein comprising two polypeptides of formula (I):


    X-H-Fc-L-scFv.sup.Y  (I),

    wherein X is scFv.sup.X or a Fab region, X specifically binds a first antigen and scFv.sup.Y specifically binds a second antigen, H is a hinge region, Fc comprises CH2 and CH3 regions of an immunoglobulin, L is a polypeptide linker, scFv.sup.X and scFv.sup.Y are each independently a single chain variable fragment, one of the two antigens is an immunomodulatory protein and the other is a tumor antigen.
    2. The bispecific binding protein of embodiment 1, wherein the immunomodulatory protein is one selected from tumor necrosis factor receptor superfamily proteins and CD28 family proteins.
    3. The bispecific binding protein of embodiment 1 or 2, wherein the immunomodulatory protein is selected from CD40, 4-1BB, TNFR2, ICOS, TRAILR1, and TRAILR2.
    4. The bispecific binding protein of any one of embodiments 1 to 3, wherein the tumor antigen is a cell-surface tumor antigen.
    5. The bispecific binding protein of any one of embodiments 1 to 4, wherein the tumor antigen is from brain cancer, breast cancer, gastric cancer, lung cancer, melanoma, ovarian cancer, pancreatic cancer and prostate cancer.
    6. The bispecific binding protein of any one of embodiments 1 to 5, wherein the tumor antigen is selected from mesothelin, nectin-4, epidermal growth factor receptor, prostate-specific membrane antigen, and B7-H4.
    7. The bispecific binding protein of any one of embodiments 1 to 6, wherein X is scFv.sup.X.
    8. The bispecific binding protein of embodiment 7, wherein the first antigen is an immunomodulatory protein and the second antigen is a tumor antigen.
    9. The bispecific binding protein of embodiment 7 or 8, wherein either scFv.sup.X or scFv.sup.Y comprises a V.sub.H region selected from:

    TABLE-US-00061 (SEQ ID NO: 10) EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAPGQGLEWIG NIDPSNGETHYNQKFKDRATLTVDKSTSTAYMELSSLRSEDTAVYYCAR ERIYYSGSTYDGYFDVWGQGTTVTVSS (SEQ ID NO: 11) EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAPGQGLEWIG NIDPSNGETHYNQKFKDRVTITVDKSTSTAYMELSSLRSEDTAVYYCAR ERIYYSGSTYDGYFDVWGQGTTVTVSS (SEQ ID NO: 12) EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAPGQGLEWIG NIDPSNGETHYAQKFQGRVTITVDKSTSTAYMELSSLRSEDTAVYYCAR ERIYYSGSTYDGYFDVWGQGTTVTVSS (SEQ ID NO: 13) EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYINWVRQAPGQGLEWIG WIFPGSGSVYCNEQFKGRATLTVDRSTSTAYMELSSLRSEDTAVYFCAS SLGKFAYWGQGTLVTVSS (SEQ ID NO: 14) EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYINWVRQAPGQGLEWIG WIFPGSGSVYSNEQFKGRATLTVDRSTSTAYMELSSLRSEDTAVYFCAS SLGKFAYWGQGTLVTVSS (SEQ ID NO: 15) EVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYYINWVRQAPGQGLEWIG WIFPGSGSVYCNEQFKGRVTITVDKSTSTAYMELSSLRSEDTAVYYCAS SLGKFAYWGQGTLVTVSS (SEQ ID NO: 16) EVQLQESGPGLVKPSETLSLTCTVSGYSITSNYYWNWIRQPPGKGLEWMG YIRYDGSNNYNPSLKNRITISRDTSKNQFSLKLSSVTAADTAVYYCARLD YWGQGTTVTVSS (SEQ ID NO: 17) EVQLQESGPGLVKPSETLSLTCTVSGYSITSNYYWNWIRQPPGKGLEWMG YIRYDGSNNYNPSLKNRVTISRDTSKNQFSLKLSSVTAADTAVYYCARLD YWGQGTTVTVSS (SEQ ID NO: 18) EVQLQESGPGLVKPSETLSLTCTVSGYSISSNYYWNWIRQPPGKGLEWMG YIRYDGSNNYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCARLD YWGQGTTVTVSS (SEQ ID NO: 19) EVQLVESGGGLVKPGETLSLTCTVSGYSITSNYYWNWIRQPPGKGLEWMG YIRYDGSNNYNPSLKGRVTISRDTSKNQFYLKLSSVTAADTAVYYCARLD YWGQGTTVTVSS (SEQ ID NO: 20) EVQLVESGGGLVQPGGSLRLSCAASGYSITSNYYWNWIRQPPGKGLEWMG YIRYDGSNNYNPSLKGRVTISRDTSKNQLYLKLSSVTAADTAVYYCARLD YWGQGTLVTVSS (SEQ ID NO: 21) EVQLVESGGGLVKPGETLILTCTVSGYDITSNYYWNWIRQPPGKGLEWMG YIRYDGSNNYNPSLKGRVTISRDTSKNQFYLKLSSVTAADTAVYYCARLD YWGQGTTVTVSS (SEQ ID NO: 22) QVQLQESGPGLVKPSETLSLTCTVSGYSITSNYYWNWIRQPPGKGLEWMG YIRYDGSNNYNPSLKNRITISRDTSKNQFSLKLSSVTAADTAVYYCARLD YWGQGTLVTVSS (SEQ ID NO: 23) EVQLVESGGGLVQPGGSLRLSCAASGYSITSNYYWNWVRQAPGKGLEWMG YIRYDGSNNYNPSLKNRITISRDTSKNTFYLQMNSLRAEDTAVYYCARLD YWGQGTLVTVSS

    [0401] and a V.sub.L region selected from:

    TABLE-US-00062 (SEQ ID NO: 41) DIQLTQSPSFLSASVGDRVTITCSASSSLSYMHWYQQKPGKSPKRWIY DTSKLASGVPSRFSGSGSGTEYTLTISSLQPEDFATYYCQQWSSNPWT FGGGTKVEIK (SEQ ID NO: 42) DIQMTQSPSSLSASVGDRVTITCKASQSVVTAVAWYQQKPGKSPKLLIY SASNRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQQYSSYPYTF GGGTKVEIK (SEQ ID NO: 43) DAVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWFLQKPGQSP QLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYFCLQVTH VPFTFGQGTKLEIK (SEQ ID NO: 44) DAVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWYLQKPGQSP QLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQVTH VPFTFGQGTKLEIK (SEQ ID NO: 45) DAVMTQTPLSLSVTEGQPASISCRSSQSLENTNGNTFLNWYLQKPGQSP QLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQVTH VPFTFGQGTKLEIK (SEQ ID NO: 46) DAVMTQTPLSLAVLPGQPASISCRSSQSLENTNGNTFLNWYLQKPGQSP QLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQVTH VPFTFGQGTKLEIK (SEQ ID NO: 47) DIQMTQSPSSLSASVGDRVTITCRSSQSLENTNGNTFLNWYQQKPGKAP KLLIYRVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQVTH VPFTFGQGTKVEIK (SEQ ID NO: 48) DAVMTQSPLSLPVTLGEPASISCRSSQSLENTNGNTFLNWFQQKPGQSP RLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQVTH VPFTFGQGTKLEIK (SEQ ID NO: 49) DAQMTQSPSSLSASVGDRVTITCRSSQSLENTNGNTFLNWFQQKPGKAP KLLIYRVSNRFSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQVTH VPFTFGQGTKLEIK (SEQ ID NO: 50) DIVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWYLQKPGQSP QLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQVTH VPFTFGQGTKLEIK (SEQ ID NO: 51) DVVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWYLQKPGQSP QLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQVTH VPFTFGQGTKLEIK
    10. The bispecific binding protein of embodiment 7 or 8, wherein either scFv.sup.X or scFv.sup.Y comprises a V.sub.H region selected from:

    TABLE-US-00063 Sequence (N.fwdarw.C) Identifier EVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYYIYWVRQAPGQGLEWIGNI (SEQ ID NO: 69) WPGNGGTFYGEKFMGRATFTADTSTSTAYMELSSLRSEDTAVYYCARRPD YSGDDYFDYWGQGTLVTVSS EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYYIYWVRQAPGKGLEWIGNI (SEQ ID NO: 70) WPGNGGTFYGEKFMGRATFSADTSKNTAYLQMNSLRAEDTAVYYCARRP DYSGDDYFDYWGQGTLVTVSS EVQLVQSGAEVKKPGSSVKVSCKASDYTFNDYWVSWVRQAPGQGLEWIGEI (SEQ ID NO: 71) YPNSGATNFNGKFRGRATLTVDNSASTAYMELSSLRSEDTAVYYCTREYTR DWFAYWGQGTLVTVSS EVQLVESGGGLVQPGGSLRLSCAASGYTENDYWVSWVRQAPGKGLEWIGEI (SEQ ID NO: 72) YPNSGATNFNGKFRGRATLSVDNSKNTAYLQMNSLRAEDTAVYYCTREYT RDWFAYWGQGTLVTVSS

    [0402] and a V.sub.L region selected from:

    TABLE-US-00064 Sequence (N.fwdarw.C) Identifier NVMLTQPHSVSESPGKTVTISCKLNSGNIGSYYVHWYQQRPGSSPTTMIYRD (SEQ ID NO: 89) DKRPDGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCHSYDSTITPVFGGGT KLTVL QVVLTQPPSASGTPGQRVTISCKLNSGNIGSYYVHWYQQLPGTAPKTMIYRD (SEQ ID NO: 90) DKRPDGVPDRFSGSSSSNSASLAISGLQSEDEADYYCHSYDSTITPVFGGGTK LTVL SVELTQPPSVSVSPGQTARITCKLNSGNIGSYYVHWYQQKPGQAPVTMIYRD (SEQ ID NO: 91) DKRPDGIPERFSGSSDSSSNSAFLTISGVQAEDEADYYCHSYDSTITPVFGGGT KLTVL EVVLTQPPSLSASPGASARLTCKLNSGNIGSYYVHWYQQKPGSPPRTMIYRD (SEQ ID NO: 92) DKRPDGVPSRFSGSKDSSSNSAFLLISGLQSEDEADYYCHSYDSTITPVFGGGT KLTVL DVQLTQSPSSLSASVGDRVTITCKLNSGNIGSYYVHWYQQKPGKAPKTMIYR (SEQ ID NO: 93) DDKRPDGVPSRFSGSGDSSSNSAFLTISSLQPEDFATYYCHSYDSTITPVFGQG TKVEIK DVVLTQSPLSLPVTLGQPASISCRSSQSLLDSDGNTYLYWFQQRPGQSPRRLI (SEQ ID NO: 94) YLVSNLGSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQPTHAPYTFGQ GTKLEIK DVQLTQSPSSLSASVGDRVTITCRSSQSLLDSDGNTYLYWFQQKPGKAPKRLI (SEQ ID NO: 95) YLVSNLGSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCMQPTHAPYTFGQG TKVEIK
    11. The bispecific binding protein of any one of embodiments 7 to 10, wherein either scFv.sup.X or scFv.sup.Y comprises a V.sub.H region selected from:

    TABLE-US-00065 Sequence (N.fwdarw.C) Identifier EVQLVQSGAEVKEPGASVKVSCKASGDTFNRYYVHWARQAPGQGLEWM (SEQ ID NO: 107) GIINPSGVSTTYAQKFQGRVTMTRDTPTNTVYMELGSLRPEDTAVYFCAES RGSGYNYFAMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFKRYYVQWVRQAPGQGLEWM (SEQ ID NO: 108) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAES RGSGYNYFAMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGYTFKRYYVHWVRQAPGQGLEWM (SEQ ID NO: 109) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAES RGSGYNYFAMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFKRYYVHWVRQAPGQGLEWM (SEQ ID NO: 110) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAES RGSGYNYFAMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPGQGLEWM (SEQ ID NO: 111) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAES RIPGYNNFAMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPGQGLEWM (SEQ ID NO: 112) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAEV RGSGYNYFAMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPGQGLEWM (SEQ ID NO: 113) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAES RVPGYNNFAMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPGQGLEWM (SEQ ID NO: 114) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAEV RGSGYNYFGMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPGQGLEWM (SEQ ID NO: 115) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAES RGSGYNYFAMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVQWVRQAPGQGLEWM (SEQ ID NO: 116) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAET RGSGYNYFGMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFKRYYMHWVRQAPGQGLEWM (SEQ ID NO: 117) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAEV RGSGFNYFGMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFHRYYVHWVRQAPGQGLEWM (SEQ ID NO: 118) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAEV RGSGFNYFGMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVQWVRQAPGQGLEWM (SEQ ID NO: 119) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAET RGSGFNYFGMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFKRYYVHWVRQAPGQGLEWM (SEQ ID NO: 120) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAEV RGSGFNYFGMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVQWVRQAPGQGLEWM (SEQ ID NO: 121) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAES RVPGYNIFAMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVHWVRQAPGQGLEWM (SEQ ID NO: 122) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAET RGSGYNYFGMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFKRYYAHWVRQAPGQGLEWM (SEQ ID NO: 123) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAES RLPGYNAFAMDVWGQGTLVTVSS EVQLVQSGAEVKKPGASVKVSCKASGDTFNRYYVQWVRQAPGQGLEWM (SEQ ID NO: 124) GIINPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAET RGPGFNYFGMDVWGQGTLVTVSS EVQLVQSGAGLVQPGGSVRVSCAASGFTFKRYYVHWVRQAPGKGLEWM (SEQ ID NO: 125) GIINPSGVSTTYAQKFQGRVTISRDNSKNTLYMQLNSLRAEDTAVYYCAR VRGSGFNYFGMDVWGQGTLVTVSS EVQLVESGAGLVKPGESVKVSCAASGFTFKRYYVHWVRQAPGKGLEWM (SEQ ID NO: 126) GIINPSGVSTTYAQKFQGRVTISRDNSTNTLYMELNSLRAEDTAVYYCARV RGSGFNYFGMDVWGQGTLVTVSS EVQLVESGAGVVKPGESVKVSCAASGFTFKRYYVHWVRQAPGKGLEWM (SEQ ID NO: 127) GIINPSGVSTTYAQKFQGRVTMSRDTSTSTVYMELNSLRAEDTAVYYCAR VRGSGFNYFGMDVWGQGTLVTVSS EVQLVESGGGLVQPGGSLRLSCAASGFTFKRYYVHWVRQAPGKGLEWVG (SEQ ID NO: 128) IINPSGVSTTYAQKFQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVR GSGFNYFGMDVWGQGTLVTVSS EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA (SEQ ID NO: 129) ISGGGGRTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREE MAFRAYRFDIWGQGTLVTVSS

    [0403] and a V.sub.L region selected from:

    TABLE-US-00066 Sequence (N.fwdarw.C) Identifier SYELTQPPSVSVSPGQTADITCSGDKLGDKYASWYQQKPGQSPVLVIYQD (SEQ ID NO: 136) NRRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSDTYVFGPG TKVTVL SYELTQPPSVSVSPGQTASITCSGDKLGDKYASWYQQKPGQSPVLVIYQD (SEQ ID NO: 137) NRRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSDTYVFGTG TKVTVL SYELTQPPSVSVSPGQTASITCSGDNLGYKYVSWYQQKPGQSPVLVIYQD (SEQ ID NO: 138) HRRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDTDTYVFGTG TKVTVL SYELTQPPSVSVSPGQTASITCSGDKLGDKYASWYQQKPGQSPVLVIYQD (SEQ ID NO: 139) NRRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQVWDSDTYVFGTG TKVTVL SYELTQPPSVSVSPGQTASITCSGDMLGYQYGSWYQQKPGQSPVLVIYQD (SEQ ID NO: 140) NRRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDGDAFVFGTG TKVTVL SYELTQPPSVSVAPGQTARISCSGDKLGDKYASWYQQKPGQAPVLVIYQD (SEQ ID NO: 141) NRRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCQAWDSDTYVFGGG TKLTVL DIQMTQSPSSLSASVGDRVTITCSGDKLGDKYASWYQQKPGKAPKLLIYQ (SEQ ID NO: 142) DNRRPSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQAWDSDTYVFGQG TKVEIK DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAA (SEQ ID NO: 143) SSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYITPLTFGGGTK VEIK
    12. The bispecific binding protein of any one of embodiments 1 to 11, wherein the two polypeptides each comprise the amino acid sequence of any one of SEQ ID NOS: 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 419, 420, and 421.
    13. A polypeptide of formula (II):


    scFv.sup.X-H-Fc-L-scFv.sup.Y  (II),

    wherein L is a polypeptide linker, H is a hinge region, Fc comprises CH2 and CH3 regions of an immunoglobulin, scFv.sup.X and scFv.sup.Y are each independently a single chain variable fragment, scFv.sup.X specifically binds a first antigen, scFv.sup.Y specifically binds a second antigen, and one of the two antigens is an immunomodulatory protein and the other is a tumor antigen.
    14. The polypeptide of embodiment 13, wherein the first antigen is an immunomodulatory protein and the second antigen is a tumor antigen.
    15. The polypeptide of embodiment 13 or 14, wherein the immunomodulatory protein is CD40 or 4-1BB.
    16. The polypeptide of any one of embodiments 13 to 15, wherein the tumor antigen is selected from mesothelin, nectin-4, epidermal growth factor receptor, prostate-specific membrane antigen, and B7-H4.
    17. The polypeptide of any one of embodiments 13 to 16 wherein scFv.sup.X- has the structure of formula (V) or (VI):


    V.sub.H.sup.X-L.sup.X-V.sub.L.sup.X-  (V),


    V.sub.L.sup.X-L.sup.X-V.sub.H.sup.X-  (VI),

    wherein V.sub.H.sup.X is a variable heavy chain, V.sub.L.sup.X is a variable light chain, and L.sup.X is a polypeptide linker.
    18. The polypeptide of any one of embodiments 13 to 17 wherein -scFv.sup.Y has the structure of formula (VII) or (VIII):


    -V.sub.L.sup.Y-L.sup.Y-V.sub.H.sup.Y  (VII),


    -V.sub.H.sup.Y-L.sup.Y-V.sub.L.sup.Y  (VIII),

    wherein V.sub.H.sup.Y is a variable heavy chain, V.sub.L.sup.Y is a variable light chain, and L.sup.Y is a polypeptide linker.
    19. The polypeptide of any one of embodiments 13 to 18 wherein scFv.sup.X- has the structure of formula (V), and -scFv.sup.Y has the structure of formula (VII).
    20. The polypeptide of any one of embodiments 13 to 19, wherein the amino acid sequence of V.sub.H.sup.X is: EVQLQESGPGLVKPSETLSLTCTVSGYSITSNYYWNWIRQPPGKGLEWMGYIRYDGSNNYN PSLKNRVTISRDTSKNQFSLKLSSVTAADTAVYYCARLDYWGQGTTVTVSS (SEQ ID NO:17); and the amino acid of V.sub.L.sup.X is DAVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWYLQKPGQSPQLLIYRVSNRFSG VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQVTHVPFTFGQGTKLEIK (SEQ ID NO:44).
    21. The polypeptide of any one of embodiments 13 to 20, wherein the amino acid sequence of V.sub.H.sup.Y is:

    TABLE-US-00067 (SEQ ID NO: 120) EVQLVQSGAEVKKPGASVKVSCKASGDTFKRYYVHWVRQAPGQGLEWMGH NPSGVSTTYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAEVRG SGFNYFGMDVWGQGTLVTVSS;
    and the amino acid sequence of V.sub.L.sup.Y is:

    TABLE-US-00068 (SEQ ID NO: 137) SYELTQPPSVSVSPGQTASITCSGDKLGDKYASWYQQKPGQSPVLVIYQD NRRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSDTYVFGTG TKVTVL.
    22. The polypeptide of any one of embodiments 13 to 21, wherein L has an amino acid sequence comprising:

    TABLE-US-00069 (SEQ ID NO: 251) VDGASSPVNVSSPSVQDI; (SEQ ID NO: 253) VDGASSPVNVGSPSVQDI;  (SEQ ID NO: 254) GASSPVNVSSPSV; (SEQ ID NO: 255) GGGGSGGGNGTGSGGGGS;  (SEQ ID NO: 256) LSAGGHGGLDNDTSAFHL; (SEQ ID NO: 257) SDKTHTSPPSPAPESSGG;  (SEQ ID NO: 258) VTTTDFQIQTEMAATMET;  (SEQ ID NO: 259) DFLPTTAQPTKKSTLKKR;  (SEQ ID NO: 260) TESRSPPAENEVSTPMQA;  (SEQ ID NO: 261) GGGGSGGGNGSGSGGGGS;  or (SEQ ID NO: 262) GGGGSGGGSGGGSGGGGS.
    23. The polypeptide of any one of embodiments 13 to 22, wherein L.sup.X and L.sup.Y each has an amino acid sequence comprising:

    TABLE-US-00070 (SEQ ID NO: 301) GGGGSGGGGSGGGGS; (SEQ ID NO: 302) GGGGSGGGGSGGGGSGGGGS;  (SEQ ID NO: 303) GGGGSGGGGSGGGGSGGGGSGGGGS;  (SEQ ID NO: 304) GGGGSGGGGSGGGGSGGGGSGGGGSGGGGS; (SEQ ID NO: 305) GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS;  or (SEQ ID NO: 306) GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS.
    24. A polypeptide of formula (III):


    Fab-H-Fc-L-scFv.sup.Y  (III),

    wherein L is a polypeptide linker, H is a hinge region, Fc comprises CH2 and CH3 regions of an immunoglobulin, Fab is a fragment antigen-binding region, scFv.sup.Y is a single chain variable fragment, Fab specifically binds a first antigen, scFv.sup.Y specifically binds a second antigen, and the first antigen is a tumor antigen and the second antigen is an immunomodulatory protein.
    25. A polypeptide of formula (IV):


    V.sub.H-CH1-H-Fc-L-scFv.sup.Y  (IV),

    wherein L is a polypeptide linker, V.sub.H-CH1, when combined with a peptide comprising V.sub.L-CL, specifically binds a first antigen, CH1 is a CH1 constant domain, CL is a light chain constant domain, H is a hinge region, Fc comprises CH2 and CH3 regions of an immunoglobulin, V.sub.H is a variable heavy chain, V.sub.L is a variable light chain, scFv.sup.Y is a single chain variable fragment, scFv.sup.Y specifically binds a second antigen, and the first antigen is a tumor antigen and the second antigen is an immunomodulatory protein.
    26. The polypeptide of embodiment 24 or 25 wherein -scFv.sup.Y has the structure of formula (VII) or (VIII):


    -V.sub.L.sup.Y-L.sup.Y-V.sub.H.sup.Y  (VII),


    -V.sub.H.sup.Y-L.sup.Y-V.sub.L.sup.Y  (VIII),

    wherein V.sub.H.sup.Y is a variable heavy chain, V.sub.L.sup.Y is a variable light chain, and L.sup.Y is a polypeptide linker.
    27. The polypeptide of embodiment 26, wherein the amino acid sequence of V.sub.H.sup.Y is: EVQLQESGPGLVKPSETLSLTCTVSGYSITSNYYWNWIRQPPGKGLEWMGYIRYDGSNNYN PSLKNRVTISRDTSKNQFSLKLSSVTAADTAVYYCARLDYWGQGTTVTVSS (SEQ ID NO:17); and the amino acid sequence of V.sub.L.sup.Y is DAVMTQTPLSLSVTPGQPASISCRSSQSLENTNGNTFLNWYLQKPGQSPQLLIYRVSNRFSG VPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQVTHVPFTFGQGTKLEIK (SEQ ID NO:44).
    28. The polypeptide of embodiment 26 or 27, wherein L has an amino acid sequence comprising: VDGASSPVNVSSPSVQDI (SEQ ID NO:251); VDGASSPVNVGSPSVQDI (SEQ ID NO:253); GASSPVNVSSPSV (SEQ ID NO:254); GGGGSGGGNGTGSGGGGS (SEQ ID NO:255); LSAGGHGGLDNDTSAFHL (SEQ ID NO:256); SDKTHTSPPSPAPESSGG (SEQ ID NO:257); VTTTDFQIQTEMAATMET (SEQ ID NO:258); DFLPTTAQPTKKSTLKKR (SEQ ID NO:259); TESRSPPAENEVSTPMQA (SEQ ID NO:260); GGGGSGGGNGSGSGGGGS (SEQ ID NO:261); or GGGGSGGGSGGGSGGGGS (SEQ ID NO:262).
    29. The polypeptide of any one of embodiments 26 to 28, wherein L.sup.Y has an amino acid sequence comprising: GGGGSGGGGSGGGGS (SEQ ID NO:301); GGGGSGGGGSGGGGSGGGGS (SEQ ID NO:302); GGGGSGGGGSGGGGSGGGGSGGGGS (SEQ ID NO:303); GGGGSGGGGSGGGGSGGGGSGGGGSGGGGS (SEQ ID NO:304); GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS (SEQ ID NO:305); or GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS (SEQ ID NO:306).
    30. The polypeptide of any one of embodiments 1 to 29, wherein the Fc comprises a CH2 region from an IgG.sub.1, IgG2, or IgG.sub.4.
    31. The polypeptide of embodiment 30, wherein the CH2 region is a variant human IgG.sub.1 comprising the amino acid substitution V263L or V273E.
    32. The polypeptide of any one of embodiments 1 to 31, wherein H is a variant IgG.sub.1 hinge that comprises the amino acid substitution C220S.
    33. The polypeptide of any one of embodiments 1 to 32, wherein Fc comprises the amino acid substitutions D356E and L358M.
    34. A pharmaceutical composition comprising a bispecific binding protein of any one of embodiments 1 to 12, and a pharmaceutically acceptable carrier.
    35. A nucleic acid comprising a nucleotide sequence encoding a bispecific binding protein of any one of embodiments 1 to 12.
    36. A vector comprising the nucleic acid of embodiment 35.
    37. A prokaryotic host cell transformed with the vector of embodiment 36.
    38. A eukaryotic host cell transformed with the vector of embodiment 36.
    39. A eukaryotic host cell engineered to express the nucleic acid of embodiment 35.
    40. The eukaryotic host cell of embodiment 39 which is a mammalian host cell.
    41. A method of producing a bispecific binding protein, comprising: (a) culturing the host cell of embodiment 38 or embodiment 39 and (b) recovering the protein.
    42. A method of activating the immune system, comprising administering to a patient in need thereof a bispecific binding protein of any one of embodiment 1 to 12, or a pharmaceutical composition according to embodiment 34.
    43. A method of treating a cancer, comprising administering to a patient in need thereof a bispecific binding protein of any one of embodiments 1 to 12, or a pharmaceutical composition according to embodiment 34.

    [0404] All publications, patents, patent applications and other documents cited in this application are hereby incorporated by reference in their entireties for all purposes to the same extent as if each individual publication, patent, patent application or other document were individually indicated to be incorporated by reference for all purposes.

    [0405] While various specific embodiments have been illustrated and described, it will be appreciated that various changes can be made without departing from the spirit and scope of the invention(s).