TUMOUR BIOMARKERS FOR IMMUNOTHERAPY

20230176060 · 2023-06-08

    Inventors

    Cpc classification

    International classification

    Abstract

    Biomarkers for prognosis of tumours, in hepatocellular carcinoma and other cancers. Measurement of biomarkers for prescription of anticancer immunotherapy targeted against ICOS+ regulatory T cells (TReg), e.g., selecting patients for treatment with an anti-ICOS antibody. Biomarkers comprising: (i) ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, (ii) mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, (iii) proportion of FOXP3 positive cells which are ICOS positive, and (iv) density of ICOS positive cells.

    Claims

    1. A method for prognosis of a cancerous solid tumour in a patient, comprising providing a sample of tumour core tissue obtained from the patient, determining one or more of the following biomarkers in said sample: (i) ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, (ii) mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, (iii) proportion of FOXP3 positive cells which are ICOS positive, and (iv) density of ICOS positive cells, and providing a prognosis for the patient based on said one or more biomarkers, wherein a shorter duration of patient survival, recurrence free survival (RFS), progression free survival (PFS) or time to progression (TTP) is indicated by a greater ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, a shorter mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, a higher proportion of FOXP3 positive cells which are ICOS positive, and/or a higher density of ICOS positive cells.

    2. A method according to claim 1, comprising determining the ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, and comparing said ratio against a reference value, wherein a ratio higher than the reference value indicates a prognosis of shorter duration of survival, RFS, PFS or TTP.

    3. A method according to claim 2, wherein the tumour is hepatocellular carcinoma and the reference value is a ratio of 0.1 ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells.

    4. A method according to any of claims 1 to 3, comprising determining the mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, and comparing said distance against a reference value, wherein a distance less than the reference value indicates a prognosis of shorter duration of survival, RFS, PFS or TTP.

    5. A method according to claim 4, wherein the tumour is hepatocellular carcinoma and the reference value is a mean distance of 105 μm between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell.

    6. A method according to any of claims 1 to 5, comprising determining the proportion of FOXP3 positive cells which are ICOS positive, and comparing said proportion against a reference value, wherein a proportion higher than the reference value indicates a prognosis of shorter duration of survival, RFS, PFS or TTP.

    7. A method according to claim 6, wherein the tumour is hepatocellular carcinoma and the reference value is a half of FOXP3 positive cells being ICOS positive.

    8. A method according to any of claims 1 to 7, comprising determining the density of ICOS positive cells, and comparing said density against a reference value, wherein a density higher than the reference value indicates a prognosis of shorter duration of survival, RFS, PFS or TTP.

    9. A method according to claim 7, wherein the tumour is hepatocellular carcinoma and the reference value is a density of 120 ICOS positive cells per mm.sup.2.

    10. A method according to claim 7, wherein the tumour is hepatocellular carcinoma associated with hepatitis B virus infection or is stage 2 or later hepatocellular carcinoma, and wherein the reference value is a density of 100 ICOS positive cells per mm.sup.2.

    11. A method according to any of claims 1 to 10, comprising determining from said one or more biomarkers that the patient has a prognosis of shorter duration of survival, RFS, PFS or TTP.

    12. A method according to claim 11, comprising determining the ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, and comparing said ratio against a reference value, wherein a ratio higher than the reference value indicates a prognosis of shorter duration of survival, RFS, PFS or TTP, determining that said ratio is higher than the reference value, and providing a prognosis of shorter duration of survival, RFS, PFS or TTP.

    13. A method according to any of claims 1 to 10, comprising determining from said one or more biomarkers that the patient has a prognosis of longer duration of survival, RFS, PFS or TTP.

    14. A method according to claim 13, comprising determining the ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, and comparing said ratio against a reference value, wherein a ratio higher than the reference value indicates a prognosis of shorter duration of survival, RFS, PFS or TTP, determining that said ratio is lower than the reference value, and providing a prognosis of longer duration of survival, RFS, PFS or TTP.

    15. Use of a biomarker for prognosis of a cancerous solid tumour in a patient, wherein the biomarker is one or more of the following as determined in tumour core tissue from the patient: (i) ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, (ii) mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, (iii) proportion of FOXP3 positive cells which are ICOS positive, and (iv) density of ICOS positive cells.

    16. A method of determining likelihood of a cancerous solid tumour in a patient to respond to an anti-ICOS and/or anti-TReg immunotherapeutic agent, comprising providing a sample of tumour core tissue obtained from the patient, and determining one or more of the following biomarkers in said sample: (i) ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, (ii) mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, (iii) proportion of FOXP3 positive cells which are ICOS positive, and (iv) density of ICOS positive cells, wherein a greater likelihood of the patient to respond to the immunotherapeutic agent is indicated by a greater ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, a shorter mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, a higher proportion of FOXP3 positive cells which are ICOS positive, and/or a higher density of ICOS positive cells.

    17. A method according to claim 16, comprising determining the ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, and comparing said number against a reference value, wherein a ratio higher than the reference value indicates an increased likelihood of responding to the immunotherapeutic agent.

    18. A method according to claim 17, wherein the tumour is hepatocellular carcinoma and the reference value is a ratio of 0.1 ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells.

    19. A method according to any of claims 16 to 18, comprising determining the mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, and comparing said distance against a reference value, wherein a distance less than the reference value indicates an increased likelihood of responding to the immunotherapeutic agent.

    20. A method according to claim 19, wherein the tumour is hepatocellular carcinoma and the reference value is a mean distance of 105 μm between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell.

    21. A method according to any of claims 16 to 20, comprising determining the proportion of FOXP3 positive cells which are ICOS positive, and comparing said proportion against a reference value, wherein a proportion higher than the reference value indicates an increased likelihood of responding to the immunotherapeutic agent.

    22. A method according to claim 21, wherein the tumour is hepatocellular carcinoma and the reference value is a half of FOXP3 positive cells being ICOS positive.

    23. A method according to any of claims 16 to 22, comprising determining the density of ICOS positive cells, and comparing said density against a reference value, wherein a density higher than the reference value indicates an increased likelihood of responding to the immunotherapeutic agent.

    24. A method according to claim 23, wherein the tumour is hepatocellular carcinoma and the reference value is a density of 120 ICOS positive cells per mm.sup.2.

    25. A method according to claim 23, wherein the tumour is hepatocellular carcinoma associated with hepatitis B virus infection or is stage 2 or later hepatocellular carcinoma, and wherein the reference value is a density of 100 ICOS positive cells per mm.sup.2.

    26. A method according to any of claims 16 to 25, comprising identifying the patient as having an increased likelihood of responding to the immunotherapeutic agent and optionally thereby selecting an anti-ICOS and/or anti-TReg immunotherapeutic agent for treatment of said patient.

    27. A method according to claim 26, comprising determining the ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, comparing said ratio against a reference value, wherein a ratio higher than the reference value indicates an increased likelihood of responding to the immunotherapeutic agent, determining that said ratio is higher than the reference value, and thereby identifying the patient as having an increased likelihood of responding to the immunotherapeutic agent.

    28. A method according to claim 26 or claim 27, comprising administering the anti-ICOS and/or anti-TReg immunotherapeutic agent to said patient.

    29. Use of a biomarker for determining likelihood of a cancerous tumour in a patient to respond to an anti-ICOS and/or anti-TReg immunotherapeutic agent, wherein the biomarker is one or more of the following as determined in tumour core tissue from the patient: (i) ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, (ii) mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, (iii) proportion of FOXP3 positive cells which are ICOS positive, and (iv) density of ICOS positive cells.

    30. A method of treating a cancerous solid tumour in a patient, wherein the tumour has been determined to comprise one or more of the following biomarkers: ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, wherein said ratio is higher than a reference value, a mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, wherein said distance is less than a reference value, a proportion of FOXP3 positive cells which are ICOS positive, wherein said proportion is higher than a reference value, and a density of ICOS positive cells, wherein said density is higher than a reference value, the method comprising administering an anti-ICOS and/or anti-TReg immunotherapeutic agent to the patient.

    31. An anti-ICOS and/or anti-TReg immunotherapeutic agent for use in a method of treating a cancerous solid tumour in a patient, wherein the tumour has been determined to comprise one or more of the following biomarkers: a ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, wherein said ratio is higher than a reference value, a mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, wherein said distance is less than a reference value, a proportion of FOXP3 positive cells which are ICOS positive, wherein said proportion is higher than a reference value, and a density of ICOS positive cells, wherein said density is higher than a reference value.

    32. A method according to claim 30, or an agent for use according to claim 31, wherein the tumour is hepatocellular carcinoma and the tumour has been determined to comprise the following biomarkers: a ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, wherein said ratio is higher than 0.1, a mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, wherein said distance is less than 105 μm, a proportion of FOXP3 positive cells which are ICOS positive, wherein said proportion is higher than half, and a density of ICOS positive cells, wherein said density is higher than 120 cells per mm.sup.2.

    33. A method according to claim 30, or an agent for use according to claim 31, wherein the tumour is hepatocellular carcinoma associated with hepatitis B virus infection or is grade 2 or later hepatocellular carcinoma, and wherein the tumour has been determined to comprise the following biomarkers: a ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, wherein said ratio is higher than 0.1, a mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, wherein said distance is less than 105 μm, a proportion of FOXP3 positive cells which are ICOS positive, wherein said proportion is higher than half, and a density of ICOS positive cells, wherein said density is higher than 100 cells per mm.sup.2.

    34. An anti-ICOS and/or anti-TReg immunotherapeutic agent for use in a method of treating a cancerous solid tumour in a patient, the method comprising selecting an anti-ICOS and/or anti-TReg immunotherapeutic agent for treatment of a patient as defined in claim 26, and administering the anti-ICOS and/or anti-TReg immunotherapeutic agent to the patient.

    35. A method of monitoring a patient's response to an anti-ICOS and/or anti-TReg immunotherapeutic agent for a cancerous solid tumour, comprising providing a sample of tumour core tissue obtained from a patient who has received an anti-ICOS and/or anti-TReg immunotherapeutic agent, determining one or more of the following biomarkers in said sample: (i) ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, (ii) mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, (iii) proportion of FOXP3 positive cells which are ICOS positive, and (iv) density of ICOS positive cells, comparing said one or more biomarkers in said sample against the same one or more biomarkers in a sample of tumour core tissue obtained from the patient prior to administration of said immunotherapeutic agent, and determining whether a change has occurred in said one or more biomarkers and thereby assessing whether the patient is responding to the immunotherapeutic agent, wherein response is indicated by one or more of the following changes from the sample prior to administration of said immunotherapeutic agent: a reduction in the ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, an increase in the mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, a reduction in the proportion of FOXP3 positive cells which are ICOS positive, and/or a reduction in the density of ICOS positive cells.

    36. A method according to claim 35, comprising measuring a reduction in the ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells compared with prior to therapy, and prescribing continued treatment with the anti-ICOS and/or anti-TReg immunotherapeutic agent for the patient.

    37. A method according to claim 35 or claim 36, comprising measuring an increase in the mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, and prescribing continued treatment with the anti-ICOS and/or anti-TReg immunotherapeutic agent for the patient.

    38. A method according to any of claims 35 to 37, comprising measuring a reduction in the proportion of FOXP3 positive cells which are ICOS positive, and prescribing continued treatment with the anti-ICOS and/or anti-TReg immunotherapeutic agent for the patient.

    39. A method according to any of claims 35 to 38, comprising measuring a reduction in the density of ICOS positive cells, and prescribing continued treatment with the anti-ICOS and/or anti-TReg immunotherapeutic agent for the patient.

    40. Use of a biomarker for monitoring a patient's response to an anti-ICOS and/or anti-TReg immunotherapeutic agent for a cancerous solid tumour, wherein the biomarker is one or more of the following as determined in tumour core tissue from the patient: (i) ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, (ii) mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, (iii) proportion of FOXP3 positive cells which are ICOS positive, and (iv) density of ICOS positive cells, wherein response to the immunotherapeutic agent is indicated by one or more of the following changes as compared with a sample of tumour core tissue obtained prior to administration of the immunotherapeutic agent: a reduction in the ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, an increase in the mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, a reduction in the proportion of FOXP3 positive cells which are ICOS positive, and a reduction in the density of ICOS positive cells.

    41. A method of identifying a reference value for classifying patients with cancerous solid tumours according to their predicted prognosis or predicted response to an anti-ICOS and/or anti-TReg immunotherapeutic agent, comprising providing samples of tumour core tissue obtained from each of a population of patients with cancerous solid tumours of the same type for whom disease outcome is known or response to the anti-ICOS and/or anti-TReg immunotherapeutic agent is known, determining one or more of the following biomarkers in each of said samples: (i) ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, (ii) mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, (iii) proportion of FOXP3 positive cells which are ICOS positive, and (iv) density of ICOS positive cells, pairing data for each of said one or more biomarkers with data for disease outcome or response to the anti-ICOS and/or anti-TReg immunotherapeutic agent in each patient, and grouping data for each of said one or more biomarkers to identify a numerical cut-off which defines two groups of statistically significant data for disease outcome or response to the anti-ICOS and/or anti-TReg immunotherapeutic agent, wherein said cut-off represents a reference value for classifying patients with the same type of cancerous solid tumours according to their predicted prognosis or predicted response to the anti-ICOS and/or anti-TReg immunotherapeutic agent.

    42. A method according to claim 41, wherein the samples are obtained from a population of patients with liver cancer, renal cell cancer, head and neck cancer, melanoma, non-small cell lung cancer, bladder cancer, ovarian cancer, cervical cancer, gastric cancer, pancreatic cancer, breast cancer (including triple negative breast cancer), carcinoma, leiomyosarcoma, anal cancer, squamous cell cancer and oesophageal cancer.

    43. A method according to claim 42, wherein the samples are obtained from a population of patients with hepatocellular carcinoma.

    44. A method, use or an immunotherapeutic agent for use according to any of claims 16 to 43, wherein the immunotherapeutic agent is an anti-ICOS antibody.

    45. A method, use or an immunotherapeutic agent for use according to any of claims 16 to 44, wherein the immunotherapeutic agent selectively depletes or inhibits TRegs.

    46. A method, use or an immunotherapeutic agent for use according to any of claims 16 to 45, wherein the immunotherapeutic agent is an antibody which binds TRegs and mediates cellular effector functions.

    47. A method, use or immunotherapeutic agent for use according to claim 46, wherein the antibody is an IgG comprising an Fc region which mediates cellular effector functions.

    48. A method, use or immunotherapeutic agent for use according to any of claims 45 to 47, wherein the immunotherapeutic agent is an antibody which binds ICOS, CD25, CCR8, CTLA-4, GITR or an MHC displayed epitope of FOXP3.

    49. A method, use or immunotherapeutic agent for use according to claim 48, wherein the antibody binds ICOS.

    50. A method, use or immunotherapeutic agent for use according to claim 44 or claim 49, wherein the one or more biomarkers comprise the density of ICOS positive cells.

    51. A method, use or immunotherapeutic agent for use according to claim 49 or claim 50, wherein the antibody comprises an ICOS binding site comprising the CDRs of KY1044, wherein HCDR1 is SEQ ID NO: 1 HCDR2 is SEQ ID NO: 2 HCDR3 is SEQ ID NO: 3 LCDR1 is SEQ ID NO: 8 LCDR2 is SEQ ID NO: 9 and LCDR3 is SEQ ID NO: 10.

    52. A method, use or immunotherapeutic agent for use according to any of claims 49 to 51, wherein the antibody comprises a VH domain amino acid sequence at least 90% identical to the KY1044 VH domain SEQ ID NO: 5 and a VL domain amino acid sequence at least 90% identical to the KY1044 VL domain SEQ ID NO: 12.

    53. A method, use or immunotherapeutic agent for use according to claim 52, wherein antibody comprises the KY1044 VH domain SEQ ID NO: 5 and the KY1044 VL domain SEQ ID NO: 12.

    54. A method, use or immunotherapeutic agent for use according to claim 53, wherein the antibody is a human IgG1K comprising the KY1044 heavy chain SEQ ID NO: 7 and the KY1044 light chain SEQ ID NO: 14.

    55. A method, use or immunotherapeutic agent according to claim 48, wherein the antibody binds CD25, CCR8, CTLA-4, GITR or an MHC displayed epitope of FOXP3.

    56. A method, use or immunotherapeutic agent according to claim 55, wherein the one or more biomarkers comprise the ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells, the mean distance between each ICOS positive FOXP3 negative cell and its nearest ICOS FOXP3 double positive cell, and/or the proportion of FOXP3 positive cells which are ICOS positive.

    57. Use of the spatial arrangement of immune cells expressing ICOS and/or FOXP3 in the TME as a biomarker for disease prognosis or for response to treatment with an anti-ICOS and/or anti-TReg immunotherapeutic agent.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0149] FIG. 1 is a flow diagram of methods in which biomarkers are used in selecting patients for treatment with anti-ICOS cancer immunotherapy according to the present invention, showing embodiments of the process of data collection to assess the cancer immune contexture and predict the eligibility and need for anti-ICOS treatment in patients with a confirmed diagnosis of HCC. Patients for whom the biomarker reading is positive (“yes” arm) are administered anti-ICOS antibody KY1044, optionally in combination with other treatment. Patients for whom the biomarker reading is negative (“no” arm) are either not prescribed anti-ICOS therapy, or are given anti-ICOS therapy in combination with one or more other treatments (e.g., administration of other agents which will have the effect of influencing the biomarker and crossing the “yes/no” threshold).

    [0150] FIG. 2 is a bar graph showing a significant increase in the density of ICOS FOXP3 double positive TReg in the TME vs the normal adjacent tissue (peritumour).

    [0151] FIG. 3 is a bar graph showing a significant increase of the ratio of ICOS FOXP3 double positive TReg to total TReg (all FOXP3+) cells in the TME vs the normal adjacent tissue (peritumour).

    [0152] FIG. 4 shows Kaplan-Meier curves of overall survival over time, separated according to the density of ICOS positive cells in the TME of HCC tumour biopsies (n=142 patients). The 142 HCC samples from the Taiwan NTU cohort were stratified according to the highest quartile (dotted line) of ICOS cell density per mm.sup.2 vs the bottom 3 quartiles (solid line), representing a cut-off density of 120 cells per mm.sup.2. Log-rank (Mantel-Cox) test p<0.05.

    [0153] FIG. 5 shows Kaplan-Meier curves of overall survival over time, separated according to ICOS+FOXP3+ to total FOXP3+ cell ratio in the TME of HCC tumour biopsies (n=142 patients). A cut off ratio of 0.5 was used to separate the high (dotted line) vs the low (solid line) ratio population. Log-rank (Mantel-Cox) test p=0.0451.

    [0154] FIG. 6 shows Kaplan-Meier curves of overall survival over time, separated according to according to the density of ICOS positive cells in the TME of HBV infected HCC tumour biopsies (n=87 patients). The 87 HCC samples from the Taiwan NTU cohort were stratified according to the highest quartile (dotted line) of ICOS cell density per mm.sup.2 vs the bottom 3 quartiles (solid line), representing a cut-off of 100 cells per mm.sup.2. Log-rank (Mantel-Cox) test p<0.05.

    [0155] FIG. 7 shows Kaplan-Meier curves of overall survival over time, separated according to the density of ICOS positive cells in the TME of AJCC stage 2 HCC tumour samples (n=41 patients). The 41 AJCC stage 2 HCC samples from the Taiwan NTU cohort were stratified according to the highest quartile (dotted line) of ICOS cell density per mm.sup.2 vs the bottom 3 quartiles (solid line), representing a cut-off of 100 cells per mm.sup.2. Log-rank (Mantel-Cox) test p<0.01.

    [0156] FIG. 8 shows Kaplan-Meier curves of relapse free survival rate (% RFS), separated according to the total density of ICOS positive cells in the TME in AJCC stage 2 HCC tumour biopsies (n=41 patients). The 41 AJCC stage 2 HCC samples from the Taiwan NTU cohort were stratified according to the highest quartile (dotted line) of ICOS cell density per mm.sup.2 vs the bottom 3 quartiles (solid line), representing a cut-off of 100 cells per mm.sup.2. Log-Rank (Mantel-Cox) test p<0.05.

    [0157] FIG. 9 shows Kaplan-Meier curves of overall survival over time, separated according to the average distance of ICOS single positive cells to their nearest ICOS FOXP3 double positive cell in the TME. The 142 HCC samples from the Taiwan NTU cohort were stratified according to the median average distance: low distance (<105 μm for the solid line) vs high distance (≥105 μm dotted line). Log-Rank (Mantel-Cox) test p<0.05.

    [0158] FIG. 10 shows Kaplan-Meier curves of overall survival overtime, separated according to the ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells in the TME of HCC. The 142 HCC samples from the Taiwan NTU cohort were stratified according to a value of an average of more or less than 0.1 double positive cells within 30 μm of ICOS single positive cells. Low incidence (<0.1 for the solid line) vs high incidence (0.1 dotted line). p<0.05 Log-Rank (Mantel-Cox).

    [0159] FIG. 11 shows reduction in the ratio of ICOS FOXP3 double positive cells to total FOXP3 positive cells (representing the ICOS+ TReg proportion within all TReg) in human patients before and after administration of anti-ICOS monoclonal antibody KY1044. A) Cohort 1 (0.8 mg flat dose, Q3W) patient with leiomyosarcoma; B) cohort 2 (2.4 mg flat dose Q3W) patients with carcinoma of unknown primary (circles), renal cell carcinoma (triangles) and pancreatic cancer (squares); C) cohort 3 (8 mg flat dose Q3W) patient with metastatic prostate cancer; D) cohort 4 (24 mg flat dose Q3W) patients with pancreatic (circles) and oesophageal (triangles) cancer and E) cohort 5 (80 mg flat dose Q3W) patients with colon adenocarcinoma (circles), pancreatic (triangles) and mesothelioma (squares).

    [0160] FIG. 12 (A) is a tissue section image on which a boundary defining the tumour core has been drawn, defining an area of approximately 2 cm×1 cm, which includes over half the tissue section. Non-tumour features are marked for exclusion from the tumour core area. Only tumour tissue that is within the marked boundaries is included for assessment as TME.

    [0161] (B) is an enlargement of an area of (A). IHC staining is visible, including haematoxylin dye which stains all cell nuclei, and darker stains of two distinct chromogens for ICOS and FOXP3 respectively.

    [0162] (C) is the identical view to (B), additionally showing square boxes representing ICOS FOXP3 double positive cells (identified by dual staining) and circles representing ICOS single positive cells (identified only by ICOS-specific staining, FOXP3 negative). “Nearest neighbour” lines connect each ICOS single positive cell to its nearest ICOS FOXP3 double positive cell. Not all ICOS FOXP3 double positive cells are connected, because some ICOS FOXP3 double positive cells in the tissue are not the nearest ICOS FOXP3 double positive cell to any ICOS single positive cell.

    [0163] (D) is an enlargement of an area of (C). Distances are measured between every ICOS single positive cell and ICOS FOXP3 double positive cell in the TME. The shortest distance from each ICOS single positive cell to an ICOS FOXP3 double positive cell (i.e., the distance to the nearest ICOS FOXP3 double positive cell) is indicated by a connecting line. Individual distance measurements from a subset of ICOS single positive cells to their nearest ICOS FOXP3 double positive cell are shown, these being 50.7, 36.6, 45.4 and 39.5 μm, respectively—such measurements would be recorded for every ICOS single positive cell. These distances are measured using the Halo® software package.

    [0164] FIG. 13 (A) is a Halo® plot of the area of tumour core defined by the boundaries in FIG. 12 (A) with ICOS single positive (black) and ICOS FOXP3 double positive (grey) cells marked, without the underlying tissue image.

    [0165] (B) is an enlargement of an area of (A).

    [0166] (C) is an enlargement of an area of (B) and is a Halo® plot of the area shown in FIG. 12 (C). Nearest neighbour lines are shown from each ICOS single positive cell (circle) to its nearest ICOS FOXP3 double positive cell (square).

    [0167] FIG. 14 (A) is an enlargement of an area of the tissue section depicted in FIG. 12(A), which area overlaps with the area shown in FIG. 12(B).

    [0168] (B) is the identical view to (A), additionally showing circles representing ICOS single positive cells (identified only by ICOS-specific staining, FOXP3 negative) and square boxes representing ICOS FOXP3 double positive cells (identified by dual staining) that are within 30 μm of any ICOS single positive cell. Lines connect each ICOS single positive cell to ICOS FOXP3 double positive cells within 30 μm. ICOS FOXP3 double positive cells that are not within 30 μm of any ICOS single positive cell are not marked. ICOS single positive cells that are not within 30 μm of any ICOS FOXP3 double positive cell are not marked.

    [0169] (C) is an enlargement of an area of (B). Example distance measurements are shown between ICOS single positive cells and ICOS FOXP3 double positive cells within 30 μm. These distances are 7.4 μm, 7.6 μm and 15.6 μm respectively. These distances would be measured from every ICOS single positive cell to every ICOS FOXP3 double positive cell within 30 μm of it, across the whole TME. These distances are measured using the Halo® software package.

    [0170] (D) is a Halo® plot of a slightly zoomed in area corresponding to (B), without the underlying tissue image, and with all detected ICOS single positive cells (circles) and ICOS FOXP3 double positive cells (squares) marked. Lines connect each ICOS single positive cell to ICOS FOXP3 double positive cells within 30 μm.

    [0171] FIG. 15 (A) is a tissue section image on which a boundary defining the tumour core has been drawn, defining an area of approximately 2 cm×2 cm, which includes most of the tissue section. Non-tumour features are marked for exclusion from the tumour core area. Only tumour tissue that is within the marked boundaries is included for assessment as TME.

    [0172] (B) is a Halo® plot of the area of tumour core defined by the boundaries in (A) with ICOS FOXP3 double positive cells (grey circles) and FOXP3 single positive cells (black triangles) marked, without the underlying tissue image.

    [0173] (C) is an enlargement of an area of (B).

    [0174] (D) and (E) are a scanned image and a Halo® plot respectively of an area within (C). A tissue feature excluded from the TME area is ringed. IHC staining is visible in (D), including haematoxylin dye which stains all cell nuclei, and darker stains of two distinct chromagens for ICOS and FOXP3 respectively. (E) marks ICOS FOXP3 double positive cells as grey circles and FOXP3 single positive cells as black triangles, and the underlying tissue image is not shown.

    DETAILED DESCRIPTION

    Provision of Tumour Samples

    [0175] To assess the cellular composition, immune contexture and specific spatial arrangement within the TME, a sample of the tumour tissue is provided in vitro. The sample may be obtained from a resected tumour after curative surgery (surgery to excise the tumour) or from a biopsy sample obtained from a tumour remaining in vivo. Resected tissue is preferred for ease of analysis in view of the greater volume of tissue generally available, but biopsy material (e.g., from core needle biopsy) may equally be used. Fine needle biopsy is an alternative, although the sample should comprise sufficient tumour core tissue for the analysis to be representative, so larger sampling (e.g., open biopsy) methods are preferred. Alternatively, where in vivo imaging systems permit assessment of biomarkers directly in situ within the TME, a surgical sampling step may be omitted. In general, however, methods of the invention are generally performed on samples in vitro.

    [0176] In addition to cancerous cells which constitute the bulk of the tumour core, the TME includes a variety of immune cells, such as T lymphocytes of various sub-types, monocytes, neutrophils, dendritic cells and macrophages.

    [0177] Assessment of protein expression on clinical biopsies is frequently carried out on formalin fixed paraffin embedded (FFPE) slides to assess tumour characteristics and expression of indicative prognostic markers. These can be used to help tailor the correct treatment for a given patient or retrospectively to distinguish between responder and non-responder patients for a given therapy through identification of new biomarkers.

    [0178] Once a tissue sample has been obtained (e.g., from resected tissue or biopsy specimens), it will usually be treated to preserve its integrity and prepare it for testing. Tissue may be fixed in 10% formalin followed by embedding in paraffin, with a standard block shape being 0.5×1×1 cm. An alternative to this process is the fresh frozen procedure where tissues can be embedded in optimal cutting temperature (OCT) compound and flash frozen in dry ice before transferring to liquid nitrogen for long term storage. The FFPE process offers benefits of long term storage at room temperature while fresh frozen is a quicker process for storing tissue and keeps antigens in a native format but requires access to dry ice for preparing and shipment and liquid nitrogen for long term storage.

    [0179] A two dimensional section of the tissue sample may be provided for testing. A minimum of one section is prepared per patient or per tumour. Optionally, multiple sections may be prepared, from the same tissue sample or from multiple samples, e.g., from different regions of one tumour or from multiple tumours. For FFPE samples, the blocks are loaded on to a microtome to be cut into sections, between 4-5 microns in diameter, and mounted onto a glass slide suitable for staining, usually a standard size of 25 mm×75 mm. Fresh frozen blocks are cut and mounted in similar way via a cryostat, which is essentially a microtome in a freezer, allowing sections to remain frozen during the process. Tissue sections are then presented for testing to determine biomarker readings, e.g., by immunohistochemistry (IHC) and digital image analysis.

    [0180] The area of tumour core in a tissue section can be defined for assessment. Resected tissue will often comprise non-tumour tissue in addition to tumour tissue. This may be the case also for biopsied tissue, although a biopsy sample may simply consist of tumour core tissue. The extent of a tumour is typically determined by a pathologist, who can define the margin of the tumour in a sample of tissue. The region within the tumour (>500 μm inwards of the margin) is referred to as the tumour core and the tumour microenvironment refers to this area. The TME may be contrasted with the peritumour stroma, which is defined as tissue >500 μm outwards from the tumour margin and generally comprises normal, non-cancerous tissue, which may or may not be of the same tissue-type or organ from which the tumour is derived. A boundary representing the tumour margin may be drawn, either directly over a physical IHC slide (e.g., manually on glass) or preferably electronically as a visual overlay on a digital image of the tissue section. The tumour margin is typically a freeform shape, and in two dimensions on a tissue section it may be represented as a single loop or, e.g., where multiple patches of tumour/non-tumour tissue appear in the section, may comprise multiple loops. Annotation of a tissue section may also define boundaries around one or more areas to be excluded from the TME, such as artefacts or tissue folds. FIG. 12.

    Detection of ICOS

    [0181] Sequences of human, mouse and cynomolgus ICOS are available from NCBI as human NCBI ID: NP_036224.1, mouse NCBI ID: NP_059508.2 and cynomolgus GenBank ID: EHH55098.1. Since patients in the present invention are preferably human patients, references herein to ICOS refer to or comprise human ICOS unless the context dictates otherwise.

    [0182] ICOS is a marker of activated T cells. ICOS positive cells may be identified by detecting the ICOS receptor on the cell surface. An ICOS-binding agent such as an antibody, e.g., anti-ICOS clone D1K2T, is brought into contact with the tissue section under conditions allowing binding between the agent and ICOS, where present. The agent is either itself detectable (e.g., carries a detectable label) or is indirectly detectable by binding a labelled secondary agent specifically to the anti-ICOS agent (e.g., a secondary antibody which carries a detectable label). Using IHC, for example, the anti-ICOS antibody (e.g., D1K2T, which is a rabbit IgG) is bound to ICOS positive cells and is detected by a secondary antibody (e.g., antibody to rabbit IgG Fc) carrying a detectable label. Excess unbound agent is removed by washing, and the detectable label is then detected to locate ICOS in the tissue, thereby identifying the presence and position of ICOS positive cells.

    [0183] An ICOS positive (ICOS+) cell is a cell which expresses ICOS as detectable using such methods as are outlined here. The ICOS positive cell may express other markers in addition to ICOS, such as FOXP3. An ICOS positive cell may be negative for FOXP3, in which case it may also be referred to as an ICOS single positive cell (particularly when ICOS is the sole antigen detected among a plurality of antigens stained for) or as an ICOS+ FOXP3− (ICOS positive FOXP3 negative) cell. An ICOS positive cell may be positive for FOXP3, in which case it may also be referred to as an ICOS FOXP3 double positive cell, or an ICOS+ FOXP3+ cell. Conversely, an ICOS negative (ICOS −) cell is a cell on which ICOS is not detectable using such methods as are outlined here (e.g., the cell exhibits no ICOS label significantly above background in IHC).

    Detection of FOXP3

    [0184] FOXP3 is a marker of TReg. FOXP3 positive cells may be identified by detecting FOXP3 within the cells. FOXP3 is an intracellular molecule, so tissue samples should be treated to expose the antigen, e.g., by incubating with detergent. A FOXP3-binding agent such as an antibody, e.g., anti-FOXP3 clone 236A/E7, is brought into contact with the tissue section under conditions allowing binding between the agent and FOXP3, where present. The agent is either itself detectable (e.g., carries a detectable label) or is indirectly detectable by binding a labelled secondary agent specifically to the anti-FOXP3 agent (e.g., a secondary antibody which carries a detectable label). Using IHC, for example, the anti-FOXP3 antibody (e.g., clone 236A/E7) is bound to ICOS positive cells and is detected by a secondary antibody carrying a detectable label. Excess unbound agent is removed by washing, and the detectable label is then detected to locate FOXP3 in the tissue, thereby identifying the presence and position of FOXP3 positive cells.

    [0185] A FOXP3 positive (FOXP3+) cell is a cell which expresses FOXP3 as detectable using such methods as are outlined here. The FOXP3 positive cell may express other markers in addition to FOXP3, such as ICOS. A FOXP3 positive cell may be negative for ICOS, in which case it may also be referred to as a FOXP3 single positive cell (particularly when FOXP3 is the sole antigen detected among a plurality of antigens stained for), or an ICOS− FOXP3+(ICOS negative FOXP3 positive) cell. A FOXP3 positive cell may be positive for ICOS, in which case it may also be referred to as an ICOS FOXP3 double positive cell, or an ICOS+ FOXP3+ cell. Conversely, a FOXP3 negative (FOXP3−) cell is a cell on which FOXP3 is not detectable using such methods as are outlined here (e.g., the cell exhibits no FOXP3 label significantly above background in IHC).

    Immunohistochemistry

    [0186] Tissue sections may be stained to visualise antigens using IHC. In brief, IHC involves incubating the tissue section with an antigen-specific agent (e.g., antibody) to allow binding of the agent to its cognate antigen, washing excess unbound agent, and detecting the presence of bound agent, thereby visualising the presence and location of the antigen in the tissue. IHC can be performed directly using directly linked reporter antibodies or indirectly through antigen binding of primary antibody followed by linked or conjugated secondary antibodies. While the former can be more time efficient, the later can provide a more flexible approach with the benefit of signal amplification. IHC may be performed in multiplex on the same tissue section with multiple different antigen-specific agents in order to detect and locate multiple different antigens, using different signals/reporters/labels for the different antigens, e.g., fluorescent or enzyme multiplex IHC [29; 30; 31; 32; 33].

    [0187] IHC is commonly used on sections of FFPE and fresh frozen tissue. To begin the IHC process on FFPE slides, the paraffin on the tissue is first removed through a series of incubations in xylene, ethanol and water. Due to the covering of antigen epitopes by fixative, FFPE slides are usually required to undergo a process called antigen retrieval, a process that breaks down the fixative methylene bridges to “uncover” the antigen of interest, allowing antibodies to bind. This can be achieved by two main methods: heat-induced epitope retrieval (HIER) and protease-induced epitope retrieval (PIER) [34; 35]. In HIER, the tissue mounted slide is boiled for several minutes before washing and is usually carried out with the use of a pressure cooker, a microwave, or a vegetable steamer while PIER is a process of incubating with a specific enzyme, such as trypsin or proteinase K, for several minutes at 37° C. before washing. Note, the exact time of each process needs to be optimised depending on the technique used and the antigen that is being retrieved for optimum retrieval and avoidance of damaging the tissue. In contrast, fresh frozen slides do not require an antigen retrieval step but will require a short fixation step if staining for intracellular targets such as FOXP3. This is usually carried out with alcohol, which unlike paraformaldehyde does not mask antigen epitopes.

    [0188] For staining of intracellular targets such as FOXP3, FFPE and fixed fresh frozen slides are incubated in detergent, such as 0.25% Triton-X 100 in PBS, for 15-30 minutes at room temperature before washing. Tissues are then blocked to prevent non-specific binding of primary antibodies by incubating with blocking buffer for 1 hour at room temperature. Endogenous alkaline phosphatase (AP) in tissues can also remain prevalent in slides prepared from frozen tissue and requires blocking at this stage with levamisol. Once tissue samples are blocked, the antigen of interest can then be stained with primary antigen-specific antibodies (anti-ICOS and anti-FOXP3). Note, antigen specific antibodies need to be confirmed for use in IHC staining as they need to bind target following the processes outlined above. The primary antibodies must be specific for a given epitope on the target of interest and must not bind to other non-relevant targets to avoid background staining or false positive staining. The most convincing evidence for an antibody specificity is a lack of binding in knockout tissues or cells for the antigen in question. Excess unbound antibody is removed by washing. For chromogenic IHC, slides should next be blocked for peroxidase activity by incubating in hydrogen peroxide in methanol. If primary antibody is not directly labelled, reporter conjugated secondary antibody is then incubated and following final wash steps the reporter detected.

    [0189] The use of different reporters can provide different advantages and disadvantages. Chromogenic IHC makes use of enzyme linked moieties that catalyse the conversion of substrates into insoluble, coloured precipitates, which allows the visualisation of a given antigen [29; 30]. The staining is permanent, unlikely to degrade over time and can be used in parallel with histological dyes such as haematoxylin and eosin. However, only low numbers of antigens can be assessed due to the low number of enzymes and enzyme substrates available commercially. Immunofluorescence (IF) IHC, uses antigen specific antibodies linked to fluorescent moieties, which allows for an increased number of staining markers to be used in parallel. Disadvantages to this method include signal deterioration over time and spectra overlap between fluorophores when multiple antigens are assessed [31; 33]. For the purposes of the present invention, both forms of IHC are more than adequate for staining for ICOS and FOXP3. As an example of the staining process using chromogenic IHC, tissues should be stained for both ICOS and FOXP3 using two primary antibodies of different species, for example mouse and sheep IgG, followed by two secondary antibodies targeting the two distinct species of primary antibody, an anti-mouse and anti-sheep, conjugated to horse radish peroxidase (HRP) or alkaline phosphatase (AP). The expression of ICOS and FOXP3 can then be revealed by applying two different dyes that react with HRP or AP, for example DAB and BCIP/NBT, staining the tissue brown and blue/black respectively.

    [0190] Serial staining immunofluorescence, such as chipcytometry, is a process able to quantitatively analyse multiple antigens via staining with antigen specific antibodies linked to fluorescent moieties on FFPE or fresh frozen tissues. Fluorescence can be assessed with high dynamic range imaging combined with artificial intelligence software to generate analysis of cell types in a section [36]. As explained before, fresh frozen sections do not require antigen retrieval and therefore produce better quality results over FFPE tissue using this method. However, the chip cytometry technique is still possible on FFPE slides with the addition of an antigen retrieval step similar to uncover antigens required for this analysis. Following this, the tissue of both FFPE and fresh derived tissues can then be re-fixed by the standard process into the cytometry chips. The tissues can then be stained for up to five separate antigens in a process similar to that described above for standard IHC using five directly labelled primary antibodies. For example, two primary antibodies targeting ICOS and FOXP3 directly conjugated to two distinct fluorophores, for example APC and GFP, will allow distinction of ICOS and FOXP3 antigen expression in the tissues upon analysis. Spatial arrangements in the tissue can then be assessed, preferably assisted by software. One main distinction between this technique and standard IHC is that the fixing process stabilises the tissue allowing storage for up to 2 years at room temperature. Additionally, this allows the tissue to be bleached in order to quench the fluorescence antibodies without suffering damage, permitting tissue to be re-stained for additional five antigens. Through a process of repeat staining and bleaching, an almost unlimited protein biomarkers can be stained on the same slide with high definition and low background fluorescence.

    [0191] Mass Cytometry Imaging (MCI) is an alternative to the standard enzyme or fluorescent IHC methods described above. Imaging Mass Cytometry (IMC) and Multiplexed Ion Beam Imaging (MIBI), are two forms of novel Mass Cytometry Imaging that can provide extremely detailed expression of multiple antigens from both FFPE and fresh frozen samples in a given area [37; 38]. In IMC, tissues are stained with metal-tagged, antigen-specific primary antibodies, the expression of each antigen can then be assessed by successively ablating very small areas of tissue (e.g., 1 μM.sup.2) with a concentrated laser beam and analysing the proportions of the specific metal ions via detecting their specific mass using Cytometry Time-Of-Flight (CyTOF). Alternatively, using MIBI, the process is very similar with the exception that an oxygen duoplasmatron primary ion beam is used to rasterize the tissue, successively ablating a thin layer and releasing the metal isotopes as ions [39; 40; 41; 42; 43]. In both ways, the amount of antigen specific antibodies in each section can be assessed via quantifying the specific masses of metal tags down to a resolution of 1 Da and a highly detailed, digital image of the whole tissue is then reconstructed using the information acquired. As an example, following a staining process similar to that outlined for standard IHC and using antigen retrieval if required, the tissues are stained with anti-ICOS and anti-FOXP3 primary antibodies linked to rare-earth, heavy-metal isotypes, such as .sup.102Pd and .sup.209Bi (many other heavy metal isotypes would be possible) [44]. Expression of ICOS and FOXP3 in the tissue would then be progressively analysed using the process outlined above. Due to the resolution of this technique, it may be used to assess any of the tissue parameters and biomarkers described herein. The ability to distinguish isotypes down to 1 Da allows MCI to analyse up to 40 markers in parallel while avoiding the issues of spectral overlap. Therefore, multiple cell types can be assessed simultaneously on the same slide. Additionally, the technique is not limited by signal decay or background fluorescence.

    Digital Image Analysis

    [0192] Tissue samples provided as sections may be viewed by microscopy. Brightfield illumination is suitable for visualisation of contrasting dyes from IHC. A tissue sample may be scanned to provide a digital image of the tissue (e.g., a magnified, brightfield image). Image magnification, e.g., 20× or 40×, facilitates analysis. The image may be annotated to define the area of tumour core, as described. In the work described herein, we scanned 5 μm IHC stained tissue slides at 20× magnification using a Hamamatsu Nanozoomer digital scanner in brightfield mode.

    [0193] Cells may be counted and intercellular distances measured in order to take biomarker readings from the defined area of tumour core. Preferably, cell counting and distance measurement is automated using software analysis of a digital image. We used the HALO® platform (Indica Labs) to perform digital image analysis. In brief, the process involved a 3-chromogen colour deconvolution to separate the IHC chromogens for ICOS and FOXP3 respectively and the nuclear counterstain. Cell objects were formed by applying weighted optical density values for the individual chromogens. Each positive cell type was then identified using defined size, shape and subcellular compartment staining parameters. Background staining, which did not correspond to cell labelling, was identified and subtracted, so that the presence of ICOS or FOXP3 was indicated by an above-background level of staining. A classifier was developed and integrated into the algorithm to automatically segment the tissue regions of interest for analysis. The completed algorithm was applied to all tissue section images in the study in an automated and objective manner to generate detailed cell-by-cell data.

    Cell Density

    [0194] The density of a type of cell in the TME is the total number of those cells divided by the area of the TME, and is typically expressed as number of cells per mm.sup.2. The cell type of interest can be identified on a tissue section (or image thereof) through detection of markers such as ICOS and FOXP3 as detailed elsewhere herein, allowing cells to be counted. As described, counting may be automated using software to count all objects in a specified field of view which meet defined criteria, thus one may instruct software to count all ICOS positive cells in the tumour core. Where other cell markers besides ICOS are detected, this cell count may comprise multiple distinct populations, e.g., ICOS single positive cells and ICOS FOXP3 double positive cells. The total number of ICOS positive cells is all cells on which ICOS is detected at a level above background, thus including ICOS single positive cells as well as cells on which ICOS is present in addition to other detected markers, including ICOS FOXP3 double positive cells. The area of tumour core (TME) may also be determined using automated software, guiding the software by drawing a boundary around the tumour core as described herein. The number of ICOS positive cells in the TME is divided by the area of said TME to give the density.

    [0195] An increased density of ICOS positive cells in the TME is a biomarker for response to anti-ICOS immunotherapeutic agents, which may also deplete or inhibit TReg, such as the anti-ICOS antibody KY1044. Examples 2, 3, 4 and 8 illustrate the determination and use of this biomarker.

    (ICOS+FOXP3+)/Total FOXP3+ Proportion

    [0196] This proportion or ratio is calculated by determining the number of ICOS FOXP3 double positive cells in the TME, determining the number of FOXP3 positive cells in the TME, and dividing the former by the latter. The cell type of interest can be identified on a tissue section (or image thereof) through detection of markers (ICOS, FOXP3) as detailed elsewhere herein, allowing cells to be counted. As described, counting may be automated using software to count all objects in a specified field of view which meet defined criteria, thus one may instruct software to count all FOXP3 positive cells in the tumour core. Where other cell markers besides FOXP3 are detected, this cell count may comprise multiple distinct populations, e.g., FOXP3 single positive cells and ICOS FOXP3 double positive cells. The total number of FOXP3 positive cells is all cells on which FOXP3 is detected at a level above background, thus including FOXP3 single positive cells as well as cells on which FOXP3 is present in addition to other detected markers, including ICOS FOXP3 double positive cells. The area of tumour core (TME) may also be determined using automated software, guiding the software by drawing a boundary around the tumour core as described herein. The number of ICOS FOXP3 double positive cells in the TME is divided by the number of FOXP3 positive cells in the TME to give the ratio.

    [0197] Since FOXP3 is a marker of TReg, this ratio may be referred to as the ICOS+ TReg proportion. A high proportion of TReg being ICOS+ is a biomarker indicative of an immunosuppressed TME. The presence of this biomarker indicates that an immunotherapeutic agent may benefit the patient. In one embodiment, a cut-off of 50% (ratio 0.5) is used to categorise patients. Thus, for example, an HCC patient is selected for anti-ICOS and/or anti-TReg treatment if testing of a tumour sample from the patient indicates that more than 50% of the FOXP3+(TReg) cells in the TME are ICOS+. Examples 1, 2, 8 and 9 illustrate the determination and use of this biomarker.

    Intercellular Proximity

    [0198] Having identified the locations of cell types by detection of markers as described, distances between those cells can be measured. Measurements should be taken from nuclear centre to nuclear centre, which generally represents the middle of the cell in T cells, which have a compact rounded shape in the TME.

    [0199] The mean distance between each ICOS single positive cell and its nearest ICOS FOXP3 double positive cell is determined by measuring the shortest distance from an ICOS single positive cell to an ICOS FOXP3 double positive cell, repeating this for every ICOS single positive cell, and dividing the sum of these shortest distances by the number of ICOS single positive cells. As with other biomarkers described herein, measurements are taken in the tumour core (TME) area of the tissue sample (e.g., on a digital image of a tissue section).

    [0200] Proximity between ICOS FOXP3 double positive cells and ICOS single positive cells represents the proximity of strongly immunosuppressive cells to TEff. Close proximity (short distance) is a biomarker indicative of an immunosuppressed TME. The presence of this biomarker indicates that an immunotherapeutic agent may benefit the patient. Examples 5 and 8 illustrate the determination and use of this biomarker.

    Zonal Influence

    [0201] We define the zonal influence ratio to be the ratio of the number of ICOS FOXP3 double positive cells within a defined radius of influence around ICOS single positive cells to the total number of ICOS single positive cells.

    [0202] The ratio may be found by identifying all ICOS FOXP3 double positive cells in the TME, identifying all ICOS single positive (i.e., ICOS+ FOXP3−) cells in the TME, then selecting the subset of ICOS FOXP3 double positive cells which are within the defined radius of any (one or more) ICOS single positive cells in the TME, and dividing the number in this subset by the number of ICOS single positive cells.

    [0203] An ICOS FOXP3 double positive cell is counted if it is within the defined radius of any ICOS single positive cell. It is not counted if it is not within the defined radius of any ICOS single positive cell. An ICOS FOXP3 double positive cell which is within the defined radius of multiple ICOS single positive cells is counted only once. This subset of counted cells thus comprises all ICOS FOXP3 double positive cells which are within the defined radius of influence of any ICOS single positive cell in the TME.

    [0204] The counted number of ICOS FOXP3 double positive cells is then divided by the number of ICOS single positive cells in the TME. The count of ICOS single positive cells is a total count including all ICOS single positive cells in the TME, whether or not these cells have an ICOS FOXP3 double positive cell within their defined radius.

    [0205] This calculation provides the zonal influence ratio. A radius of 30 μm is preferred. Lymphocyte cell size varies between 7-15 μm in diameter. The immediate extracellular environment influences the cell, and where two cells are within approximately 30 μm one may expect communication via soluble intercellular mediators and potentially via direct cell:cell contact. Immunosuppressive TReg such as ICOS FOXP3 double positive cells can suppress FOXP3 negative lymphocytes through direct interaction or through release of immunosuppressive cytokines such as IL10 and TGFβ. Thus, to identify cells which are within a zone of influence of one another, we define a radius of 30 μm around the cells of interest, in this case the ICOS+ FOXP3− cells. The invention is not limited by the precise distance of this radius, and wider (e.g., 50 μm) or narrower (e.g., 20 μm) zones may be drawn, for example within approximately 50% (15-45 μm) or 20% (24-30 μm) of the suggested 30 μm value. Examples 6 and 8 illustrate the determination and use of the zonal influence biomarker.

    Cancerous Solid Tumours

    [0206] Cancers are typically classified by the type of tissue in which the cancer originates (histological type) or by primary site, the location in the body where the cancer first developed. Cancer classification is the subject of an international standard, ICD-O-3, produced by the World Health Organisation [45], incorporated by reference herein. The morphology axis provides five-digit codes ranging from M-8000/0 to M-9989/3. The first four digits indicate the specific histological term. The fifth digit after the slash (/) is the behaviour code, which indicates whether a tumour is malignant, benign, in situ, or uncertain (whether benign or malignant). A separate one-digit code is also provided for histologic grading (differentiation).

    [0207] When considering cohorts of patients and reference values for biomarkers calculated therefrom, it is preferred that the reference value is calculated from patients with tumours of the same type. The tumours may be of the same physiological category (e.g., all carcinomas, all sarcomas or all myelomas, optionally including mixed type tumours spanning more than one category), and preferably the same tissue type, optionally a morphological type as classified by the ICD-O-3 (e.g., HCC M-8170/3). The tumour type may be for example liver cancer, e.g., HCC (e.g., ICD-O-3 M-8170/3, M-8171/3, M-8172/3, M-8173/3, M-8174/3 or M-8175/3), renal cell cancer (optionally renal cell carcinoma, e.g., clear cell renal cell carcinoma), head and neck cancer, melanoma (optionally malignant melanoma), non-small cell lung cancer (e.g., adenocarcinoma), bladder cancer, ovarian cancer, cervical cancer, gastric cancer, pancreatic cancer, breast cancer or testicular germ cell carcinoma, including the metastases of any solid tumour such as those listed.

    [0208] It has been found that patients are less likely to respond to systemic anti-PD-1 immunotherapy if their tumour has metastasised to the liver. Patients with liver metastases are often excluded from clinical trials. Lee et al [46] suggested that antigen-specific TReg are activated in the liver and that these “liver-trained” TReg then suppress the wider anti-tumour immune response in the patient. Pre-clinical studies indicated that, for patients with liver metastasis, the sensitivity of a tumour to immune checkpoint inhibitors like anti-PD-1 might be improved by depleting TReg.

    [0209] This rationale may extend to HCC which metastasises to other body tissues such as bone and lungs. Here the primary tumour is in the liver and the metastases are remote, but the effect described by Lee et al may occur, viz. tumour antigen-specific TReg are activated in the liver and propagate an immunosuppressive effect which reduces the sensitivity of tumours in other tissues to treatment with an immune checkpoint inhibitor.

    [0210] In embodiments of the invention, a tumour may thus be: [0211] a primary tumour of the liver (e.g., HCC); [0212] a liver metastasis, i.e., a tumour of non-liver origin which originated elsewhere in the body and has metastasised to the liver; or [0213] a tumour at a site other than the liver, wherein the patient also has a tumour metastasis in the liver.

    [0214] In embodiments of the invention, the patient is one who has a tumour in the liver, which is optionally either a primary tumour of the liver (e.g., HCC) or a liver metastasis.

    [0215] The present invention may involve identifying patients with such tumours as being suitable for treatment with anti-TReg immunotherapy, where such treatment also comprises administration of an immune checkpoint inhibitor (e.g., anti-PD-1 or anti-PD-L1).

    Hepatocellular Cancer (HCC)

    [0216] Primary liver cancer is presently the fourth largest cause of cancer mortality globally, and most liver cancer cases are HCC. The carcinogenesis of HCC is attributed to chronic inflammation of the liver, predominantly from infection by hepatitis B virus (HBV) or hepatitis C virus (HCV) or from liver cirrhosis.

    [0217] An elevated level of alpha-foetoprotein (AFP) in the blood is a known indicator of the presence of either a primary liver cancer or germ cell tumour. This protein is normally produced by the foetus and is undetectable in the blood of healthy adult males and non-pregnant healthy women. AFP level has been found to negatively correlate with survival in HCC patients.

    [0218] The current treatment selected for HCC is commonly influenced by the disease stage. The AJCC staging system is a classification system developed by the American Joint Committee on Cancer for describing the extent of disease progression in cancer patients [28]. For patients with early-stage localised HCC, curative-intent treatment modalities include resection, ablation, and liver transplantation, whereas for patients with intermediate-stage localised HCC, image-guided transcatheter tumour therapies such as transarterial chemoembolisation have obtained survival benefits. However, the majority of patients with HCC either progress to or develop de novo locally advanced or metastatic diseases and are indicated for systemic therapy [47].

    [0219] Sorafenib, a multikinase inhibitor, was first systemic therapy approved for HCC [48, 49]. Since 2016, 4 other targeted agents, including 3 multikinase inhibitors and one antivascular endothelial growth factor receptor (VEGFR) monoclonal antibody, have been demonstrated in phase Ill clinical trials to provide survival benefits to patients with advanced HCC [50, 51, 52, 53]. Consequently, regulatory agencies of multiple countries have approved lenvatinib as a first-line systemic therapy for HCC and approved regorafenib, cabozantinib, and ramucirumab (limited to patients with α-fetoprotein >400 ng/mL) for the treatment of those with HCC who have been previously treated with sorafenib. Anti-PD-1 antibody has also been used as a second line treatment in advanced HCC.

    [0220] Patients in accordance with the present invention may have HCC which is associated with HBV and/or HCV infection, or which is not associated with HBV and/or HCV infection. The HCC may be of any stage (as determined according to AJCC staging manual, 8th edition), e.g., stage 1, stage 2 or stage 3. Patients may be male or female, adult or paediatric (<18 years). Patients may have undergone, or may be intended to undergo, hepatectomy for the tumour. Patients may have received previous treatment for the HCC, e.g., treatment with sorafenib and/or any other agent mentioned above. Patients may or may not have received previous treatment for the cancer by immunotherapy.

    Prognosis

    [0221] Overall survival (OS) is defined as defined as the length of time from either the date of diagnosis or the start of treatment for a disease, such as cancer, until death. When used to describe populations of patients diagnosed with the disease (rather than individual patients), OS is typically expressed as a median, representing the length of time from either the date of diagnosis or the start of treatment that half of the patients in the group are still alive. In the HCC patient cohort described herein, OS was calculated from the date of hepatectomy to the date of the patient's death or their final follow-up day.

    [0222] Recurrence free survival (RFS) in cancer refers to the length of time after primary treatment for the cancer ends that the patient survives without any signs or symptoms of that cancer. Also called disease free survival (DFS), relapse free survival.

    [0223] Progression free survival (PFS) refers to the length of time during and after treatment that a patient lives with the disease but it does not get worse.

    [0224] Time to progression (TTP) refers to the length of time from the date of diagnosis or the start of treatment until the disease starts to get worse or spread to other parts of the body.

    [0225] In general, data for the same one or more measures of survival are obtained for all patients within a cohort (e.g., in a population of patients from which reference values are generated), in order to provide data for prognosis of survival by the same one or more measures.

    Immunotherapeutic Agents

    [0226] An immunotherapeutic agent (agent used for immunotherapy) according to the present invention may be an anti-ICOS agent and/or it may be an anti-TReg immunotherapeutic agent. An anti-ICOS agent is an agent which binds ICOS, preferably the ICOS extracellular domain. An anti-TReg immunotherapeutic agent is one which depletes or inhibits TReg, preferably selectively, i.e., without depleting or inhibiting other T cells such as TEff or wherein the effect on such other T cells is less than on TReg. An agent which binds ICOS and also depletes or inhibits TReg is an anti-ICOS and anti-TReg immunotherapeutic agent. Examples include the anti-ICOS antibody KY1044 and other anti-ICOS antibodies with Fc effector function (e.g., anti-ICOS human IgG1).

    [0227] Anti-TReg immunotherapies include antibodies, other biological agents, small molecules and cell therapies. The anti-TReg immunotherapeutic agent may be an antibody which binds TReg and mediates cellular effector functions (e.g., via an effector positive Fc region) to deplete or inhibit TReg. The anti-TReg immunotherapeutic agent may bind a marker of TReg, which is selectively or differentially expressed on TReg, e.g., on the TReg cell surface. Examples of such surface markers include ICOS, CD25, CCR8, CTLA-4 and glucocorticoid-induced TNF-related protein (GITR). MHC displayed epitopes may also represent such markers and offer an opportunity to target TReg via intracellular proteins such as FOXP3, which does not comprise an extracellular portion. Digested peptides of FOXP3 and other intracellular markers are presented on the TReg surface on MHC class I, whereupon they may be recognised by an agent that specifically binds the epitope displayed in the MHC groove. Dao et al described a TCR mimic antibody that binds epitope of intracellular FOXP3 [54]. As summarised by Dao et al, other TReg immunotherapeutic agents which have been described include targeting agents for CD25 (e.g., the anti-CD25 antibody daclizumab), agents for IL-2 receptor (e.g., IL-2 toxin fusions, such as dennileukin difitox which is a fusion protein of IL-2 and diphtheria toxin), anti-GITR antibodies which deplete TReg, anti-CTLA-4 antibodies which suppress TReg function and agents which disrupt tumour homing by TReg and/or modulate T cell plasticity. Antibody to chemokine receptor-4 (CCR4) was shown to selectively deplete TReg expressing a higher level of FOXP3, which resulted in augmentation of CD8+ T cell response specific for the NY-ESO-1 peptide. CCR4 is expressed on activated T cells, T helper 2, NK cells, macrophages, and dendritic cells, therefore confounding the selective effects. A defucosylated, humanised anti-CCR4 mAb, mogamulizumab, has been in clinical trials in various cancers. Chemokine receptor-8 (CCR8) is preferentially expressed on TReg in breast cancer patients and is associated with poor prognosis. CCR8 is also expressed on tissue-resident memory CD8+ T cells and NK-T cells, and therefore, the therapeutic potential of targeting this molecule remains to be investigated. In addition, modulating transforming growth factor (TGF)-beta, a crucial cytokine for TReg function has also been tried. Cyclophosphamide has been shown to suppress TReg.

    [0228] Recently, anti-TReg therapies comprising anti-CD36 and/or PPARbeta inhibitors were described in WO2020053833. It disclosed a method of reducing the number of intratumoural TReg (e.g., CD4+ cells) in a subject, including for example administering a CD36 inhibitor. In some embodiments, the method included administering a PPARbeta inhibitor.

    Antibodies

    [0229] Preferred immunotherapeutic agents are antibodies, which may be whole immunoglobulins or antigen-binding fragments thereof comprising immunoglobulin domains, whether natural or partly or wholly synthetically produced. Antibodies may be IgG, IgM, IgA, IgD or IgE molecules or antigen-specific antibody fragments thereof (including, but not limited to, a Fab, F(ab′)2, Fv, disulphide linked Fv, scFv, single domain antibody, closed conformation multispecific antibody, disulphide-linked scfv, diabody), whether derived from any species that naturally produces an antibody, or created by recombinant DNA technology; whether isolated from serum, B-cells, hybridomas, transfectomas, yeast or bacteria. Antibodies can be humanised using routine technology.

    [0230] The antibody comprises an antibody antigen-binding site (paratope) which binds to and is complementary to the epitope of its target antigen. The term “epitope” refers to a region of an antigen that is bound by an antibody. Epitopes may be defined as structural or functional.

    [0231] Functional epitopes are generally a subset of the structural epitopes and have those residues that directly contribute to the affinity of the interaction. Epitopes may also be conformational, that is, composed of non-linear amino acids. In certain embodiments, epitopes may include determinants that are chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl groups, or sulfonyl groups, and, in certain embodiments, may have specific three-dimensional structural characteristics, and/or specific charge characteristics.

    [0232] Examples of antibody fragments include:

    [0233] (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region;

    [0234] (iii) an Fd fragment consisting of the VH and CH1 domains;

    [0235] (iv) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody,

    [0236] (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546; which is incorporated by reference herein in its entirety), which consists of a VH or VL domain; and

    [0237] (vi) an isolated complementarity determining region (CDR) that retains specific antigen-binding functionality.

    [0238] Further examples of antibodies are H2 antibodies that comprise a dimer of a heavy chain (5′-VH-(optional hinge)-CH2-CH3-3′) and are devoid of a light chain.

    [0239] Single-chain antibodies (e.g., scFv) are a commonly used fragment. Multispecific antibodies may be formed from antibody fragments. An antibody of the invention may employ any such format, as appropriate.

    [0240] Digestion of whole immunoglobulins with the enzyme papain results in two identical antigen-binding fragments, known also as “Fab” fragments, and a “Fc” fragment, having no antigen-binding activity but having the ability to crystallize. “Fab” when used herein refers to a fragment of an antibody that includes one constant and one variable domain of each of the heavy and light chains. The term “Fc region” herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions. The “Fc fragment” refers to the carboxy-terminal portions of both H chains held together by disulfides. The effector functions of antibodies are determined by sequences in the Fc region, the region which is also recognised by Fc receptors (FcR) found on certain types of cells. Digestion of antibodies with the enzyme pepsin, results in the F(ab′)2 fragment in which the two arms of the antibody molecule remain linked and comprise two-antigen binding sites. The F(ab′)2 fragment has the ability to crosslink antigen.

    [0241] A mAb.sup.2 comprises a VH and VL domain from an intact antibody, fused to a modified constant region, which has been engineered to form an antigen-binding site, known as an “Fcab”. The technology behind the Fcab/mAb.sup.2 format is described in more detail in WO2008/003103, and the description of the mAb.sup.2 format is incorporated herein by reference. Further descriptions of this format can be found in WO2006/072620, WO2008/003116, WO2009/000006 and WO2009/0132876.

    [0242] “Fv” when used herein refers to the minimum fragment of an antibody that retains both antigen-recognition and antigen-binding sites. This region consists of a dimer of one heavy and one light chain variable domain in tight, non-covalent or covalent association. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognise and bind antigen, although at a lower affinity than the entire binding site.

    [0243] In a Fab, an antibody antigen-binding site may be provided by one or more antibody variable domains. In an example, the antibody binding site is provided by a single variable domain, e.g., a heavy chain variable domain (VH domain) or a light chain variable domain (VL domain). In another example, the binding site comprises a VH/VL pair or two or more of such pairs. Thus, an antibody antigen-binding site may comprise a VH and a VL.

    [0244] Optionally, antibody immunoglobulin domains may be fused or conjugated to additional polypeptide sequences and/or to labels, tags, toxins or other molecules. Antibody immunoglobulin domains may be fused or conjugated to one or more different antigen binding regions, providing a molecule that is able to bind a second antigen. An antibody of the present invention may be a multispecific antibody, e.g., a bispecific antibody, comprising (i) an antibody antigen binding site for ICOS and (ii) a further antigen binding site (optionally an antibody antigen binding site, as described herein) which recognises another antigen.

    [0245] The antibody variable domains include amino acid sequences of complementarity determining regions (CDRs; i.e., CDR1, CDR2, and CDR3), and framework regions (FRs). Thus, within each of the VH and VL domains are CDRs and FRs. The term “hypervariable region”, “CDR region” or “CDR” refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops. Generally, antigen binding sites of an antibody include six hypervariable regions: three in the VH (HCDR1, HCDR2, HCDR3), and three in the VL (LCDR1, LCDR2, LCDR3). These regions of the heavy and light chains of an antibody confer antigen-binding specificity to the antibody. A VH domain comprises a set of HCDRs, and a VL domain comprises a set of LCDRs. VH refers to the variable domain of the heavy chain. VL refers to the variable domain of the light chain. Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. An antibody may comprise an antibody VH domain comprising a VH CDR1, CDR2 and CDR3 and a framework. It may alternatively or also comprise an antibody VL domain comprising a VL CDR1, CDR2 and CDR3 and a framework. Examples of antibody VH and VL domains and CDRs according to the present invention are as listed in the appended sequence listing and tables that form part of the present disclosure. As described herein, a “set of CDRs” comprises CDR1, CDR2 and CDR3. Thus, a set of HCDRs refers to HCDR1, HCDR2 and HCDR3, and a set of LCDRs refers to LCDR1, LCDR2 and LCDR3. Unless otherwise stated, a “set of CDRs” includes HCDRs and LCDRs.

    [0246] CDRs may be defined according to the Kabat system [55], the Chothia system [56] or the IMGT system [57, 58). IMGT is used by default, so CDRs and variable domain numbering herein are according to IMGT unless stated to the contrary.

    [0247] Antibodies and other biological agents according to the present invention may be provided in isolated or purified form. An isolated antibody or protein is one that has been identified, separated and/or recovered from a component of its production environment (e.g., natural or recombinant). For example, the antibody or protein is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the antibody is derived, or substantially free of chemical precursors or other chemicals when chemically synthesized. The language “substantially free of cellular material” includes preparations of an antibody in which the antibody is separated from cellular components of the cells from which it is isolated or recombinantly produced. Thus, an antibody that is substantially free of cellular material includes preparations of antibody having less than about 30%, 20%, 10%, or 5% (by dry weight) of heterologous protein (also referred to herein as a “contaminating protein”). When the antibody is recombinantly produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%, 10%, or 5% of the volume of the protein preparation. When the antibody is produced by chemical synthesis, it is preferably substantially free of chemical precursors or other chemicals, i.e., it is separated from chemical precursors or other chemicals which are involved in the synthesis of the protein. Accordingly such preparations of the antibody have less than about 30%, 20%, 10%, 5% (by dry weight) of chemical precursors or compounds other than the antibody of interest. In a preferred embodiment, antibodies of the invention are isolated or purified.

    [0248] An antibody may comprise a VH domain that has at least 60, 70, 80, 85, 90, 95, 98 or 99% amino acid sequence identity with a VH domain of any of the antibodies described herein and/or shown in the appended sequence listing, and/or comprising a VL domain that has at least 60, 70, 80, 85, 90, 95, 98 or 99% amino acid sequence identity with a VL domain of any of those antibodies. Algorithms that can be used to calculate % identity of two amino acid sequences include e.g. BLAST, FASTA, or the Smith-Waterman algorithm, e.g. employing default parameters. Particular variants may include one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue).

    [0249] Alterations may be made in one or more framework regions and/or one or more CDRs. Variants are optionally provided by CDR mutagenesis. The alterations normally do not result in loss of function, so an antibody comprising a thus-altered amino acid sequence may retain an ability to bind the antigen (e.g., ICOS). It may retain the same quantitative binding ability as an antibody in which the alteration is not made, e.g. as measured in an assay described herein. The antibody comprising a thus-altered amino acid sequence may have an improved ability to bind the antigen.

    [0250] Alteration may comprise replacing one or more amino acid residue with a non-naturally occurring or non-standard amino acid, modifying one or more amino acid residue into a non-naturally occurring or non-standard form, or inserting one or more non-naturally occurring or non-standard amino acid into the sequence. Examples of numbers and locations of alterations in sequences of the invention are described elsewhere herein. Naturally occurring amino acids include the 20 “standard” L-amino acids identified as G, A, V, L, I, M, P, F, W, S, T, N, Q, Y, C, K, R, H, D, E by their standard single-letter codes. Non-standard amino acids include any other residue that may be incorporated into a polypeptide backbone or result from modification of an existing amino acid residue. Non-standard amino acids may be naturally occurring or non-naturally occurring.

    [0251] The term “variant” as used herein refers to a peptide or nucleic acid that differs from a parent polypeptide or nucleic acid by one or more amino acid or nucleic acid deletions, substitutions or additions, yet retains one or more specific functions or biological activities of the parent molecule. Amino acid substitutions include alterations in which an amino acid is replaced with a different naturally-occurring amino acid residue. Such substitutions may be classified as “conservative”, in which case an amino acid residue contained in a polypeptide is replaced with another naturally occurring amino acid of similar character either in relation to polarity, side chain functionality or size. Such conservative substitutions are well known in the art. Substitutions encompassed by the present invention may also be “non-conservative”, in which an amino acid residue which is present in a peptide is substituted with an amino acid having different properties, such as naturally-occurring amino acid from a different group (e.g., substituting a charged or hydrophobic amino; acid with alanine), or alternatively, in which a naturally-occurring amino acid is substituted with a non-conventional amino acid. In some embodiments amino acid substitutions are conservative. Also encompassed within the term variant when used with reference to a polynucleotide or polypeptide, refers to a polynucleotide or polypeptide that can vary in primary, secondary, or tertiary structure, as compared to a reference polynucleotide or polypeptide, respectively (e.g., as compared to a wild-type polynucleotide or polypeptide).

    [0252] In some aspects, one can use “synthetic variants”, “recombinant variants”, or “chemically modified” polynucleotide variants or polypeptide variants isolated or generated using methods well known in the art. “Modified variants” can include conservative or non-conservative amino acid changes, as described below. Polynucleotide changes can result in amino acid substitutions, additions, deletions, fusions and truncations in the polypeptide encoded by the reference sequence. Some aspects use include insertion variants, deletion variants or substituted variants with substitutions of amino acids, including insertions and substitutions of amino acids and other molecules) that do not normally occur in the peptide sequence that is the basis of the variant, for example but not limited to insertion of ornithine which do not normally occur in human proteins. The term “conservative substitution,” when describing a polypeptide, refers to a change in the amino acid composition of the polypeptide that does not substantially alter the polypeptide's activity. For example, a conservative substitution refers to substituting an amino acid residue for a different amino acid residue that has similar chemical properties (e.g., acidic, basic, positively or negatively charged, polar or nonpolar, etc.). Conservative amino acid substitutions include replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, or a threonine with a serine. Conservative substitution tables providing functionally similar amino acids are well known in the art. For example, the following six groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Serine (S), Threonine (T); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W) [59]. In some embodiments, individual substitutions, deletions or additions that alter, add or delete a single amino acid or a small percentage of amino acids can also be considered “conservative substitutions” if the change does not reduce the activity of the peptide. Insertions or deletions are typically in the range of about 1 to 5 amino acids. The choice of conservative amino acids may be selected based on the location of the amino acid to be substituted in the peptide, for example if the amino acid is on the exterior of the peptide and expose to solvents, or on the interior and not exposed to solvents.

    [0253] One can select the amino acid that will substitute an existing amino acid based on the location of the existing amino acid, including its exposure to solvents (i.e., if the amino acid is exposed to solvents or is present on the outer surface of the peptide or polypeptide as compared to internally localized amino acids not exposed to solvents). Selection of such conservative amino acid substitutions are well known in the art [60, 61, 62]. Accordingly, one can select conservative amino acid substitutions suitable for amino acids on the exterior of a protein or peptide (i.e. amino acids exposed to a solvent), for example, but not limited to, the following substitutions can be used: substitution of Y with F, T with S or K, P with A, E with D or Q, N with D or G, R with K, G with N or A, T with S or K, D with N or E, I with L or V, F with Y, S with T or A, R with K, G with N or A, K with R, A with S, K or P.

    [0254] In alternative embodiments, one can also select conservative amino acid substitutions encompassed suitable for amino acids on the interior of a protein or peptide, for example one can use suitable conservative substitutions for amino acids is on the interior of a protein or peptide (i.e. the amino acids are not exposed to a solvent), for example but not limited to, one can use the following conservative substitutions: where Y is substituted with F, T with A or S, I with L or V, W with Y, M with L, N with D, G with A, T with A or S, D with N, I with L or V, F with Y or L, S with A or T and A with S, G, T or V. In some embodiments, non-conservative amino acid substitutions are also encompassed within the term of variants.

    [0255] Antibodies disclosed herein may be modified to increase or decrease serum half-life, for example by sequence engineering of one or more antibody constant regions and/or fusion to other molecules, e.g., PEGylation or by binding to albumin, e.g. incorporating an albumin binding single domain antibody (dAb). Various half-life extending fusions have been described [63].

    [0256] An antibody of the invention may be a human antibody or a chimaeric antibody comprising human variable regions and non-human (e.g., mouse) constant regions. The antibody of the invention for example has human variable regions, and optionally also has human constant regions.

    [0257] Thus, antibodies optionally include constant regions or parts thereof, e.g., human antibody constant regions or parts thereof. For example, a VL domain may be attached at its C-terminal end to an antibody light chain kappa or lambda constant domain. Similarly, an antibody VH domain may be attached at its C-terminal end to all or part (e.g. a CH1 domain or Fc region) of an immunoglobulin heavy chain constant region derived from any antibody isotype, e.g. IgG, IgA, IgE and IgM and any of the isotype sub-classes, such as IgG1 or IgG4. Examples of human antibody constant domains are shown in Table C.

    [0258] Constant regions of antibodies of the invention may alternatively be non-human constant regions. For example, when antibodies are generated in transgenic animals (examples of which are described elsewhere herein), chimaeric antibodies may be produced comprising human variable regions and non-human (host animal) constant regions. Some transgenic animals generate fully human antibodies. Others have been engineered to generate antibodies comprising chimaeric heavy chains and fully human light chains. Where antibodies comprise one or more non-human constant regions, these may be replaced with human constant regions to provide antibodies more suitable for administration to humans as therapeutic compositions, as their immunogenicity is thereby reduced.

    Fc Effector Functions, ADCC, ADCP and CDC

    [0259] As discussed above, antibodies can be provided in various isotypes and with different constant regions. Examples of human IgG antibody heavy chain constant region sequences are shown in Table C. The Fc region of the antibody primarily determines its effector function in terms of Fc binding, antibody-dependent cell-mediated cytotoxicity (ADCC) activity, complement dependent cytotoxicity (CDC) activity and antibody-dependent cell phagocytosis (ADCP) activity. These “cellular effector functions”, as distinct from effector T cell function, involve recruitment of cells bearing Fc receptors to the site of the target cells, resulting in killing of the antibody-bound cell. In addition to ADCC and CDC, the ADCP mechanism [64] represents a means of depleting antibody-bound T cells, and thus targeting high ICOS expressing TRegs for deletion.

    [0260] Cellular effector functions ADCC, ADCP and/or CDC may also be exhibited by antibodies lacking Fc regions. Antibodies may comprise multiple different antigen-binding sites, one directed to ICOS and another directed to a target molecule where engagement of that target molecule induces ADCC, ADCP and/or CDC, e.g., an antibody comprising two scFv regions joined by a linker, where one scFv can engage an effector cell.

    [0261] An antibody according to the present invention may be one that exhibits ADCC, ADCP and/or CDC. Alternatively, an antibody according to the present invention may lack ADCC, ADCP and/or CDC activity. In either case, an antibody according to the present invention may comprise, or may optionally lack, an Fc region that binds to one or more types of Fc receptor. Use of different antibody formats, and the presence or absence of FcR binding and cellular effector functions, allow the antibody to be tailored for use in particular therapeutic purposes as discussed elsewhere herein.

    [0262] A suitable antibody format for some therapeutic applications employs a wild-type human IgG1 constant region. A constant region may be an effector-enabled IgG1 constant region, optionally having ADCC and/or CDC and/or ADCP activity. A suitable wild type human IgG1 contant region sequence is IGHG1*01. Further examples of human IgG1 constant regions are shown herein.

    [0263] A constant region may be engineered for enhanced ADCC and/or CDC and/or ADCP. The potency of Fc-mediated effects may be enhanced by engineering the Fc domain by various established techniques. Such methods increase the affinity for certain Fc-receptors, thus creating potential diverse profiles of activation enhancement. This can achieved by modification of one or several amino acid residues [65]. Human IgG1 constant regions containing specific mutations or altered glycosylation on residue Asn297 (e.g., N297Q, EU index numbering) have been shown to enhance binding to Fc receptors. Example mutations are one or more of the residues selected from 239, 332 and 330 for human IgG1 constant regions (or the equivalent positions in other IgG isotypes). An antibody may thus comprise a human IgG1 constant region having one or more mutations independently selected from N297Q, S239D, 1332E and A330L (EU index numbering). A triple mutation (M252Y/S254T/T256E) may be used to enhance binding to FcRn, and other mutations affecting FcRn binding are discussed in Table 2 of [66], any of which may be employed in the present invention.

    [0264] Increased affinity for Fc receptors can also be achieved by altering the natural glycosylation profile of the Fc domain by, for example, generating under fucosylated or defucosylated variants [67]. Non-fucosylated antibodies harbour a tri-mannosyl core structure of complex-type N-glycans of Fc without fucose residue. These glycoengineered antibodies that lack core fucose residue from the Fc N-glycans may exhibit stronger ADCC than fucosylated equivalents due to enhancement of FcγRIIIa binding capacity. An antibody according to the present invention may be fucosylated, afucosylated, defucosylated or under fucosylated.

    [0265] To increase ADCC, residues in the hinge region can be altered to increase binding to Fc-gamma RIII [68]. Thus, an antibody may comprise a human IgG heavy chain constant region that is a variant of a wild-type human IgG heavy chain constant region, wherein the variant human IgG heavy chain constant region binds to human Fcγ receptors selected from the group consisting of FcyRIIB and FcyRIIA with higher affinity than the wild type human IgG heavy chain constant region binds to the human Fcγ receptors. The antibody may comprise a human IgG heavy chain constant region that is a variant of a wild type human IgG heavy chain constant region, wherein the variant human IgG heavy chain constant region binds to human FcγRIIB with higher affinity than the wild type human IgG heavy chain constant region binds to human FcγRIIB. The variant human IgG heavy chain constant region can be a variant human IgG1, a variant human IgG2, or a variant human IgG4 heavy chain constant region. In one embodiment, the variant human IgG heavy chain constant region comprises one or more amino acid mutations selected from G236D, P238D, S239D, S267E, L328F, and L328E (EU index numbering system). In another embodiment, the variant human IgG heavy chain constant region comprises a set of amino acid mutations selected from the group consisting of: S267E and L328F; P238D and L328E; P238D and one or more substitutions selected from the group consisting of E233D, G237D, H268D, P271G, and A330R; P238D, E233D, G237D, H268D, P271G, and A330R; G236D and S267E; S239D and S267E; V262E, S267E, and L328F; and V264E, S267E, and L328F (EU index numbering system). The enhancement of CDC may be achieved by amino acid changes that increase affinity for C1q, the first component of the classic complement activation cascade [69]. Another approach is to create a chimeric Fc domain created from human IgG1 and human IgG3 segments that exploit the higher affinity of IgG3 for C1q [70]. Antibodies of the present invention may comprise mutated amino acids at residues 329, 331 and/or 322 to alter the C1q binding and/or reduced or abolished CDC activity. In another embodiment, the antibodies or antibody fragments disclosed herein may contain Fc regions with modifications at residues 231 and 239, whereby the amino acids are replaced to alter the ability of the antibody to fix complement. In one embodiment, the antibody or fragment has a constant region comprising one or more mutations selected from E345K, E430G, R344D and D356R, in particular a double mutation comprising R344D and D356R (EU index numbering system).

    [0266] WO2008/137915 described anti-ICOS antibodies with modified Fc regions having enhanced effector function. The antibodies were reported to mediate enhanced ADCC activity as compared to the level of ADCC activity mediated by a parent antibody comprising the VH and VK domains and a wild type Fc region. Antibodies according to the present invention may employ such variant Fc regions having effector function as described therein.

    [0267] ADCC activity of an antibody may be determined in an assay as described herein. ADCC activity of an anti-ICOS antibody may be determined in vitro using an ICOS positive T cell line as described herein. More generally, ADCC activity of an antibody may be determined in vitro in an ADCC assay using cells exhibiting cell surface display of the antigen recognised by the antibody.

    [0268] For some patients it may be preferred to use antibodies without Fc effector function. Antibodies may be provided without a constant region, or without an Fc region—examples of such antibody formats are described elsewhere herein. Alternatively, an antibody may have a constant region which is effector null. An antibody may have a heavy chain constant region that does not bind Fcγ receptors, for example the constant region may comprise a Leu235Glu mutation (i.e., where the wild type leucine residue is mutated to a glutamic acid residue). Another optional mutation for a heavy chain constant region is Ser228Pro, which increases stability. A heavy chain constant region may be an IgG4 comprising both the Leu235Glu mutation and the Ser228Pro mutation. This “IgG4-PE” heavy chain constant region is effector null.

    [0269] An alternative effector null human constant region is a disabled IgG1. A disabled IgG1 heavy chain constant region may contain alanine at position 235 and/or 237 (EU index numbering), e.g., it may be a IgG1*01 sequence comprising the L235A and/or G237A mutations (“LAGA”).

    [0270] A variant human IgG heavy chain constant region may comprise one or more amino acid mutations that reduce the affinity of the IgG for human FcγRIIIA, human FcγRIIA, or human FcγRI. In one embodiment, the FcγRIIB is expressed on a cell selected from the group consisting of macrophages, monocytes, B-cells, dendritic cells, endothelial cells, and activated T-cells. In one embodiment, the variant human IgG heavy chain constant region comprises one or more of the following amino acid mutations G236A, S239D, F243L, T256A, K290A, R292P, S298A, Y300L, V3051, A330L, 1332E, E333A, K334A, A339T, and P396L (EU index numbering system). In one embodiment, the variant human IgG heavy chain constant region comprises a set of amino acid mutations selected from the group consisting of: S239D; T256A; K290A; S298A; 1332E; E333A; K334A; A339T; S239D and 1332E; S239D, A330L, and 1332E; S298A, E333A, and K334A; G236A, S239D, and 1332E; and F243L, R292P, Y300L, V3051, and P396L (EU index numbering system). In one embodiment, the variant human IgG heavy chain constant region comprises a S239D, A330L, or 1332E amino acid mutations (EU index numbering system). In one embodiment, the variant human IgG heavy chain constant region comprises an S239D and 1332E amino acid mutations (EU index numbering system). In one embodiment, the variant human IgG heavy chain constant region is a variant human IgG1 heavy chain constant region comprising the S239D and 1332E amino acid mutations (EU index numbering system).

    [0271] An antibody may have a heavy chain constant region that binds one or more types of Fc receptor but does not induce cellular effector functions, i.e., does not mediate ADCC, CDC or ADCP activity. Such a constant region may be unable to bind the particular Fc receptor(s) responsible for triggering ADCC, CDC or ADCP activity.

    Anti-ICOS Antibodies

    [0272] An anti-ICOS agent may be an antibody to ICOS, which binds to the ICOS extracellular domain and thereby targets T cells expressing ICOS.

    [0273] Anti-ICOS antibodies have been reported to have anti-tumour effects resulting from binding ICOS+ T cells. An anti-ICOS antibody may provide an immunotherapeutic effect by various mechanisms. For example, anti-ICOS antibodies may have an agonistic effect on ICOS, thus enhancing the function of TEff cells, as indicated by an ability to increase IFNγ expression and secretion. Anti-ICOS antibodies may optionally be engineered to deplete cells to which they bind, which should have the effect of preferentially downregulating ICOS+ TReg, lifting the suppressive effect of these cells on the effector T cell response and thus promoting the effector T cell response overall. The anti-ICOS antibody KY1044 has an ideal functional profile for use as an immunotherapeutic agent in the present invention, although other anti-ICOS agents may alternatively be used.

    [0274] An anti-ICOS antibody may be any of the following antibodies, may comprise the VH and VL domains of any of the following antibodies or may comprise the HCDRs and/or LCDRs of any of the following antibodies:

    [0275] (a) KY1044

    [0276] (b) anti-ICOS antibodies described in PCT/GB2017/052352 WO2018/029474 or U.S. Pat. No. 9,957,323, the contents of which are incorporated herein by reference (e.g., STIM001, STIM002, STIM002B, STIM003, STIM004, STIM005, STIM006, STIM007, STIM008 or STIM009)

    [0277] (c) anti-ICOS antibodies described in PCT/GB2018/053701 WO2019/122884 the contents of which are incorporated herein by reference (e.g., STIM017, STIM020, STIM021, STIM022, STIM023, STIM039, STIM040, STIM041, STIM042, STIM043, STIM044, STIM050, STIM051, STIM052, STIM053, STIM054, STIM055, STIM056, STIM057, STIM058, STIM059, STIM060, STIM061, STIM062, STIM063, STIM064, STIM065 or STIM066)

    [0278] (d) anti-ICOS/PD-L1 mAb.sup.2 bispecific antibodies described in PCT/GB2018/053698 WO2019/122882

    [0279] (e) vopratelimab

    [0280] (f) anti-ICOS antibodies described in WO2016/154177 or US2016/0304610 (e.g., 37A10S713, 7F12, 37A10, 35A9, 36E10, 16G10, 37A10S714, 37A10S715, 37A10S716, 37A10S717, 37A10S718, 16G10S71, 16G10S72, 16G10S73, 16G10S83, 35A9S79, 35A9S710 or 35A9S89)

    [0281] (g) anti-ICOS antibodies described in WO2016/120789 or US2016/0215059 (e.g., 422.2 H2L5)

    [0282] (h) antibody C398.4 or a humanised antibody thereof as described in WO2018/187613 or US2018/0289790, e.g., ICOS.33 IgG1f S267E, ICOS.4, ICOS34 G1f, ICOS35 G1f, 17C4, 9D5, 3E8, 1D7a, 1D7b or 2644 (for sequences see WO2018187613 Table 35), e.g., the antibody BMS-986226 in NCT03251924

    [0283] (i) antibody JMAb 136, “136”, or any other antibody described in WO2010/056804

    [0284] (j) antibody 314-8, the antibody produced from hybridoma CNCM I-4180, or any other anti-ICOS antibody described in WO2012/131004, WO2014/033327 or US2015/0239978

    [0285] (k) antibody Icos145-1, the antibody produced by hybridoma CNCM I-4179, or any other antibody described in WO2012/131004, U.S. Pat. No. 9,376,493 or US2016/0264666

    [0286] (l) antibody MIC-944 (from hybridoma DSMZ 2645), 9F3 (DSMZ 2646) or any other anti-ICOS antibody described in WO99/15553, U.S. Pat. Nos. 7,259,247, 7,132,099, 7,125,551, 7,306,800, 7,722,872, WO05/103086, US8,318,905 or U.S. Pat. No. 8,916,155

    [0287] (m) anti-ICOS antibodies described in WO98/3821, U.S. Pat. No. 7,932,358B2, US2002/156242, U.S. Pat. Nos. 7,030,225, 7,045,615, 7,279,560, 7,226,909, 7,196,175, 7,932,358, 8,389,690, WO02/070010, U.S. Pat. Nos. 7,438,905, 7,438,905, WO01/87981, U.S. Pat. Nos. 6,803,039, 7,166,283, 7,988,965, WO01/15732, U.S. Pat. No. 7,465,445 or U.S. Pat. No. 7,998,478 (e.g., JMAb-124, JMAb-126, JMAb-127, JMAb-128, JMAb-135, JMAb-136, JMAb-137, JMAb-138, JMAb-139, JMAb-140 or JMAb-141, e.g., JMAb136)

    [0288] (n) anti-ICOS antibodies described in WO2014/08911

    [0289] (o) anti-ICOS antibodies described in WO2012/174338

    [0290] (p) anti-ICOS antibodies described in US2016/0145344

    [0291] (q) anti-ICOS antibodies described in WO2011/020024, US2016/002336, US2016/024211 or U.S. Pat. No. 8,840,889

    [0292] (r) anti-ICOS antibodies described in U.S. Pat. No. 8,497,244

    [0293] (s) antibody clone ISA-3 (eBioscience), clone SP98 (Novus Biologicals), clone 1 G1, clone 3G4 (Abnova Corporation), clone 669222 (R&D Systems), clone TQ09 (Creative Diagnostics), clone 2C7 (Deng et al. Hybridoma Hybridomics 2004), clone ISA-3 (eBioscience) or clone 17G9 (McAdam et al. J Immunol 2000).

    [0294] KY1044 is a human anti-ICOS subclass G1 kappa monoclonal antibody. It has been developed with the intention of having dual mechanisms of action, namely depletion of TReg and co-stimulation (agonism) of TEff cells [7]. Sequences of the antibody KY1044 are shown in Table K herein.

    [0295] An anti-ICOS antibody may be one that competes for binding to human ICOS with an antibody (e.g., human IgG1, or an scFv) comprising the heavy and light chain CDRs of KY1044. An anti-ICOS antibody may bind ICOS with at least the same affinity as KY1044, or with an affinity within 50%, within 25% or within 10% of the affinity of KY1044 (e.g., as determined by surface plasmon resonance with chip-bound antigen or chip-bound IgG anti-ICOS antibody).

    [0296] An anti-ICOS antibody in the present invention may comprise one or more CDRs of KY1044 (e.g., all 6 CDRs, or a set of HCDRs and/or LCDRs) or variants thereof as described herein.

    [0297] The antibody may comprise an antibody VH domain comprising CDRs HCDR1, HCDR2 and HCDR3 and an antibody VL domain comprising CDRs LCDR1, LCDR2 and LCDR3, wherein the HCDR3 is the KY1044 HCDR3 or comprises that HCDR3 with 1, 2, 3, 4 or 5 amino acid alterations. The HCDR2 may be the HCDR2 of KY1044 or it may comprise that HCDR2 with 1, 2, 3, 4 or 5 amino acid alterations. The HCDR1 may be the HCDR1 of KY1044 or it may comprise that HCDR1 with 1, 2, 3, 4 or 5 amino acid alterations.

    [0298] The antibody may comprise an antibody VL domain comprising CDRs HCDR1, HCDR2 and HCDR3 and an antibody VL domain comprising CDRs LCDR1, LCDR2 and LCDR3, wherein the LCDR3 is the LCDR3 of KY1044 or comprises that LCDR3 with 1, 2, 3, 4 or 5 amino acid alterations. The LCDR2 may be the KY1044 LCDR2 or it may comprise that LCDR2 with 1, 2, 3, 4 or 5 amino acid alterations. The LCDR1 may be the KY1044 LCDR1 or it may comprise that LCDR1 with 1, 2, 3, 4 or 5 amino acid alterations.

    [0299] An antibody may comprise:

    [0300] an antibody VH domain comprising HCDRs HCDR1, HCDR2 and HCDR3, and

    [0301] an antibody VL domain comprising LCDRs LCDR1, LCDR2 and LCDR3,

    [0302] wherein the HCDRs are those of KY1044 or comprise the KY1044 HCDRs with 1, 2, 3, 4 or 5 amino acid alterations; and/or

    [0303] wherein the LCDRs are those of antibody KY1044 or comprise the KY1044 LCDRs with 1, 2, 3, 4 or 5 amino acid alterations.

    [0304] An antibody may comprise a VH domain comprising a set of HCDRs HCDR1, HCDR2 and HCDR3, wherein

    [0305] HCDR1 is the HCDR1 of KY1044 SEQ ID NO: 1,

    [0306] HCDR2 is the HCDR2 of KY1044 SEQ ID NO: 2,

    [0307] HCDR3 is the HCDR3 of KY1044 SEQ ID NO: 3,

    [0308] or comprising that set of HCDRs with 1, 2, 3, 4, 5 or 6 amino acid alterations.

    [0309] An antibody may comprise a VL domain comprising a set of LCDRs LCDR1, LCDR2 and LCDR3, wherein

    [0310] LCDR1 is the LCDR1 of KY1044 SEQ ID NO: 8,

    [0311] LCDR2 is the LCDR2 of KY1044 SEQ ID NO: 9,

    [0312] LCDR3 is the LCDR3 of KY1044 SEQ ID NO: 10,

    [0313] or comprising that set of LCDRs with 1, 2, 3 or 4 amino acid alterations.

    [0314] Amino acid alterations (e.g., substitutions) may be at any residue position in the CDRs.

    [0315] Preferably, the antibody comprises an ICOS binding site comprising the full set of 6 CDRs of KY1044.

    [0316] An anti-ICOS antibody according to the invention may comprise an antibody VH domain which is the VH domain of KY1044 SEQ ID NO 5 or which has an amino acid sequence at least 90% identical to the KY1044 antibody VH domain sequence. The amino acid sequence identity may be at least 95%, at least 96%, at least 97%, at least 98% or at least 99%.

    [0317] An anti-ICOS antibody according to the invention may comprise an antibody VL domain which is the VL domain of KY1044 SEQ ID NO: 12 or which has an amino acid sequence at least 90% identical to the KY1044 antibody VL domain sequence. The amino acid sequence identity may be at least 95%.

    [0318] Preferably, the antibody comprises the KY1044 VH and VL domains.

    [0319] As detailed elsewhere herein, antibodies may include constant regions, optionally human heavy and/or light chain constant regions. An exemplary isotype is IgG, e.g., human IgG1. An anti-ICOS antibody may comprise the KY1044 heavy chain SEQ ID NO: 7 and/or the KY1044 light chain SEQ ID NO: 14. KY1044 may be recombinantly produced as two heavy chains of 454 amino acid residues each, and two light chains of 215 amino acid residues each with inter and intra chain disulphide bonds that are typical of IgG1 antibodies.

    Immunotherapy

    [0320] Immunotherapy comprises treatment with an immunotherapeutic agent, which may be an anti-ICOS agent and/or an anti-TReg agent. It may be administered to the patient as a pharmaceutical formulation, e.g., by intravenous or subcutaneous injection. In preferred embodiments, the anti-ICOS and/or anti-TReg immunotherapy comprises administration of an anti-ICOS antibody such as KY1044 to the patient.

    [0321] Patients may also receive, concurrently, previously or subsequently, treatment according to the standard of care for their cancer, optionally including surgery. Sorafenib, a multikinase inhibitor, was the first systemic therapy approved for HCC. Since 2016, 4 other targeted agents, including 3 multikinase inhibitors and one antivascular endothelial growth factor receptor (VEGFR) monoclonal antibody, have been demonstrated in phase Ill clinical trials to provide survival benefits to patients with advanced HCC [71, 72, 73, 74]. Regulatory agencies of multiple countries have approved lenvatinib as a first-line systemic therapy for HCC and approved regorafenib, cabozantinib, and ramucirumab (limited to patients with α-fetoprotein >400 ng/mL) for the treatment of those with HCC who have been previously treated with sorafenib. Anti-PD-1 antibody has also been used as a second line treatment in advanced HCC.

    [0322] Treatments which may be combined with, or substituted for, anti-ICOS and/or anti-TReg immunotherapy include those that induce immunological cell death, which is characterised by release of ATP and HMGB1 from the cell and exposure of calreticulin on the plasma membrane [75, 76]. Treatments that induce immunological cell death include radiation (e.g., ionising irradiation of cells using UVC light or γ rays), chemotherapeutic agents (e.g., oxaliplatin, anthracyclines such as doxorubicin, idarubicin or mitoxantrone, BK channel agonists such as phloretin or pimaric acid, bortezomib, cardiac glycosides, cyclophosphamide, GADD34/PP1 inhibitors with mitomycin, PDT with hypericin, polyinosinic-polycytidylic acid, 5-fluorouracil, gemcitabine, gefitnib, erlotinib, or thapsigargin with cisplatin) and antibodies to tumour-associated antigens. The tumour-associated antigen can be any antigen that is over-expressed by tumour cells relative to non-tumour cells of the same tissue, e.g., HER2, CD20, EGFR. Suitable antibodies include herceptin (anti-HER2), rituximab (anti-CD20), or cetuximab (anti-EGFR).

    [0323] Other treatments which may be combined with anti-ICOS and/or anti-TReg immunotherapy, and methods of administering anti-ICOS treatments and/or combination therapy, are described in WO2018/029474 which is incorporated herein by reference in its entirety.

    [0324] Methods of the present invention, including methods of determining biomarkers and methods in which patient samples are monitored for a signature of response comprising changes in one or more biomarkers, may be used to inform prescription of these or other treatments.

    [0325] A patient who receives surgery to remove or reduce a tumour may receive immunotherapy before and/or after the surgery. Immunotherapy following surgery may treat remaining tumour tissue and/or other remaining primary tumours or metastases.

    Statistical Methods and Modelling

    [0326] Kaplan-Meier curves and log rank tests are examples of univariate analysis. They describe the survival solely according to the selected factor under investigation. An alternative method is the Cox proportional hazards (COX-PH) regression analysis, which works for both quantitative predictor variables and for categorical variables. Furthermore, the Cox regression model extends survival analysis methods to assess simultaneously the effect of several risk factors on survival time.

    [0327] As demonstrated in the appended Examples, reference (cut-off) values may be determined as the value at which patients can be differentiated with statistical significance with respect to the clinical measure (e.g., OS). Cut-off values may be determined empirically by testing a series of cut-off values to identify a value providing statistical significance (e.g., p<0.05 by log rank test), preferably the value with the highest statistical significance. Preferably, cut-off values are determined from the data by ROC analysis—see [77], incorporated herein by reference. Optionally, the cut-off value is the median reading of the biomarker, the top quartile reading of the biomarker or the bottom quartile reading of the biomarker.

    [0328] Where reference values are calculated, it may be convenient to include a multiplication or division factor, in order to express the value at a desired order of magnitude. For example, if a cut-off value is determined to be 0.001, this may conveniently be expressed as 1 by including a multiplication factor of 1000. Biomarker readings from test samples are then multiplied by the same factor, for comparison against the reference value. Similarly, reference numbers and biomarkers may be transformed to generate other values on any desired scale (whether numerical, visual (e.g., a colour chart), auditory or other), and the biomarker readings may still validly be compared against said reference values provided that the same transformation is consistently performed. Thus, the invention need not be constrained by the manner in which biomarker data are presented. Rather, readings and reference values used in the invention will be those that are representative of the underlying data, so that (for example) a biomarker reference value representing a density of 100 ICOS positive cells per mm.sup.2 tumour core may be expressed as “100 cells per mm.sup.2” or as “0”. In the latter instance a subtraction of 100 is applied, so a tumour sample from which a density of 110 cells per mm.sup.2 is calculated is then converted to 10 for comparison against the 0 reference value.

    [0329] An example of the use of logistic regression analysis to identify biomarker variables that can be used to guide prognosis and treatment of patients is found in the study by Kagamu et al [27]. That study identifies the status of CD4+ T cells in the peripheral blood of patients as biomarkers that can identify patients presenting early disease progression after nivolumab treatment, enabling classification of patients as non-responders or responders. The authors describe a formula based on the percentages of CD62.sup.low CD4+ T cells and CD25+ FOXP3+ cells in peripheral blood of patients with non-small cell lung cancer to predict non-responders. The prediction formula was developed by using the discovery cohort data with a logistic regression model. The performance of the prediction formula was evaluated using the independent validation cohort data. Survival curves were estimated using the Kaplan-Meier method. All P values were two-sided, and p<0.05 was considered statistically significant. Tests for differences between two populations were performed using a Student t test. Multiple-group comparison was performed using one-way ANOVA with Tukey post hoc analysis.

    [0330] This type of modelling can be generally applied to clinical data from cancer patients in order to identify biomarkers and combinations of biomarkers which allow meaningful classification of patients, e.g., according to predicted survival and/or likelihood of response to treatment. A number of software packages are available to run the statistical analyses and modelling, including SAS 9.4 (SAS Institute Inc.) and Prism 8 (GraphPad).

    EXAMPLES

    [0331] Much information can be read from a tumour tissue section, and insight is gained about the nature of the TME by observing the spatial arrangement of cells, including the distribution, spread, clustering and proximity of various different cell types in relation to one another. Previously, the density of immune cells within 20 μm of a melanoma cell was reported to be associated with response to immune checkpoint blockers (Gide et al 2020). In the present invention, we reveal that the spatial arrangement of immune cells expressing ICOS and/or FOXP3 in the TME is a biomarker for disease prognosis and for response to immunotherapy. In the Examples below we describe analyses of ICOS positive, FOXP3 positive and ICOS FOXP3 double positive cells in the TME of HCC samples, characterising the TME in terms of the density, ratios, intercellular distances and numbers of these cells. We co-stained for ICOS and FOXP3 and measured the density of ICOS single positive, FOXP3 single positive and ICOS FOXP3 double positive cells per mm.sup.2, the ratio of different stained cells (e.g., ratio of FOXP3 single positive cells to ICOS FOXP3 double positive cells), the distance between different stained cells (e.g., average distance of ICOS FOXP3 double positive cells to ICOS single positive cells) and the number of ICOS FOXP3 double positive cells in a region of influence (defined by a radius of 30 μM) around ICOS single positive cells.

    [0332] We looked for associations between these measurements of the TME and clinical outcomes or clinical metadata. We describe how such measurements represent biomarkers for disease prognosis (including overall survival) and for response to anti-ICOS and/or anti-TReg immunotherapy.

    [0333] ICOS FOXP3 double positive cells are identified as active TReg, characteristic of an immunosuppressive TME. HCC tumours were found to contain a high proportion of ICOS+ TRegs, implying a strongly immunosuppressive environment. Higher density of ICOS+ cells, a higher ratio of ICOS+ FOXP3+ dual positive cells to total FOXP3+ cells, a closer proximity between ICOS+ TRegs and other ICOS+ cells, and higher numbers of ICOS+ TReg in regions of influence were all associated with poorer overall survival.

    [0334] We describe how anti-TReg anti-ICOS and/or immunotherapy may provide clinical benefit, including extended survival, in patients exhibiting these biomarkers in the TME. The anti-ICOS antibody KY1044 is an ideal candidate therapeutic agent because of its ability to target ICOS positive cells and to selectively deplete cells with high expression of ICOS, removing the highly immunosuppressive TReg and boosting the anti-tumour immune response.

    Example 1. Increased Number and Ratio of ICOS Positive TRegs in the TME Vs Peritumour

    [0335] It was previously reported that in a cohort of 20 HCC patients there was an increase in ICOS FOXP3 double positive cells in the TME compared with adjacent normal tissue[3]. In the present study we assessed data from a large cohort of patients, which confirm and extend the previous findings. We found a significant increase of ICOS FOXP3 double positive cells in the TME compared with peritumour tissue in HCC samples. We also observed a significant increase in the ratio of ICOS positive TReg (ICOS FOXP3 double positive cells) to total TReg (FOXP3 positive cells) (p<0.001) in tumour core vs peritumour. A high density of tumour-infiltrating TReg is thought to be an unfavourable prognostic indicator of HCC. With the fact that ICOS+ FOXP3+ cells have been reported to be highly immunosuppressive through the production of both TGF-β and IL-10[78], our findings indicate that HCC tumours should strongly benefit from a strategy aimed at depleting ICOS FOXP3 double positive cells. Tumours with higher ratios of ICOS FOXP3 double positive cells to ICOS negative FOXP3 positive cells should benefit the most.

    Tumour Samples

    [0336] Tumour tissues were originally collected from HCC patients who received hepatectomy at the National Taiwan University Hospital, Taipei, Taiwan. Formalin-fixed, paraffin-embedded tissue sections (5 μm thickness) were retrieved for the present study from archived tissues.

    Patient Data

    [0337] A total of 142 patients (male:female=112:30, median age of 61.0 years) were enrolled in the study cohort. Among them, 87 (61.3%) had chronic hepatitis B virus (HBV) infection, 33 (23.2%), had chronic hepatitis C (HCV) infection, and 22 (15.5%) had no HBV/HCV infection. No patients were double positive for HBV and HCV. Patients with AFP<20 ng/mL or early stage disease had significantly improved median overall survival (OS). OS was calculated from the date of hepatectomy to the date of the patient's death or their final follow-up day. Median OS was calculated as the length of time after diagnosis at which half of the patients in the cohort were still on study. In this cohort, the median OS was of 100.3 months. The age, gender and viral etiology were not significantly associated with changes in OS.

    Immunohistochemistry

    [0338] A sequential dual multiplex IHC assay was performed to detect ICOS and FOXP3 expressing cells in the 5 μm tissue sections as follows. Tissue slides were deparaffinised, rehydrated, and autoclaved in citrate buffer (pH 6.0) for 10 minutes using a decloaking chamber for antigen retrieval, followed by blocking with hydrogen peroxide and then a casein-containing blocking reagent (Background Sniper, BioCare Medical) to reduce non-specific background staining. The slides were then incubated with an anti-ICOS antibody (dilution 1:800; clone D1K2T; Cell Signaling) at 4° C. overnight. The MACH1 Universal HRP-Polymer detection kit (BioCare Medical) was applied, including a secondary antibody to detect D1K2T, and an automated DAB detection was carried out as per manufacturer's recommendations. DAB (3,3′-diaminobenzidine) is a derivative of benzene and provides a brown colour stain.

    [0339] Blocking steps was repeated and the slides were then incubated with anti-FOXP3 antibody (dilution 1:800; clone 236A/E7; Abcam) at 4° C. overnight. The MACH1 Universal HRP-Polymer detection kit was applied, including a secondary antibody for detection, and Vina Green Chromogen Kit (BioCare Medical) was carried out as per manufacturer's recommendations. The Vina Green Chromagen provides a green colour stain, used here as a secondary staining for FOXP3. The slides were counterstained with haematoxylin and bluing reagent, which converts the initial soluble red colour of the haematoxylin within the nucleus to an insoluble blue colour. The alkaline pH of the bluing solution also causes the mordant dye-lake to reform in the tissue and become more permanent. The result is a stain of all cell nuclei, which shows the overall architecture of the tissue and provides a contextual background against which the two IHC chromagens can be viewed, facilitating subsequent analysis by the pathologist or computer. Finally, all slides were removed from the instrument, washed, dehydrated and mounted in a permanent mounting medium following standard IHC procedures.

    Digital Pathology

    [0340] The 5 μm IHC stained tissue slides were scanned at 20× magnification using a Hamamatsu Nanozoomer digital scanner in brightfield mode. Dual-IHC analysis of whole slide images was performed with the Indica Labs HALO® platform. In brief, the process involved a 3-chromogen colour deconvolution to separate the IHC chromogens (×2) plus counterstain. Cell objects were formed by applying weighted optical density values for the individual chromogens. Each positive cell type was then identified using defined size, shape and subcellular compartment staining parameters. A classifier was developed and integrated into the algorithm to automatically segment the tissue regions of interest for analysis. The completed algorithm was applied to all tissue section images in the study in an automated and objective manner to generate detailed cell-by-cell data. All scanned images were reviewed and the following regions were defined and manually annotated: [0341] invasive margin: edge of tumour as defined by pathologist [0342] core (TME): tumour centre >500 μm inwards from the invasive margin [0343] peritumour stroma: tissue around tumour >500 μm outwards from the invasive margin.

    [0344] Tissue folds and/or staining artefacts were omitted from the analysis by manual exclusion.

    Results and Conclusions

    [0345] The density of ICOS+ FOXP3+ cells was significantly higher (p<0.001 by paired T test) in the TME (tumour core) than in the peritumour area. FIG. 2.

    [0346] The ratio of ICOS positive TRegs (ICOS FOXP3 double positive cells) to total FOXP3 cells was also significantly higher in the TME (tumour core) than in the peritumour area (p<0.001 by paired T test). FIG. 3.

    [0347] These findings are consistent with earlier work in HCC in which ICOS+ TRegs were more prevalent in TME than in the peritumour area [3].

    [0348] The high number and proportion of TReg expressing ICOS in HCC implies a strongly immunosuppressive environment in these tumours. Anti-ICOS and/or anti-TReg immunotherapy is likely to be of benefit in HCC with these characteristics.

    [0349] These effects were more pronounced in viral-related cancers, which suggests viral-associated or virally induced cancers (e.g., HBV positive HCC, HCV positive HCC) may be more likely to respond to anti-ICOS and/or anti-TReg immunotherapy, although the result did not reach statistical significance in the present study.

    Example 2. ICOS is a Biomarker for Disease Prognosis

    [0350] Using the same HCC patient cohort as in Example 1, we uncovered links between patient survival and the density of ICOS+ cells and proportion of ICOS+ TReg in the tumour samples. Higher density of ICOS positive cells was linked to shorter OS. Higher proportion of ICOS positive TReg was also linked to shorter OS.

    Sample Processing

    [0351] Tumour samples were processed and IHC and digital pathology work were conducted as described in Example 1.

    Data Analysis

    [0352] Associations between cell measurements and survival were analysed by constructing Kaplan-Meier curves for patient populations divided according to different cell measurements. Differences in survival between patient populations were compared by log rank test. Kaplan-Meier log-rank analyses were performed using Graphpad Prism 8.3.1.

    [0353] Statistical analyses were performed using SAS statistical software (version 9.4, SAS Institute Inc., Cary, N.C., USA). A two-sided p value of <0.05 was considered statistically significant. The OS and RFS of patients in different subgroups were estimated using the Kaplan-Meier method and compared using the log-rank test. The unpaired T test was used to compare the differences in cell densities.

    [0354] The hazard ratio (HRs, Mantel-Haenszel) with 95% confidence intervals (CIs) was also used to estimate the degree of the association between the ratio of ICOS+ TReg to total TReg and prognosis of HCC cancer.

    Results and Conclusions

    [0355] The effect of ICOS+ TReg proportion and of ICOS+ cell density and on HCC prognosis were each examined by constructing Kaplan-Meier curves, and differences in OS and were compared by log rank test. Patients with a high ratio of ICOS.sup.+FOXP3.sup.+/total FOXP3.sup.+ cells (p=0.074) or with high ICOS+ cell density in the TME were associated with a shorter OS (p<0.05).

    [0356] The results demonstrated a significant correlation between high ICOS cell density and bad prognosis (poor survival), suggesting that low ICOS expression, manifesting as a lower density of ICOS+ cells in the TME, is a predictor for better survival of patients with HCC. We found that for patients having 120 or more ICOS positive cells per mm.sup.2 in the TME, median OS was more than halved compared with other patients. Patients with a low density (<120 cells per mm.sup.2) had a median survival of 147.3 months whereas those with a high density (>=120 cells per mm.sup.2) had a median survival of 68.9 months. FIG. 4. The cut-off of 120 cells is a rounded value. Statistical significance was observed with other similar cut-off numbers, e.g., 123 cells per mm.sup.2. The hazard ratio (HRs, Mantel-Haenszel) with 95% confidence intervals (CIs) for the association between the density of ICOS+ cells and prognosis of HCC cancer was calculated as 0.5774 with CI 0.3346-0.9963; p<0.05

    [0357] When the analysis was performed with figures for relapse free survival (RFS) rather than overall survival (OS), the log-rank (Mantel-Cox) test did not indicate statistical significance for the difference in % RFS for patient populations stratified according to the highest quartile (5120 cells per mm.sup.2) vs the bottom 3 quartiles (<120 cells per mm.sup.2).

    [0358] A high proportion of ICOS positive TRegs in the TReg population was also associated with worse prognosis for survival. We found that patients for whom 50% or more of TReg were ICOS positive, median OS was halved compared with other patients. Patients with a low ratio (<0.5) had a median survival of 147.3 months whereas those with a high ratio (>=0.5) had a median survival of 61.6 months. FIG. 5. Hazard ratio for the association was 0.5870 with confidence intervals of and CI 0.3486-0.9885; p=0.0451.

    [0359] The cut-off ratio of 0.5 in this population was determined empirically as the ratio at which patients could be differentiated with statistical significance with respect to survival time. A split of the cohort using the median ratio (0.33) similarly divided patients into those with longer and shorter survival, and patients with a higher ratio had longer survival, but without meeting statistical significance. The same applied when splitting the cohort into patients with top quartile vs bottom quartile of the ratio, i.e., a difference was observed but did not meet statistical significance.

    [0360] When the effect on RFS (rather than OS) was assessed, separating the cohort on a cut-off ratio of 0.5, we saw a clear separation of data, with % RFS being higher in patients with a ratio <0.50. This reflects the same trend observed with OS, but the difference for RFS was not statistically significant according to the log-rank (Mantel-Cox) test.

    [0361] In conclusion, patients with a higher density of ICOS+ cells and/or a higher ratio of ICOS+ TReg to total TReg in the TME have a worse survival, and treatment with an anti-TReg therapeutic agent should address at least one cause of this by decreasing the number of ICOS+ TReg and effecting an anti-tumour response to improve survival.

    Example 3. ICOS is a Prognostic Biomarker in HBV Positive HCC

    [0362] Chronic infection with hepatitis B virus (HBV) is linked to the pathogenesis of HCC. Through further analysis of the data from Example 2, we found that a high density of ICOS positive cells per mm.sup.2 in the TME of HBV positive tumours was associated with poor prognosis. When focusing on HBV positive HCC tumours, the results demonstrated a significant correlation between high ICOS cell density and bad prognosis, suggesting that low ICOS expression, manifesting as a lower density of ICOS+ cells in the TME, is a predictor for better survival of patients with HCC associated with HBV infection.

    [0363] Whereas a cut-off value of 120 cells per mm.sup.2 was used to differentiate patient populations for HBV agnostic HCC (Example 2), a lower cut-off value of 100 cells per mm.sup.2 was determined for HBV positive HCC. Patients with 100 or more ICOS positive cells per mm.sup.2 or more in the TME (top quartile) exhibited a median OS of 26.1 months, whereas OS was undefined/not reached for patients having less than 100 ICOS cells per mm.sup.2 (bottom three quartiles). FIG. 6. Statistical significance by log-rank (Mantel-Cox) test was p<0.05. The same analysis for RFS rather than OS did not meet statistical significance.

    [0364] The hazard ratio (HRs, Mantel-Haenszel) with 95% confidence intervals (CIs) was also used to estimate the degree of the association between the density of ICOS positive cells and prognosis of HCC cancer (OS). HR of 0.4345 and CI 0.2131-0.8861 p=0.0219.

    Example 4. ICOS is a Prognostic Biomarker in AJCC Stage 2 HCC

    [0365] Through further analysis of the data from Example 2, we found that a high density of ICOS positive cells per mm.sup.2 in the TME of AJCC stage 2 HCC tumours was associated with poor prognosis. Similarly to Example 3, we found that when focusing on AJCC2 HCC tumours, the results demonstrated a significant correlation between high ICOS cell density and bad prognosis, suggesting that low ICOS expression, manifesting as a lower density of ICOS+ cells in the TME, is a predictor for better survival of patients with AJCC2 HCC.

    [0366] Whereas a cut-off value of 120 cells per mm.sup.2 was used to differentiate patient populations for HBV agnostic HCC (Example 2), a lower cut-off value of 100 cells per mm.sup.2 was determined for AJCC stage 2 HCC. Patients with 100 or more ICOS positive cells per mm.sup.2 or more in the TME (top quartile) exhibited a lower median OS compared with patients having less than 100 ICOS cells per mm.sup.2 (bottom three quartiles). FIG. 7. Statistical significance by log-rank (Mantel-Cox) test was p<0.01.

    [0367] Patients with 100 or more ICOS positive cells per mm.sup.2 or more in the TME (top quartile) also exhibited a lower % RFS compared with patients having less than 100 ICOS cells per mm.sup.2 (bottom three quartiles). FIG. 8. Statistical significance by log-rank (Mantel-Cox) test was p<0.05.

    [0368] We believe the lower cut-off value of 100 cells per mm.sup.2 would also be appropriate for more advanced stages of HCC, e.g., stage 3 HCC. This could be verified by analysis of samples and survival data for the 18 patients with stage 3 AJCC in the present cohort.

    Example 5. Intercellular Distances are Biomarkers for Prognosis

    [0369] The distribution of immune cells relative to each other may influence not only the anti-tumour immune status of a patient but also the patient's survival. Using the tumour samples from the same HCC patient cohort as the previous Examples, we measured distances between ICOS FOXP3 double positive cells and ICOS single positive (ICOS positive FOXP3 negative) cells. ICOS FOXP3 double positive cells represent active TReg which are highly immunosuppressive to CD8+ cytotoxic T cells and CD4+T helper cells. ICOS single positive cells are considered as non-TReg lymphocytes, such as activated CD8+ cytotoxic T cells and CD4+T helper cells. Thus in this study we investigated the spacing between the effector T cells which may be mediating an anti-tumour immune response, and active TReg which may be suppressing that response. Although intercellular distances were studied here in dead tissue, it is believed that the methods used to sample and preserve the tissue, and the IHC and digital pathology techniques used, preserve the integrity of the tissue such that the distances between cells are representative of those in the tumour in vivo immediately prior to sampling.

    [0370] We discovered that the average distance from ICOS single positive cells to the nearest ICOS FOXP3 double positive cell was correlated with overall survival. A shorter distance between cells was associated with shorter survival.

    Cell:Cell Proximity Measurement

    [0371] The cell density and distances between ICOS or FOXP3 single- and ICOS/FOXP3 dual-expressing cells in the tumour core, margin, and the peritumour area were quantitated by digital pathology as follows.

    [0372] Quantification of cells positive for multiple chromogenic markers within a defined region was done. Quantification of cells in which multiple chromogenic markers co-localise was done.

    [0373] Spatial relationships of the different cell populations identified were investigated. A classification algorithm was developed using a Random Forest approach and applied to each whole slide image to identify viable tissue within each region (margin/core/peritumour). A separate customised multiplex IHC algorithm was developed to quantify FOXP3 and ICOS single and dual ICOS/FOXP3 IHC positive stained cells. Specifically, haematoxylin and IHC chromogen stains were weighted differentially to segment cells within the regions and to establish an accurate cell count. Threshold values were adjusted for each chromogen to determine cells positive for FOXP3 only (teal nuclear chromogen), ICOS only (3,3′-diaminobenzidine (DAB) brown chromogen) and dual FOXP3/ICOS. FOXP3 and ICOS single and dual cell counts were normalised across the viable tissue area for each region to obtain the number of cells positive per mm.sup.2 of tissue per region for each whole slide image.

    [0374] The cell-based analysis data was further utilised to plot the spatial location of detected cell phenotypes within the tumour core. These plots were subsequently used to generate proximity and relative spatial distribution data for ICOS single and dual FOXP3/ICOS cells using the Spatial Analysis module embedded within Halo platform. For each set of sections per cancer type, average distance data for every ICOS single positive cell to its nearest dual FOXP3/ICOS positive cell within the tumour core per whole slide image were initially generated. This was followed by measuring the number of dual FOXP3/ICOS positive cells within 30 μm of every ICOS single positive cell within the tumour core per whole slide image. Proximity analysis was then performed for the dual FOXP3/ICOS positive cells within 30 μm of an ICOS single positive cell, to generate the average distance of these cells from their nearest ICOS single positive cell.

    Data Analysis

    [0375] Data analysis was generally performed as described in Example 2.

    Results and Conclusions

    [0376] We calculated the average (mean) distance from ICOS single positive cells to their nearest ICOS FOXP3 double positive cell in each of the 142 HCC samples from the Taiwan NTU cohort. The median average distance in this cohort was 105 μm. Using this median as a cut-off value to stratify the cohort, we found that patients with an average distance of less than 105 μm had significantly lower overall survival than patients with an average distance of 105 μm or greater. FIG. 9. This stratification did not show a statistically significant association with RFS. The hazard ratio (HRs, Mantel-Haenszel) with 95% confidence intervals (CIs) was used to estimate the degree of the association between the distance of ICOS+ single positive cells to the nearest ICOS FOXP3 double positive cell and overall survival of HCC cancer. We calculated HR of 1.692 (high distance vs low distance) and CI were 1.063-2.694; p=0.0266.

    [0377] Thus, a shorter distance between ICOS+FOXP3+ cells and ICOS+FOXP3− cells was significantly associated with a shorter OS (p<0.05), which suggests that ICOS+ TReg are actively immunosuppressing ICOS+ TEff in the TME of HCC.

    Example 6. Zonal Influence of Immunosuppressive TReg in Radius of TEff

    [0378] Following on from the previous Examples, we further studied the spatial distribution of ICOS+ FOXP3+ and ICOS+ single positive cells to identify potential implication of having a high density of the highly immunosuppressive ICOS+FOXP3+ double positive TRegs next to ICOS+ single positive cells (potentially effector cells). Focusing on the TME, we identified and counted the number of ICOS FOXP3 double positive cells that were within 30 μm of any ICOS single positive cell.

    [0379] Defining a zone by taking a radius of 30 μm around each ICOS single positive cell, we measured the total number of ICOS FOXP3 double positive cells falling within any one or more such zones in the TME, then divided this cell count by the total number of ICOS single positive cells in the TME area, to give a ratio which we term the zonal influence ratio.

    [0380] We identified a statistically significant association between overall survival and the zonal influence ratio. In patient samples having a zonal influence ratio of <0.1, the patient OS (but not RFS) was significantly greater than in samples having an average of ≥0.1. FIG. 10 and Table E6-1.

    TABLE-US-00001 TABLE E6-1 Median survival Bottom 3 quartiles Undefined Top quartile 79.00   Hazard Ratio (Mantel-Haenszel) A/B B/A Ratio (and its reciprocal) 0.6099 1.640 95% CI of ratio 0.3819 to 0.9741 1.027 to 2.618

    Example 7. Value of Immunotherapy

    [0381] The Examples above indicate that the following characteristics are all associated with a poorer OS: [0382] greater ICOS expression (higher density of ICOS+ cells) in tumour core (TME) [0383] greater ratio of ICOS*FOXP3+/total FOXP3+ cells [0384] greater proximity (shorter distance) between ICOS+ TReg and other ICOS+ cells [0385] greater number of ICOS+FOXP3+ TRegs within 30 m of ICOS single positive cells.

    [0386] We conclude that an immunosuppressive TME is clinically significant in HCC. TReg could suppress function and proliferation of CD4+ and CD8+ TEff. This is consistent with earlier studies in which an increase of TReg and decrease of CD8+ T cells in TME was associated with poor prognosis in patients with solid tumours, including HCC [2].

    [0387] Depleting/reducing ICOS.sup.high positive TReg in such tumours, e.g., with an antibody such as KY1044, should improve the immune contexture by reducing immunosuppression and provide clinical benefit in patients with HCC and other tumours characterised by these features.

    [0388] KY1044 has been shown to deplete ICOS+FOXP3+ TReg in cancer patients. In multiple cohorts of patients in a clinical trial with KY1044 monotherapy, KY1044 decreased the ratio of ICOS+FOXP3+ TReg to all FOXP3+ TReg from baseline (screening) to 8 days following the second cycle of dosing (C2D8) with dosing at 3 weekly intervals. FIG. 11.

    Example 8. Calculating Biomarkers from a Patient Tumour Sample

    [0389] We illustrate the determination of biomarker readings from a tumour sample from the patient cohort described in Examples 1 to 6.

    [0390] A tissue slide was prepared from the tumour sample, stained for ICOS and FOXP3, and digitally analysed as described in Example 1. FIGS. 12 to 14.

    [0391] The area of tumour core (AREA_TME) was defined and quantified.

    [0392] The following data were recorded for cells within the tumour core: [0393] number of ICOS single positive cells (SPICOS_NB_TME); [0394] number of FOXP3 positive cells (TOTFOXP_NB_TME); [0395] number of ICOS FOXP3 double positive cells (DP_NB_TME); [0396] the average (mean) distance from each ICOS single positive cell to its nearest ICOS FOXP3 double positive cell (DIST_SPICOS_TME), representing intercellular proximity between ICOS+ FOXP3+ cells and ICOS+ FOXP3− cells; calculation of this average was performed automatically by the Halo® software from its distance measurements and cell count data; and [0397] the number of ICOS FOXP3 double positive cells that were within 30 μm of any ICOS single positive cell (DP_NB_30UMSPICOSROI_TME).

    [0398] Summing the number of ICOS single positive cells and the number of ICOS FOXP3 double positive cells gives the total number of ICOS positive cells (TOTICOS_NB_TME).

    [0399] Dividing the total number of ICOS positive cells by the area of tumour core gives the density of ICOS positive cells (TOTICOS_DEN_TME).

    [0400] Dividing the number of ICOS FOXP3 double positive cells by the total number of FOXP3 positive cells gives the proportion of FOXP3 positive cells which are ICOS positive (“ICOS+ TReg proportion”) (RATIO_DP_TO_TOTFOXP_TME).

    [0401] Dividing the number of ICOS FOXP3 double positive cells that were within 30 μm of any ICOS single positive cell by the total number of ICOS single positive cells in the TME gives the zonal influence ratio (RATIO_DP_30UMSPICOSROI_TO_SPICOS_TME).

    TABLE-US-00002 TABLE E8-1 Data from tissue sample obtained from HCC stage 1 HBV+ tumour. Biomarker reference values calculated from the whole patient cohort are shown in the far right column. Cut-off Sample value AREA_TME 168.49 TOTICOS_NB_TME 43347 TOTICOS_DEN_TME 257 100 SPICOS_NB_TME 29254 TOTFOXP_NB_TME 21825 DP_NB_TME 14093 RATIO_DP_TO_TOTFOXP_TME 0.646154 0.5 DIST_SPICOS_DP_TME 51.7492 105 DP_NB_30UMSPICOSROI_TME 6863 RATIO_DP_30UMSPICOSROI_TO_SPICOS_TME 0.234600397 0.1

    [0402] Each of the ICOS+ cell density, intercellular proximity, the ICOS+ TReg proportion, and the zonal influence ratio are biomarkers for prognosis and treatment of patients in the present invention. The biomarker readings for the patient can be compared against the reference values for the cohort. The example biomarker data from the sample would indicate a poor prognosis, because the density of ICOS positive cells is greater than 100 mm.sup.2, the ratio of ICOS+ FOXP3+ cells to total FOXP3+ cells is greater than 0.5, the average distance from an ICOS+ FOXP3− cell to its nearest ICOS+ FOXP3+ cell is less than 105 μm, and the zonal influence ratio is greater than 0.1. A patient having an HCC tumour presenting with this data would be expected to have relatively short survival compared with other HCC patients. The biomarker data indicate that the patient would benefit from treatment with an anti-ICOS and/or anti-TReg immunotherapeutic agent, which could extend the patient's survival.

    Example 9. Calculating ICOS+ TReg Proportion

    [0403] A tissue slide was prepared from another tumour sample from the patient cohort described in Examples 1 to 6. The section of tissue was stained for ICOS and FOXP3, and digitally analysed as described in Example 1. FIG. 15.

    [0404] Analysis read-out for the ICOS+ TReg proportion was as follows:

    [0405] Number of ICOS FOXP3 double positive cells in TME=11,066

    [0406] Number of FOXP3 single positive cells in TME=10,842

    [0407] Total FOXP3 cells in TME=21,908

    [0408] Ratio=11,066/21,908=0.51

    REFERENCES

    [0409] 1 Wei, Duffy & Allison, Cancer Discov. 2018 [0410] 2 Gao Q, et al. J Clin Oncol 25:2586-93 2007 [0411] 3 Tu J F, et al. Sci Rep 6:35056 2016 [0412] 4 Strauss L, et al J Immunol 180:2967-2980 2008 [0413] 5 Kornete M, Sgouroudis E, Piccirillo C A. J Immunol 188:1064-1074 2012 [0414] 6 32nd Annual Meeting and Pre-Conference Programs of the Society for Immunotherapy of Cancer (SITC 2017): Part Two. Poster P288 Journal for ImmunoTherapy of Cancer 5:87 2017 [0415] 7 Sainson et al., BioRxiv September 2019 doi:10.1101/771493 [0416] 8 Mo et al Vaccine 35:5932-5938 2017 [0417] 9 Hansen A, et al. Annals of Oncology 29 2018 [0418] 10 El-Khoueiry A B, et al. Lancet 389:2492-2502 2017 [0419] 11 Zhu A X, et al. Lancet Oncol 19:940-952 2018 [0420] 12 Yau T, et al. Annals of Oncology 30 2019 [0421] 13 Finn R S, et al. J Clin Oncol 1901307 2019 [0422] 14 Calderaro, J. et al. Programmed death ligand 1 expression in hepatocellular carcinoma: Relationship With clinical and pathological features. Hepatology 64, 2038-2046 2016 [0423] 15 Yau T, et al. J Clin Oncol 37:4012-4012 2019 [0424] 16 Cheng A-L, et al. Annals of Oncology 30 2019 [0425] 17 Sicklick et al., Nat Med, April 2019 doi:10.1038/s41591-019-0407-5 [0426] 18 Ali et al., PLoS Med. 13:e1002194 2016 [0427] 19 Newman et al., Nat Methods 12:453-457 2015 [0428] 20 Aran, Hu & Butte, Genome Biol 18:220 2017 [0429] 21 Binneweis et al., Nat Med 24:541-550 2018 [0430] 22 Cristescu et al., Science 362 2018 [0431] 23 Jiang et al. Nat Med. 2018 [0432] 24 Romano et al., PNAS 112(19):6140-6145 2015 [0433] 25 Yap T A, et al J Clin Oncol 36:3000 2018 [0434] 26 Feng et al., JCI Insight 2(14):e93652 2017 [0435] 27 Kagamu et al., Cancer Immunology Research 8:334-344 2020 DOI: 10.1158/2326-6066.CIR-19-0574 [0436] 28 AJCC Cancer Staging Manual, Eighth Edition 2018 [0437] 29 Malik, N. & Daymon, M. Improved double immunoenzyme labelling using alkaline phosphatase and horseradish peroxidase. J. Clin. Pathol. 35, 1092-1094 1982 [0438] 30 Lan, H. Y., Mu, W., Nikolic-Paterson, D. J. & Atkins, R. C. A novel, simple, reliable, and sensitive method for multiple immunoenzyme staining: use of microwave oven heating to block antibody crossreactivity and retrieve antigens: J. Histochem. Cytochem. 2017 doi:10.1177/43.1.7822770. [0439] 31 Ferri, G.-L., Gaudio, R. M., Castello, I. F., Berger, P. & Giro, G. Quadruple Immunofluorescence: A Direct Visualization Method: J. Histochem. Cytochem. 2016 doi:10.1177/002215549704500201 [0440] 32 Boorsma, D. M. Direct immunoenzyme double staining applicable for monoclonal antibodies. Histochemistry 80, 103-106 1984 [0441] 33 Zhang, W. et al. Fully automated 5-plex fluorescent immunohistochemistry with tyramide signal amplification and same species antibodies. Lab. Invest. 97, 873-885 2017 [0442] 34 Shi, S. R., Key, M. E. & Kalra, K. L. Antigen retrieval in formalin-fixed, paraffin-embedded tissues: an enhancement method for immunohistochemical staining based on microwave oven heating of tissue sections. J. Histochem. Cytochem. Off. J. Histochem. Soc. 39, 741-748 1991 [0443] 35 Shi, S.-R., Shi, Y. & Taylor, C. R. Antigen Retrieval Immunohistochemistry. J. Histochem. Cytochem. 59, 13-32 2011 [0444] 36 Hennig, C., Adams, N. & Hansen, G. A versatile platform for comprehensive chip-based explorative cytometry. Cytometry A 75A, 362-370 2009 [0445] 37 Giesen, C. et al. Highly multiplexed imaging of tumor tissues with subcellular resolution by mass cytometry. Nat. Methods 11, 417-422 2014 [0446] 38 Angelo, M. et al. Multiplexed ion beam imaging (MIBI) of human breast tumors. Nat. Med. 20, 436-442 2014 [0447] 39 Bandura, D. R. et al. Mass Cytometry: Technique for Real Time Single Cell Multitarget Immunoassay Based on Inductively Coupled Plasma Time-of-Flight Mass Spectrometry. Anal. Chem. 81, 6813-6822 2009 [0448] 40 Mavropoulos, A. et al. Equivalence of Imaging Mass Cytometry and Immunofluorescence on FFPE Tissue Sections, 2017 [0449] 41 Wagner, J. et al. A Single-Cell Atlas of the Tumor and Immune Ecosystem of Human Breast Cancer. Cell 177, 1330-1345.e18 2019 [0450] 42 Zhang, T. et al. Immunocyte Profiling Using Single-Cell Mass Cytometry Reveals EpCAM+CD4+ T Cells Abnormal in Colon Cancer. Front. Immunol. 10 2019 [0451] 43 Ijsselsteijn, M. E., van der Breggen, R., Farina Sarasqueta, A., Koning, F. & de Miranda, N. F. C. C. A 40-Marker Panel for High Dimensional Characterization of Cancer Immune Microenvironments by Imaging Mass Cytometry. Front. Immunol. 10 2019 [0452] 44 Han, G., Spitzer, M. H., Bendall, S. C., Fantl, W. J. & Nolan, G. P. Metal-isotope-tagged monoclonal antibodies for high-dimensional mass cytometry. Nat. Protoc. 13, 2121-2148 2018 [0453] 45 International Classification of Diseases for Oncology, Third Edition (ICD-O-3) WHO 2000 [0454] 46 Lee et al., Science Immunology 5 eaba0759 2020 [0455] 47 Forner A, Reig M, Bruix J, Lancet 391:1301-1314 2018 [0456] 48 Llovet J M et al. N Engl J Med 359:378-90 2008 [0457] 49 Cheng A L, et al. Lancet Oncol 10:25-34 2009 [0458] 50 Bruix J, et al. Lancet 389:56-66 2017 [0459] 51 Kudo M, et al. Lancet 391:1163-1173 2018 [0460] 52 Abou-Alfa G K, et al. N Engl J Med 379:54-63 2018 [0461] 53 Zhu A X, et al. Lancet Oncol 20:282-296 2019 [0462] 54 Dao, Tao et al. Oncoimmunology 8(7) 1570778 2019 doi:10.1080/2162402X.2019.1570778 [0463] 55 Kabat, E. A. et al., 1991, “Sequences of Proteins of Immunological Interest”, 5th edit., NIH Publication no. 91-3242, U.S. Department of Health and Human Services [0464] 56 Chothia, C. & Lesk, A. M., 1987, “Canonical structures for the hypervariable regions of immunoglobulins”, J. Mol. Biol., 196, 901-917 [0465] 57 Lefranc, M. P., “Unique database numbering system for immunogenetic analysis”, Immunol. Today, 18, 50 1997 [0466] 58 Lefranc M. P., IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains, Dev Comp Immunol. 27(1):55-77 2003 [0467] 59 Creighton, Proteins, W. H. Freeman and Company (1984) [0468] 60 Dordo et al, J. Mol Biol, 1999, 217, 721-739 [0469] 61 Taylor et al, J. Theor. Biol. 119(1986); 205-218 [0470] 62 S. French and B. Robson, J. Mol. Evol. 19(1983)171 [0471] 63 Strohl, BioDrugs (2015) 29:215-239 [0472] 64 GuI et al., “Antibody-Dependent Phagocytosis of Tumor Cells by Macrophages: A Potent Effector Mechanism of Monoclonal Antibody Therapy of Cancer”, Cancer Res., 75(23), Dec. 1, 2015 [0473] 65 Lazar et al., 2006, Proc. Natl. Acad. Sci. U.S.A., March 14; 103(11):4005-10 [0474] 66 Dall et al., Immunol 2002; 169:5171-5180 [0475] 67 Natsume et al., 2009, Drug Des. Devel. Ther., 3:7-16 or by Zhou Q., Biotechnol. Bioeng., 2008, Feb. 15, 99(3):652-65) [0476] 68 Shields et al., 2001, J. Biol. Chem., March 2; 276(9):6591-604) [0477] 69 Idusogie et al., J. Immunol., 2001, 166:2571-2575 [0478] 70 Natsume et al., 2008, Cancer Res., 68: 3863-3872 [0479] 71 Bruix J, et al. Lancet 389:56-66 2017 [0480] 72 Kudo M, et al. Lancet 391:1163-1173 2018 [0481] 73 Abou-Alfa G K, et al. N Engl J Med 379:54-63 2018 [0482] 74 Zhu A X, et al. Lancet Oncol 20:282-296 2019 [0483] 75 Kroemer et al. Immunologic Cell Death in Cancer Therapy, Ann Rev Immunol. 31:51-72 2013 [0484] 76 Galluzzi, Zitvogel & Kroemer Canc. Imm. Res. 4:895-902 2016 [0485] 77 NCSS Statistical Software, Chapter 546, One ROC Curve and Cutoff Analysis. Documentation for NCSS 2020 Statistical Software. [0486] 78 Ito T, et al. Immunity 28(6):870-880 2008

    TABLE-US-00003 TABLE B Biomarker summary One or more of the following biomarkers is assessed within the TME, in an area of tumour core in a tissue section. Notes of preferred Example measurement Biomarker Detail method Units (e.g., in HCC) ICOS+ the density or concentration counts all ICOS+ cells, number >120 cells per mm.sup.2 density of cells that express ICOS including ICOS single of cells >100 cells per mm.sup.2 protein, i.e., ICOS positive positive and ICOS per in HCC known to be (ICOS+) cells FOXP3 double positive region or associated with hepatitis area, e.g., B virus (HBV) infection cells per OR is stage 2 or later mm.sup.2 HCC according to the criteria of the American Joint Committee on Cancer (AJCC2) ICOS+ TReg the proportion of FOXP3+ a measure of TReg fraction >0.5 proportion cells which are ICOS+, activity, indicating or % representing the proportion the level of immuno- of TReg that are ICOS suppression in the positive TME Intercellular ICOS+ FOXP3−: ICOS+ measured from nucle- distance, <105 μm proximity FOXP3+ intercellular ar centre to nuclear e.g., μm proximity, being the centre average (mean) distance between each ICOS single positive cell (ICOS+ FOXP3− cell) and its nearest ICOS FOXP3 double positive (ICOS+ FOXP3+) cell, representing the proximity of ICOS positive TReg to other ICOS positive cells (including ICOS+ TEff) Zonal ratio of the number of ICOS radius measured from fraction >0.1 influence FOXP3 double positive cells the nuclear centre of or % ratio that are within a defined the ICOS single posi- proximity (“radius of tive cell, counting influence”) of one or all ICOS+ FOXP3+ more ICOS single positive cells that are within cells to the total number the region defined by of ICOS single positive the radius cells. The radius of influence represents a distance (e.g., 30 μm) across which cell-cell and/or cytokine-dependent communication can occur between an ICOS FOXP3 double positive cell and an ICOS single positive cell, this subset of double positive cells thus representing TReg that are positioned to be able to suppress one or more TEff

    TABLE-US-00004 TABLE C Antibody constant region sequences Seq ID No: Description Sequence 15 Human IGHG1*01 Human Heavy Chain Constant gcctccaccaagggcccatcggtcttccccctggcaccctcctccaagagcacctctg IgG1 Region (IGHG1*01) ggggcacagcggccctgggctgcctggtcaaggactacttccccgaaccggtgacggt constant Nucleotide Sequence gtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacag region tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggca cccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaa agttgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaa ctcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatga tctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctga ggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccg cgggaggagcagtacaacagcacgtaccgggtggtcagcgtcctcaccgtcctgcacc aggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagc ccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtac accctgcccccatcccgggatgagctgaccaagaaccaggtcagcctgacctgcctgg tcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccgga gaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctac agcaagctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccg tgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtctccggg taaa 16 Human Heavy Chain Constant ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Region (IGHG1*01) Protein SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE Sequence (P01857) LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 17 Human IGHG1*02 Human Heavy Chain Constant gcctccaccaagggcccatcggtcttccccctggcaccctcctccaagagcacctctg IgG1 or Region (IGHG1*02 or ggggcacagcggccctgggctgcctggtcaaggactacttccccgaaccggtgacggt constant IGHG1*05 IGHG1*05) Nucleotide gtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacag region Sequence tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggca cccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaa agttgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaa ctcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatga tctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctga ggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccg cgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcacc aggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagc ccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtac accctgcccccatcccgggatgagctgaccaagaaccaggtcagcctgacctgcctgg tcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccgga gaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctac agcaagctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccg tgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtctccggg taaa 18 Human Heavy Chain Constant A S T K G P S V F P L A P S S K S T S G G T A A L G C L V K Region (IGHG1*02) Protein D Y F P E P V T V S W N S G A L T S G V H T F P A V L Q S S Sequence G L Y S L S S V V T V P S S S L G T Q T Y I C N V N H K P S N T K V D K K V E P K S C D K T H T C P P C P A P E L L G G P S V F L F P P K P K D T L M I S R T P E V T C V V V D V S H E D P E V K F N W Y V D G V E V H N A K T K P R E E Q Y N S T Y R V V S V L T V L H Q D W L N G K E Y K C K V S N K A L P A P I E K T I S K A K G Q P R E P Q V Y T L P P S R D E L T K N Q V S L T C L V K G F Y P S D I A V E W E S N G Q P E N N Y K T T P P V L D S D G S F F L Y S K L T V D K S R W Q Q G N V F S C S V M H E A L H N H Y T Q K S L S L S P G K 19 Human IGHG1*03 Human Heavy Chain Constant gcctccaccaagggcccatcggtcttccccctggcaccctcctccaagagcacctctg IgG1 Region (IGHG1*03) ggggcacagcggccctgggctgcctggtcaaggactacttccccgaaccggtgacggt constant Nucleotide Sequence gtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacag region (Y14737) tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggca cccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagag agttgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaa ctcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatga tctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctga ggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccg cgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcacc aggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagc ccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtac accctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctgg tcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccgga gaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctat agcaagctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccg tgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtccccggg taaa 20 Human Heavy Chain Constant A S T K G P S V F P L A P S S K S T S G G T A A L G C L V K Region (IGHG1*03) Protein D Y F P E P V T V S W N S G A L T S G V H T F P A V L Q S S Sequence G L Y S L S S V V T V P S S S L G T Q T Y I C N V N H K P S N T K V D K R V E P K S C D K T H T C P P C P A P E L L G G P S V F L F P P K P K D T L M I S R T P E V T C V V V D V S H E D P E V K F N W Y V D G V E V H N A K T K P R E E Q Y N S T Y R V V S V L T V L H Q D W L N G K E Y K C K V S N K A L P A P I E K T I S K A K G Q P R E P Q V Y T L P P S R E E M T K N Q V S L T C L V K G F Y P S D I A V E W E S N G Q P E N N Y K T T P P V L D S D G S F F L Y S K L T V D K S R W Q Q G N V F S C S V M H E A L H N H Y T Q K S L S L S P G K 21 Human IGHG1*04 Human Heavy Chain Constant gcctccaccaagggcccatcggtcttccccctggcaccctcctccaagagcacctctg IgG1 Region (IGHG1*04) ggggcacagcggccctgggctgcctggtcaaggactacttccccgaaccggtgacggt constant Nucleotide Sequence gtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacag region tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggca cccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaa agttgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaa ctcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatga tctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctga ggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccg cgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcacc aggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagc ccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtac accctgcccccatcccgggatgagctgaccaagaaccaggtcagcctgacctgcctgg tcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccgga gaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctac agcaagctcaccgtggacaagagcaggtggcagcaggggaacatcttctcatgctccg tgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtctccggg taaa 22 Human Heavy Chain Constant ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Region (IGHG1*04) Protein SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE Sequence LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNIFSCSVMHEALHNHYTQKSLSLSPGK 23 Disabled Disabled Disabled Human IGHG1*01 gcctccaccaagggcccatcggtcttccccctggcaccctcctccaagagcacctctg Human human Heavy Chain Constant ggggcacagcggccctgggctgcctggtcaaggactacttccccgaaccggtgacggt IgG1 IGHG1*01 Region Nucleotide Sequence gtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacag heavy tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggca chain cccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaa constant agtggagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaa region ctcgcgggggcaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatga tctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctga ggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccg cgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcacc aggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagc ccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtac accctgcccccatcccgggatgagctgaccaagaaccaggtcagcctgacctgcctgg tcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccgga gaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctac agcaagctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccg tgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtctccggg taaa 24 Disabled Human IGHG1*01 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Heavy Chain Constant SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE Region Amino Acid LAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP Sequence. Two residues REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY that differ from the wild- TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY type sequence are SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK identified in bold 25 Human IGHG2*01 Human Heavy Chain Constant gcctccaccaagggcccatcggtcttccccctggcgccctgctccaggagcacctccg IgG2 or Region (IGHG2*01 or agagcacagccgccctgggctgcctggtcaaggactacttccccgaaccggtgacggt constant IGHG2*04 IGHG2*03 or IGHG2*05) gtcgtggaactcaggcgctctgaccagcggcgtgcacaccttcccagctgtcctacag region or Nucleotide Sequence tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcaacttcggca IGHG2*05 cccagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagac agttgagcgcaaatgttgtgtcgagtgcccaccgtgcccagcaccacctgtggcagga ccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggaccc ctgaggtcacgtgcgtggtggtggacgtgagccacgaagaccccgaggtccagttcaa ctggtacgtggacggcgtggaggtgcataatgccaagacaaagccacgggaggagcag ttcaacagcacgttccgtgtggtcagcgtcctcaccgttgtgcaccaggactggctga acggcaaggagtacaagtgcaaggtctccaacaaaggcctcccagcccccatcgagaa aaccatctccaaaaccaaagggcagccccgagaaccacaggtgtacaccctgccccca tcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttct accccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaa gaccacacctcccatgctggactccgacggctccttcttcctctacagcaagctcacc gtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgagg ctctgcacaaccactacacgcagaagagcctctccctgtctccgggtaaa 26 Human Heavy Chain Constant ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Region (IGHG2*01) Protein SSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAG Sequence PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ FNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 27 Human IGHG2*02 Human Heavy Chain Constant GCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCCG IgG2 Region (IGHG2*02) AGAGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGT constant Nucleotide Sequence GTCGTGGAACTCAGGCGCTCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAG region TCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGACCTCCAGCAACTTCGGCA CCCAGACCTACACCTGCAACGTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAC AGTTGAGCGCAAATGTTGTGTCGAGTGCCCACCGTGCCCAGCACCACCTGTGGCAGGA CCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCC CTGAGGTCACGTGCGTGGTGGTGGACGTGAGCCACGAAGACCCCGAGGTCCAGTTCAA CTGGTACGTGGACGGCATGGAGGTGCATAATGCCAAGACAAAGCCACGGGAGGAGCAG TTCAACAGCACGTTCCGTGTGGTCAGCGTCCTCACCGTCGTGCACCAGGACTGGCTGA ACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCAGCCCCCATCGAGAA AACCATCTCCAAAACCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCA TCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCT ACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAA GACCACACCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACC GTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGG CTCTGCACAACCACTACACACAGAAGAGCCTCTCCCTGTCTCCGGGTAAA 28 Human Heavy Chain Constant ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Region (IGHG2*02) Protein SSGLYSLSSVVTVTSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAG Sequence PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGMEVHNAKTKPREEQ FNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 29 Human IGHG2*04 Human Heavy Chain Constant gcctccaccaagggcccatcggtcttccccctggcgccctgctccaggagcacctccg IgG2 Region (IGHG2*04) agagcacagcggccctgggctgcctggtcaaggactacttccccgaaccggtgacggt constant Nucleotide Sequence gtcgtggaactcaggcgctctgaccagcggcgtgcacaccttcccagctgtcctacag region tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggca cccagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagac agttgagcgcaaatgttgtgtcgagtgcccaccgtgcccagcaccacctgtggcagga ccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggaccc ctgaggtcacgtgcgtggtggtggacgtgagccacgaagaccccgaggtccagttcaa ctggtacgtggacggcgtggaggtgcataatgccaagacaaagccacgggaggagcag ttcaacagcacgttccgtgtggtcagcgtcctcaccgttgtgcaccaggactggctga acggcaaggagtacaagtgcaaggtctccaacaaaggcctcccagcccccatcgagaa aaccatctccaaaaccaaagggcagccccgagaaccacaggtgtacaccctgccccca tcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttct accccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaa gaccacacctcccatgctggactccgacggctccttcttcctctacagcaagctcacc gtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgagg ctctgcacaaccactacacgcagaagagcctctccctgtctccgggtaaa 30 Human Heavy Chain Constant ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Region (IGHG2*04) Protein SSGLYSLSSVVTVPSSSLGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAG Sequence PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ FNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 31 Human IGHG2*06 Human Heavy Chain Constant GCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCCG IgG2 Region (IGHG2*06) AGAGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGT constant Nucleotide Sequence GTCGTGGAACTCAGGCGCTCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAG region TCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAACTTCGGCA CCCAGACCTACACCTGCAACGTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAC AGTTGAGCGCAAATGTTGTGTCGAGTGCCCACCGTGCCCAGCACCACCTGTGGCAGGA CCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCC CTGAGGTCACGTGCGTGGTGGTGGACGTGAGCCACGAAGACCCCGAGGTCCAGTTCAA CTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCACGGGAGGAGCAG TTCAACAGCACGTTCCGTGTGGTCAGCGTCCTCACCGTCGTGCACCAGGACTGGCTGA ACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCAGCCCCCATCGAGAA AACCATCTCCAAAACCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCA TCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCT ACCCCAGCGACATCTCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAA GACCACACCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACC GTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGG CTCTGCACAACCACTACACACAGAAGAGCCTCTCCCTGTCTCCGGGTAAA 32 Human Heavy Chain Constant ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Region (IGHG2*06) Protein SSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAG Sequence PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ FNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 33 Human IGHG4*01 Human Heavy Chain Constant gcttccaccaagggcccatccgtcttccccctggcgccctgctccaggagcacctccg IgG4 or Region (IGHG4*01 or agagcacagccgccctgggctgcctggtcaaggactacttccccgaaccggtgacggt constant IGHG4*04 IGHG4*04) Nucleotide gtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacag region Sequence tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggca cgaagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagag agttgagtccaaatatggtcccccatgcccatcatgcccagcacctgagttcctgggg ggaccatcagtcttcctgttccccccaaaacccaaggacactctcatgatctcccgga cccctgaggtcacgtgcgtggtggtggacgtgagccaggaagaccccgaggtccagtt caactggtacgtggatggcgtggaggtgcataatgccaagacaaagccgcgggaggag cagttcaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggc tgaacggcaaggagtacaagtgcaaggtctccaacaaaggcctcccgtcctccatcga gaaaaccatctccaaagccaaagggcagccccgagagccacaggtgtacaccctgccc ccatcccaggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggct tctaccccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaacta caagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaggcta accgtggacaagagcaggtggcaggaggggaatgtcttctcatgctccgtgatgcatg aggctctgcacaaccactacacacagaagagcctctccctgtctctgggtaaa 34 Human Heavy Chain Constant ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Region (IGHG4*01) Protein SSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLG Sequence (P01861) GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREE QFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLP PSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRL TVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 35 Human IGHG4*02 Human Heavy Chain Constant gcttccaccaagggcccatccgtcttccccctggcgccctgctccaggagcacctccg IgG4 Region (IGHG4*02) agagcacagccgccctgggctgcctggtcaaggactacttccccgaaccggtgacggt constant Nucleotide Sequence gtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacag region tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggca cgaagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagag agttgagtccaaatatggtcccccgtgcccatcatgcccagcacctgagttcctgggg ggaccatcagtcttcctgttccccccaaaacccaaggacactctcatgatctcccgga cccctgaggtcacgtgcgtggtggtggacgtgagccaggaagaccccgaggtccagtt caactggtacgtggatggcgtggaggtgcataatgccaagacaaagccgcgggaggag cagttcaacagcacgtaccgtgtggtcagcgtcctcaccgtcgtgcaccaggactggc tgaacggcaaggagtacaagtgcaaggtctccaacaaaggcctcccgtcctccatcga gaaaaccatctccaaagccaaagggcagccccgagagccacaggtgtacaccctgccc ccatcccaggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggct tctaccccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaacta caagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaggcta accgtggacaagagcaggtggcaggaggggaatgtcttctcatgctccgtgatgcatg aggctctgcacaaccactacacgcagaagagcctctccctgtctctgggtaaa 36 Human Heavy Chain Constant ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Region (IGHG4*02) Protein SSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLG Sequence GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREE QFNSTYRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLP PSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRL TVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 37 Human IGHG4*03 Human Heavy Chain Constant gcttccaccaagggcccatccgtcttccccctggcgccctgctccaggagcacctccg IgG4 Region (IGHG4*03) agagcacagccgccctgggctgcctggtcaaggactacttccccgaaccggtgacggt constant Nucleotide Sequence gtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacag region tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggca cgaagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagag agttgagtccaaatatggtcccccatgcccatcatgcccagcacctgagttcctgggg ggaccatcagtcttcctgttccccccaaaacccaaggacactctcatgatctcccgga cccctgaggtcacgtgcgtggtggtggacgtgagccaggaagaccccgaggtccagtt caactggtacgtggatggcgtggaggtgcataatgccaagacaaagccgcgggaggag cagttcaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggc tgaacggcaaggagtacaagtgcaaggtctccaacaaaggcctcccgtcctccatcga gaaaaccatctccaaagccaaagggcagccccgagagccacaggtgtacaccctgccc ccatcccaggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggct tctaccccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaacta caagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctc accgtggacaagagcaggtggcaggaggggaacgtcttctcatgctccgtgatgcatg aggctctgcacaaccactacacgcagaagagcctctccctgtctctgggtaaa 38 Human Heavy Chain Constant ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Region (IGHG4*03) Protein SSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLG Sequence GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREE QFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLP PSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 39 Human IGHG4-PE Human Heavy Chain Constant gcctccaccaagggcccatccgtcttccccctggcgccctgctccaggagcacctccg IgG4-PE Region (IGHG4-PE) agagcacggccgccctgggctgcctggtcaaggactacttccccgaaccagtgacggt constant Nucleotide Sequence gtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacag region Version A tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggca cgaagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagag agttgagtccaaatatggtcccccatgcccaccatgcccagcgcctgaatttgagggg ggaccatcagtcttcctgttccccccaaaacccaaggacactctcatgatctcccgga cccctgaggtcacgtgcgtggtggtggacgtgagccaggaagaccccgaggtccagtt caactggtacgtggatggcgtggaggtgcataatgccaagacaaagccgcgggaggag cagttcaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggc tgaacggcaaggagtacaagtgcaaggtctccaacaaaggcctcccgtcatcgatcga gaaaaccatctccaaagccaaagggcagccccgagagccacaggtgtacaccctgccc ccatcccaggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggct tctaccccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaacta caagaccacgcctcccgtgctggactccgacggatccttcttcctctacagcaggcta accgtggacaagagcaggtggcaggaggggaatgtcttctcatgctccgtgatgcatg aggctctgcacaaccactacacacagaagagcctctccctgtctctgggtaaa 40 Human Heavy Chain Constant gcctccaccaagggacctagcgtgttccctctcgccccctgttccaggtccacaagcg Region (IGHG4-PE) agtccaccgctgccctcggctgtctggtgaaagactactttcccgagcccgtgaccgt Nucleotide Sequence ctcctggaatagcggagccctgacctccggcgtgcacacatttcccgccgtgctgcag Version B agcagcggactgtatagcctgagcagcgtggtgaccgtgcccagctccagcctcggca ccaaaacctacacctgcaacgtggaccacaagccctccaacaccaaggtggacaagcg ggtggagagcaagtacggccccccttgccctccttgtcctgcccctgagttcgaggga ggaccctccgtgttcctgtttccccccaaacccaaggacaccctgatgatctcccgga cacccgaggtgacctgtgtggtcgtggacgtcagccaggaggaccccgaggtgcagtt caactggtatgtggacggcgtggaggtgcacaatgccaaaaccaagcccagggaggag cagttcaattccacctacagggtggtgagcgtgctgaccgtcctgcatcaggattggc tgaacggcaaggagtacaagtgcaaggtgtccaacaagggactgcccagctccatcga gaagaccatcagcaaggctaagggccagccgagggagccccaggtgtataccctgcct cctagccaggaagagatgaccaagaaccaagtgtccctgacctgcctggtgaagggat tctacccctccgacatcgccgtggagtgggagagcaatggccagcccgagaacaacta caaaacaacccctcccgtgctcgatagcgacggcagcttctttctctacagccggctg acagtggacaagagcaggtggcaggagggcaacgtgttctcctgttccgtgatgcacg aggccctgcacaatcactacacccagaagagcctctccctgtccctgggcaag 41 Human Heavy Chain Constant gccagcaccaagggcccttccgtgttccccctggccccttgcagcaggagcacctccg Region (IGHG4-PE) aatccacagctgccctgggctgtctggtgaaggactactttcccgagcccgtgaccgt Nucleotide Sequence gagctggaacagcggcgctctgacatccggcgtccacacctttcctgccgtcctgcag Version C tcctccggcctctactccctgtcctccgtggtgaccgtgcctagctcctccctcggca ccaagacctacacctgtaacgtggaccacaaaccctccaacaccaaggtggacaaacg ggtcgagagcaagtacggccctccctgccctccttgtcctgcccccgagttcgaaggc ggacccagcgtgttcctgttccctcctaagcccaaggacaccctcatgatcagccgga cacccgaggtgacctgcgtggtggtggatgtgagccaggaggaccctgaggtccagtt caactggtatgtggatggcgtggaggtgcacaacgccaagacaaagccccgggaagag cagttcaactccacctacagggtggtcagcgtgctgaccgtgctgcatcaggactggc tgaacggcaaggagtacaagtgcaaggtcagcaataagggactgcccagcagcatcga gaagaccatctccaaggctaaaggccagccccgggaacctcaggtgtacaccctgcct cccagccaggaggagatgaccaagaaccaggtgagcctgacctgcctggtgaagggat tctacccttccgacatcgccgtggagtgggagtccaacggccagcccgagaacaatta taagaccacccctcccgtcctcgacagcgacggatccttctttctgtactccaggctg accgtggataagtccaggtggcaggaaggcaacgtgttcagctgctccgtgatgcacg aggccctgcacaatcactacacccagaagtccctgagcctgtccctgggaaag 42 Human Heavy Chain Constant ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Region (IGHG4-PE) Protein SSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEG Sequence GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREE QFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLP PSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRL TVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 43 In- In- Inactivated Human Heavy GCCTCCACCAAGGGCCCATCCGTCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCCG activated activated Chain Constant Region agagcacggccgccctgggctgcctggtcaaggactacttccccgaaccagtgacggt Human IGHG4 (IGHG4) Nucleotide gtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctacag IgG4 Sequence tcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggca constant cgaagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagag region agttgagtccaaatatggtcccccatgcccaccatgcccagcgcctccagttgcgggg ggaccatcagtcttcctgttccccccaaaacccaaggacactctcatgatctcccgga cccctgaggtcacgtgcgtggtggtggacgtgagccaggaagaccccgaggtccagtt caactggtacgtggatggcgtggaggtgcataatgccaagacaaagccgcgggaggag cagttcaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggc tgaacggcaaggagtacaagtgcaaggtctccaacaaaggcctcccgtcatcgatcga gaaaaccatctccaaagccaaagggcagccccgagagccacaggtgtacaccctgccc ccatcccaggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggct tctaccccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaacta caagaccacgcctcccgtgctggactccgacggatccttcttcctctacagcaggcta accgtggacaagagcaggtggcaggaggggaatgtcttctcatgctccgtgatgcatg aggctctgcacaaccactacacacagaagagcctctccctgtctctgggtaaa 44 Inactivated Human Heavy ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ Chain Constant Region SSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPPVAG (IGHG4) Protein Sequence GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREE (inactivating mutations QFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLP from human IgG4 shown in PSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRL bold) TVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 45 Human Cκ IGKC*01 Human Cκ Light Chain cgtacggtggccgctccctccgtgttcatcttcccaccttccgacgagcagctgaagt constant Constant Region (IGKC*01) ccggcaccgcttctgtcgtgtgcctgctgaacaacttctacccccgcgaggccaaggt region Nucleotide Sequence gcagtggaaggtggacaacgccctgcagtccggcaactcccaggaatccgtgaccgag caggactccaaggacagcacctactccctgtcctccaccctgaccctgtccaaggccg actacgagaagcacaaggtgtacgcctgcgaagtgacccaccagggcctgtctagccc cgtgaccaagtctttcaaccggggcgagtgt 46 Cκ Light Chain Constant RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE Region (IGKC*01) Amino QDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Acid Sequence 47 Human Cκ IGKC*02 Cκ Light Chain Constant cgaactgtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaat constant Region (IGKC*02) ctggaactgcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagt region Nucleotide Sequence acagtggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacagag caggagagcaaggacagcacctacagcctcagcagcaccctgacgctgagcaaagcag actacgagaaacacaaagtctacgccggcgaagtcacccatcagggcctgagctcgcc cgtcacaaagagcttcaacaggggagagtgt 48 Cκ Light Chain Constant RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE Region (IGKC*02) Amino QESKDSTYSLSSTLTLSKADYEKHKVYAGEVTHQGLSSPVTKSFNRGEC Acid Sequence 49 Human Cκ TGKC*03 Cκ Light Chain Constant cgaactgtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaat constant Region (IGKC*03) ctggaactgcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagt region Nucleotide Sequence acagcggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacagag caggagagcaaggacagcacctacagcctcagcagcaccctgacgctgagcaaagcag actacgagaaacacaaagtctacgcctgcgaagtcacccatcagggcctgagctcgcc cgtcacaaagagcttcaacaggggagagtgt 50 Cκ Light Chain Constant RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQRKVDNALQSGNSQESVTE Region (IGKC*03) Amino QESKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Acid Sequence 51 Human Cκ IGKC*04 Cκ Light Chain Constant cgaactgtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaat constant Region (IGKC*04) ctggaactgcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagt region Nucleotide Sequence acagtggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacagag caggacagcaaggacagcacctacagcctcagcagcaccctgacgctgagcaaagcag actacgagaaacacaaactctacgcctgcgaagtcacccatcagggcctgagctcgcc cgtcacaaagagcttcaacaggggagagtgt 52 Cκ Light Chain Constant RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE Region (IGKC*04) Amino QDSKDSTYSLSSTLTLSKADYEKHKLYACEVTHQGLSSPVTKSFNRGEC Acid Sequence 53 Human Cκ IGKC*05 Cκ Light Chain Constant cgaactgtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaat constant Region (IGKC*05) ctggaactgcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagt region Nucleotide Sequence acagtggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacagag caggacagcaaggacagcacctacagcctcagcaacaccctgacgctgagcaaagcag actacgagaaacacaaagtctacgcctgcgaagtcacccatcagggcctgagctcgcc cgtcacaaagagcttcaacaggggagagtgc 54 Ck Light Chain Constant RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTE Region (IGKC*05) Amino QDSKDSTYSLSNTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Acid Sequence 55 Human Cλ IGLC1*01 Cλ Light Chain Constant cccaaggccaaccccacggtcactctgttcccgccctcctctgaggagctccaagcca constant Region (IGLC1*01) acaaggccacactagtgtgtctgatcagtgacttctacccgggagctgtgacagtggc region Nucleotide Sequence ttggaaggcagatggcagccccgtcaaggcgggagtggagacgaccaaaccctccaaa (ENST00000390321.2) cagagcaacaacaagtacgcggccagcagctacctgagcctgacgcccgagcagtgga agtcccacagaagctacagctgccaggtcacgcatgaagggagcaccgtggagaagac agtggcccctacagaatgttca 56 Cλ Light Chain Constant PKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSK Region (IGLC1*01) Amino QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS Acid Sequence (A0A075B6K8) 57 Human Cλ IGLC1*02 Cλ Light Chain Constant ggtcagcccaaggccaaccccactgtcactctgttcccgccctcctctgaggagctcc constant Region (IGLC1*02) aagccaacaaggccacactagtgtgtctgatcagtgacttctacccgggagctgtgac region Nucleotide Sequence agtggcctggaaggcagatggcagccccgtcaaggcgggagtggagaccaccaaaccc Version A tccaaacagagcaacaacaagtacgcggccagcagctacctgagcctgacgcccgagc agtggaagtcccacagaagctacagctgccaggtcacgcatgaagggagcaccgtgga gaagacagtggcccctacagaatgttca 58 Cλ Light Chain Constant ggtcagcccaaggccaaccccactgtcactctgttcccgccctcctctgaggagctcc Region (IGLC1*02) aagccaacaaggccacactagtgtgtctgatcagtgacttctacccgggagctgtgac Nucleotide Sequence agtggcctggaaggcagatggcagccccgtcaaggcgggagtggagaccaccaaaccc Version B tccaaacagagcaacaacaagtacgcggccagcagctacctgagcctgacgcccgagc agtggaagtcccacagaagctacagctgccaggtcacgcatgaagggagcaccgtgga gaagacagtggcccctacagaatgttca 59 Cλ Light Chain Constant GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKP Region (IGLC1*02) Amino SKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS Acid Sequence 60 Human Cλ IGLC2*01 Cλ Light Chain Constant ggccagcctaaggccgctccttctgtgaccctgttccccccatcctccgaggaactgc constant Region (IGLC2*01) aggctaacaaggccaccctcgtgtgcctgatcagcgacttctaccctggcgccgtgac region Nucleotide Sequence cgtggcctggaaggctgatagctctcctgtgaaggccggcgtggaaaccaccacccct Version A tccaagcagtccaacaacaaatacgccgcctcctcctacctgtccctgacccctgagc agtggaagtcccaccggtcctacagctgccaagtgacccacgagggctccaccgtgga aaagaccgtggctcctaccgagtgctcc 61 Cλ Light Chain Constant ggccagcctaaagctgcccccagcgtcaccctgtttcctccctccagcgaggagctcc Region (IGLC2*01) aggccaacaaggccaccctcgtgtgcctgatctccgacttctatcccggcgctgtgac Nucleotide Sequence cgtggcttggaaagccgactccagccctgtcaaagccggcgtggagaccaccacaccc Version B tccaagcagtccaacaacaagtacgccgcctccagctatctctccctgacccctgagc agtggaagtcccaccggtcctactcctgtcaggtgacccacgagggctccaccgtgga aaagaccgtcgcccccaccgagtgctcc 62 Cλ Light Chain Constant GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTP Region (IGLC1*02) Amino SKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS Acid Sequence 63 Human Cλ IGLC2*02 Cλ Light Chain Constant ggtcagcccaaggctgccccctcggtcactctgttcccgccctcctctgaggagcttc constant or Region (IGLC2*02 or aagccaacaaggccacactggtgtgtctcataagtgacttctacccgggagccgtgac region IGLC2*03 IGLC2*03) Nucleotide agtggcctggaaggcagatagcagccccgtcaaggcgggagtggagaccaccacaccc Sequence tccaaacaaagcaacaacaagtacgcggccagcagctatctgagcctgacgcctgagc agtggaagtcccacagaagctacagctgccaggtcacgcatgaagggagcaccgtgga gaagacagtggcccctacagaatgttca 64 Cλ Light Chain Constant GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTP Region (IGLC2*02) Amino SKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS Acid Sequence 65 Human Cλ IGLC3*01 Cλ Light Chain Constant constant Region (IGLC3*01) acaaggccacactggtgtgtctcataagtgacttctacccgggagccgtgacagttgc region Nucleotide Sequence ctggaaggcagatagcagccccgtcaaggcgggggtggagaccaccacaccctccaaa caaagcaacaacaagtacgcggccagcagctacctgagcctgacgcctgagcagtgga agtcccacaaaagctacagctgccaggtcacgcatgaagggagcaccgtggagaagac agttgcccctacggaatgttca 66 Cλ Light Chain Constant PKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSK Region (IGLC3*01) Amino QSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS Acid Sequence 67 Human Cλ IGLC3*02 Cλ Light Chain Constant ggtcagcccaaggctgccccctcggtcactctgttcccaccctcctctgaggagcttc constant Region (IGLC3*02) aagccaacaaggccacactggtgtgtctcataagtgacttctacccggggccagtgac region Nucleotide Sequence agttgcctggaaggcagatagcagccccgtcaaggcgggggtggagaccaccacaccc tccaaacaaagcaacaacaagtacgcggccagcagctacctgagcctgacgcctgagc agtggaagtcccacaaaagctacagctgccaggtcacgcatgaagggagcaccgtgga gaagacagtggcccctacggaatgttca 68 Cλ Light Chain Constant GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGPVTVAWKADSSPVKAGVETTTP Region (IGLC1*02) Amino SKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS Acid Sequence 69 Human Cλ IGLC3*03 Cλ Light Chain Constant ggtcagcccaaggctgccccctcggtcactctgttcccaccctcctctgaggagcttc constant Region (IGLC3*03) aagccaacaaggccacactggtgtgtctcataagtgacttctacccgggagccgtgac region Nucleotide Sequence agtggcctggaaggcagatagcagccccgtcaaggegggagtggagaccaccacaccc tccaaacaaagcaacaacaagtacgcggccagcagctacctgagcctgacgcctgagc agtggaagtcccacaaaagctacagctgccaggtcacgcatgaagggagcaccgtgga gaagacagtggcccctacagaatgttca 70 Cλ Light Chain Constant GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTP Region (IGLC3*03) Amino SKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS Acid Sequence 71 Human Cλ IGLC3*04 Cλ Light Chain Constant ggtcagcccaaggctgccccctcggtcactctgttcccgccctcctctgaggagcttc constant Region (IGLC3*04) aagccaacaaggccacactggtgtgtctcataagtgacttctacccgggagccgtgac region Nucleotide Sequence agtggcctggaaggcagatagcagccccgtcaaggegggagtggagaccaccacaccc tccaaacaaagcaacaacaagtacgcggccagcagctacctgagcctgacgcctgagc agtggaagtcccacagaagctacagctgccaggtcacgcatgaagggagcaccgtgga gaagacagtggcccctacagaatgttca 72 Cλ Light Chain Constant GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTP Region (IGLC3*04) Amino SKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS Acid Sequence 73 Human Cλ IGLC6*01 Cλ Light Chain Constant ggtcagcccaaggctgccccatcggtcactctgttcccgccctcctctgaggagcttc constant Region (IGLC6*01) aagccaacaaggccacactggtgtgcctgatcagtgacttctacccgggagctgtgaa region Nucleotide Sequence agtggcctggaaggcagatggcagccccgtcaacaegggagtggagaccaccacaccc tccaaacagagcaacaacaagtacgcggccagcagctacctgagcctgacgcctgagc agtggaagtcccacagaagctacagctgccaggtcacgcatgaagggagcaccgtgga gaagacagtggcccctgcagaatgttca 74 Cλ Light Chain Constant GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVETTTP Region (IGLC6*01) Amino SKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPAECS Acid Sequence 75 Human Cλ IGLC7*01 Cλ Light Chain Constant ggtcagcccaaggctgccccatcggtcactctgttcccaccctcctctgaggagcttc constant or Region (IGLC7*01 or aagccaacaaggccacactggtgtgtctcgtaagtgacttctacccgggagccgtgac region IGLC7*02 IGLC7*02) Nucleotide agtggcctggaaggcagatggcagccccgtcaaggtgggagtggagaccaccaaaccc Sequence tccaaacaaagcaacaacaagtatgcggccagcagctacctgagcctgaegccegage agtggaagtcccacagaagctacagctgccgggtcacgcatgaagggagcaccgtgga gaagacagtggcccctgcagaatgctct 76 Cλ Light Chain Constant GQPKAAPSVTLFPPSSEELQANKATLVCLVSDFYPGAVTVAWKADGSPVKVGVETTKP Region (IGLC7*01) Amino SKQSNNKYAASSYLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPAECS Acid Sequence 77 Human Cλ IGLC7*03 Cλ Light Chain Constant GGTCAGCCCAAGGCTGCCCCCTCGGTCACTCTGTTCCCACCCTCCTCTGAGGAGCTTC constant Region (IGLC7*03) AAGCCAACAAGGCCACACTGGTGTGTCTCGTAAGTGACTTCAACCCGGGAGCCGTGAC region Nucleotide Sequence AGTGGCCTGGAAGGCAGATGGCAGCCCCGTCAAGGTGGGAGTGGAGACCACCAAACCC TCCAAACAAAGCAACAACAAGTATGCGGCCAGCAGCTACCTGAGCCTGACGCCCGAGC AGTGGAAGTCCCACAGAAGCTACAGCTGCCGGGTCACGCATGAAGGGAGCACCGTGGA GAAGACAGTGGCCCCTGCAGAATGCTCT 78 Cλ Light Chain Constant GQPKAAPSVTLFPPSSEELQANKATLVCLVSDFNPGAVTVAWKADGSPVKVGVETTKP Region (IGLC7*03) Amino SKQSNNKYAASSYLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPAECS Acid Sequence

    TABLE-US-00005 TABLE K KY1044 antibody sequences SEQ ID SEQUENCE  1 Amino acid sequence GVTFDDYG of HCDR1 of KY1044  2 Amino acid sequence INWNGGDT of HCDR2 of KY1044  3 Amino acid sequence ARDFYGSGSYYHVPFDY of HCDR3 of KY1044  4 Nucleic acid sequence GAGGTGCAGCTGGTGGAGTCTGGGGGAGGTGTGGTACGGCCTGGGGGGTCCCTGAGACTCTCCTGTGTAGCCTCTGGAGTCA of VH of KY1044 CCTTTGATGATTATGGCATGAGCTGGGTCCGCCAAGCTCCAGGGAAGGGGCTGGARTGGGTCTCTGGTATTAATTGGAATGG TGGCGACACAGATTATTCAGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTATCTACAA ATGAATAGTCTGAGAGCCGAGGACACGGCCTTGTATTACTGTGCGAGGGATTTCTATGGTTCGGGGAGTTATTATCACGTTC CTTTTGACTACTGGGGCCAGGGAATCCTGGTCACCGTCTCCTCA  5 Amino acid sequence EVQLVESGGGVVRPGGSLRLSCVASGVTFDDYGMSWVRQAPGKGLEWVSGINWNGGDTDYSDSVKGRFTISRDNAKNSLYLQ of VH of KY1044 MNSLRAEDTALYYCARDFYGSGSYYHVPFDYWGQGILVTVSS  6 Nucleic acid sequence GAGGTGCAGCTGGTGGAGTCTGGGGGAGGTGTGGTACGGCCTGGGGGGTCCCTGAGACTCTCCTGTGTAGCCTCTGGAGTCA of KY1044 heavy chain CCTTTGATGATTATGGCATGAGCTGGGTCCGCCAAGCTCCAGGGAAGGGGCTGGARTGGGTCTCTGGTATTAATTGGAATGG TGGCGACACAGATTATTCAGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTATCTACAA ATGAATAGTCTGAGAGCCGAGGACACGGCCTTGTATTACTGTGCGAGGGATTTCTATGGTTCGGGGAGTTATTATCACGTTC CTTTTGACTACTGGGGCCAGGGAATCCTGGTCACCGTCTCCTCAGCCAGCACCAAGGGCCCCTCTGTGTTCCCTCTGGCCCC TTCCAGCAAGTCCACCTCTGGCGGAACAGCCGCTCTGGGCTGCCTCGTGAAGGACTACTTCCCCGAGCCTGTGACCGTGTCC TGGAACTCTGGCGCTCTGACCAGCGGAGTGCACACCTTCCCTGCTGTGCTGCAGTCCTCCGGCCTGTACTCCCTGTCCTCCG TCGTGACCGTGCCTTCCAGCTCTCTGGGCACCCAGACCTACATCTGCAACGTGAACCACAAGCCCTCCAACACCAAGGTGGA CAAGAAGGTGGAACCCAAGTCCTGCGACAAGACCCACACCTGTCCCCCTTGTCCTGCCCCTGAACTGCTGGGCGGACCTTCC GTGTTCCTGTTCCCCCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCCGAAGTGACCTGCGTGGTGGTGGATGTGT CCCACGAGGACCCTGAAGTGAAGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAAGCCTAGAGAGGA ACAGTACAACTCCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAAGAGTACAAGTGC AAGGTGTCCAACAAGGCCCTGCCTGCCCCCATCGAAAAGACCATCTCCAAGGCCAAGGGCCAGCCCCGGGAACCCCAGGTGT ACACACTGCCCCCTAGCAGGGACGAGCTGACCAAGAACCAGGTGTCCCTGACCTGTCTCGTGAAAGGCTTCTACCCCTCCGA TATCGCCGTGGAATGGGAGTCCAACGGCCAGCCTGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACTCCGACGGCTCA TTCTTCCTGTACAGCAAGCTGACAGTGGACAAGTCCCGGTGGCAGCAGGGCAACGTGTTCTCCTGCTCCGTGATGCACGAGG CCCTGCACAACCACTACACCCAGAAGTCCCTGTCCCTGAGCCCCGGCAAGTGATGA  7 Amino acid sequence EVQLVESGGGVVRPGGSLRLSCVASGVTFDDYGMSWVRQAPGKGLEWVSGINWNGGDTDYSDSVKGRFTISRDNAKNSLYLQ of KY1044 heavy chain MNSLRAEDTALYYCARDFYGSGSYYHVPFDYWGQGILVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK  8 Amino acid sequence QSVSRSY of LCDR1 of KY1044  9 Amino acid sequence GAS of LCDR2 of KY1044 10 Amino acid sequence HQYDMSPFT of LCDR3 of KY1044 11 Nucleic acid sequence GAAATTGTGTTGACGCAGTCTCCAGGGACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGA of VL of KY1044 GTGTTAGCAGAAGCTACTTAGCCTGGTACCAGCAGAAACGTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAG GGCCACTGGCATCCCAGACAGGTTCAGTGGCGATGGGTCTGGGACAGACTTCACTCTCTCCATCAGCAGACTGGAGCCTGAA GATTTTGCAGTGTATTACTGTCACCAGTATGATATGTCACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAA 12 Amino acid sequence EIVLTQSPGTLSLSPGERATLSCRASQSVSRSYLAWYQQKRGQAPRLLIYGASSRATGIPDRFSGDGSGTDFTLSISRLEPE of VL of KY1044 DFAVYYCHQYDMSPFTFGPGTKVDIK 13 Nucleic acid sequence GAAATTGTGTTGACGCAGTCTCCAGGGACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGTCAGA of KY1044 light chain GTGTTAGCAGAAGCTACTTAGCCTGGTACCAGCAGAAACGTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCAGCAG GGCCACTGGCATCCCAGACAGGTTCAGTGGCGATGGGTCTGGGACAGACTTCACTCTCTCCATCAGCAGACTGGAGCCTGAA GATTTTGCAGTGTATTACTGTCACCAGTATGATATGTCACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAAcgta cggtggccgctccctccgtgttcatcttcccaccttccgacgagcagctgaagtccggcaccgcttctgtcgtgtgcctgct gaacaacttctacccccgcgaggccaaggtgcagtggaaggtggacaacgccctgcagtccggcaactcccaggaatccgtg accgagcaggactccaaggacagcacctactccctgtcctccaccctgaccctgtccaaggccgactacgagaagcacaagg tgtacgcctgcgaagtgacccaccagggcctgtctagccccgtgaccaagtctttcaaccggggcgagtgt 14 Amino acid sequence EIVLTQSPGTLSLSPGERATLSCRASQSVSRSYLAWYQQKRGQAPRLLIYGASSRATGIPDRFSGDGSGTDFTLSISRLEPE of KY1044 light chain DFAVYYCHQYDMSPFTFGPGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESV TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC