INFLUENZA VIRUS SURFACE PROTEIN-DERIVED RECOMBINANT HEMAGGLUTININ PROTEIN FORMING TRIMER, AND USE THEREOF
20230173055 · 2023-06-08
Assignee
- POSTECH RESEARCH AND BUSINESS DEVELOPMENT FOUNDATION (Pohang-si Gyeongsangbuk-do, KR)
- BIOAPPLICATIONS INC (Pohang-si Gyeongsangbuk-do, KR)
- INDUSTRY-ACADEMIC COOPERATION FOUNDATION GYEONGSANG NATIONAL UNIVERSITY (Jinju-si Gyeongsangnam-do, KR)
- Konkuk University Industrial Cooperation Corp (Seoul, KR)
Inventors
- In Hwan HWANG (Pohang-si Gyeongsangbuk-do, KR)
- Jun Ho LEE (Pohang-si Gyeongsangbuk-do, KR)
- Diao HAIPING (Pohang-si Gyeongsangbuk-do, KR)
- Shijian SONG (Pohang-si Gyeongsangbuk-do, KR)
- Woe Yeon KIM (Jinju-si Gyeongsangnam-do, KR)
- Min Gab KIM (Jinju-si Gyeongsangnam-do, KR)
- Gyeong Ryul RYU (Jinju-si Gyeongsangnam-do, KR)
- Gyeong Im SHIN (Jinju-si Gyeongsangnam-do, KR)
- Chang Seon SONG (Seoul, KR)
- Ji Ho LEE (Seoul, KR)
- Deok Hwan KIM (Icheon-si Gyeonggi-do, KR)
Cpc classification
C12N2760/16134
CHEMISTRY; METALLURGY
C12N2760/16122
CHEMISTRY; METALLURGY
A61K35/744
HUMAN NECESSITIES
C12N15/8258
CHEMISTRY; METALLURGY
C12R2001/46
CHEMISTRY; METALLURGY
C12N2760/16151
CHEMISTRY; METALLURGY
International classification
C12N15/82
CHEMISTRY; METALLURGY
Abstract
The present invention relates to an influenza virus surface protein-derived recombinant hemagglutinin (HA) protein forming a trimer and use thereof, and more specifically to a recombinant vector for producing an influenza virus surface protein-derived HA protein forming a trimer, a transformant transformed by the recombinant vector, a method for producing an influenza virus surface protein-derived HA protein forming a trimer using the recombinant vector, an influenza virus surface protein-derived HA protein produced by the method, and the use thereof in preventing, ameliorating or treating influenza virus-infected disease.
Claims
1. A recombinant vector for producing an influenza virus-derived recombinant hemagglutinin (HA) protein forming a trimer, comprising: (i) a gene encoding a protein lacking a transmembrane protein portion in influenza virus-derived hemagglutinin (HA); and (ii) a gene encoding a protein of a trimeric motif region of Coronin 1.
2. The recombinant vector of claim 1, wherein the influenza virus is any one selected from the group consisting of Influenza A viruses H5N6, H7N9 and H9N2.
3. The recombinant vector of claim 1, wherein the protein lacking a transmembrane protein portion in influenza virus-derived HA comprises the amino acid sequence of SEQ ID NO: 2 or the amino acid sequence of SEQ ID NO: 18.
4. The recombinant vector of claim 1, wherein the gene encoding a protein lacking a transmembrane protein portion in influenza virus-derived HA comprises the nucleotide sequence of SEQ ID NO: 1 or the nucleotide sequence of SEQ ID NO: 17.
5. The recombinant vector of claim 1, wherein the protein of a trimeric motif region of Coronin 1 comprises the amino acid sequence of SEQ ID NO: 4.
6. The recombinant vector of claim 1, wherein the gene encoding a protein of a trimeric motif region of Coronin 1 comprises the nucleotide sequence of SEQ ID NO: 3.
7. The recombinant vector of claim 1, further comprising a gene encoding a protein of the LysM domain in the recombinant vector.
8. The recombinant vector of claim 7, wherein the protein of the LysM domain comprises the amino acid sequence of SEQ ID NO: 14.
9. The recombinant vector of claim 7, wherein the gene encoding a protein of the LysM domain comprises the nucleotide sequence of SEQ ID NO: 13.
10. A transformant which is transformed by the recombinant vector according to claim 1.
11. A method for producing an influenza virus-derived recombinant hemagglutinin (HA) protein forming a trimer in a plant, comprising the steps of: (a) constructing the recombinant vector according to claim 1; (b) introducing the recombinant vector into a cell to prepare a transformant; (c) culturing the transformant; (d) infiltrating a plant with a culture product in which the transformant is cultured; and (e) pulverizing the plant to obtain an influenza virus-derived recombinant hemagglutinin (HA) protein forming a trimer.
12. An influenza virus-derived recombinant HA protein forming a trimer, which is produced by the method of claim 11.
13. A vaccine composition with increased immunogenicity, for preventing or treating influenza virus-infected disease, comprising the influenza virus-derived recombinant HA protein forming a trimer according to claim 12.
14. The vaccine composition with increased immunogenicity, for preventing or treating influenza viruses-infected diseases caused by influenza viruses having different genotypes of claim 13, wherein the influenza virus-derived recombinant HA protein forming a trimer comprises two or more different types of influenza virus-derived recombinant HA proteins.
15. The vaccine composition of claim 13, wherein the influenza virus-derived recombinant HA protein forming a trimer is coated on the surface of bacteria including peptidoglycan in the cell wall or chitosan.
16. The vaccine composition of claim 15, wherein the bacteria including peptidoglycan in the cell wall is bacteria which is generally recognized as safe (GRAS).
17. The vaccine composition of claim 13, further comprising a cholera toxin B subunit.
18. The vaccine composition of claim 13, wherein the vaccine composition is an injection form.
19. The vaccine composition with increased immunogenicity, for preventing or treating influenza viruses-infected diseases caused by influenza viruses having different genotypes of claim 14, wherein the two or more different types of influenza virus-derived recombinant HA proteins forming a trimer are coated on the surface of bacteria including peptidoglycan in the cell wall or chitosan by any one method of i) to iii) below: i) coating the surface of bacteria including peptidoglycan in the cell wall or chitosan, after mixing two or more different types of influenza virus-derived recombinant HA proteins forming a trimer; ii) coating the surface of bacteria including peptidoglycan in the cell wall or chitosan with each of two or more different types of influenza virus-derived recombinant HA proteins forming a trimer, followed by mixing; or iii) coating the surface of bacteria including peptidoglycan in the cell wall or chitosan with two or more different types of influenza virus-derived recombinant HA proteins forming a trimer by the two methods of (i) and (ii) above.
20. A method for preventing or treating influenza virus-infected disease, comprising administering the vaccine composition according to claim 13 to a subject in need thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
DETAILED DESCRIPTION
[0067] Hereinafter, the present invention will be described in detail.
[0068] As described above, the full-length protein of influenza virus-derived hemagglutinin (HA) is a membrane-bound form having a transmembrane domain, and there is a limitation in that it is difficult to produce at a high level in cells. Accordingly, in order to increase the production level, if only the ectodomain is expressed except for the transmembrane domain of HA and made into a soluble form in cells, there is an advantage that it can be produced with high efficiency. However, when only the ectodomain of HA is prepared in a soluble form, there is a limitation in that the trimeric form of the original full-length HA is not well made when it is present on the surface of the influenza virus. Accordingly, the inventors of the present invention tried to develop a technique for inducing the formation of a trimer when expressing and producing a recombinant protein of the ectodomain of HA in plants for the purpose of use as a vaccine with increased immunogenicity. In addition, in order for the protein thus produced to have the ability to bind to peptidoglycan, it was attempted to develop a recombinant HA ectodomain protein capable of delivering antigens in various ways by binding with genes capable of binding to surfaces such as Lactococcus or chitosan particles. Accordingly, by designing HA expressing only the ectodomain excluding the transmembrane domain of influenza virus-derived HA that can be mass-produced, a trimeric motif of Coronin A in mice forming a trimeric structure and a Lactococcus lactis LysM peptidoglycan-binding domain-including protein that binds to the surface of Lactococcus or chitosan particles to effectively deliver an antigen, and expressing them in one vector, an influenza virus-derived recombinant HA protein forming a trimer and a binary vector capable of expressing the protein in a large amount in plants were constructed.
[0069] Accordingly, a first aspect of the present invention relates to a recombinant vector for producing an influenza virus-derived recombinant hemagglutinin (HA) protein forming a trimer, including (i) a gene encoding a protein lacking a transmembrane protein portion in influenza virus-derived hemagglutinin (HA); and (ii) a gene encoding a protein of a trimeric motif region of Coronin 1.
[0070] In the recombinant vector of the present invention, the influenza virus may include, without limitation, various types of influenza viruses that infect humans, dogs, pigs, horses, poultry, wild birds, seals and the like, and may include conventionally known influenza virus types A, B and C, Isavirus or Thogotovirus.
[0071] Influenza virus type A is the cause of seasonal flu and pandemic flu epidemics. Wild aquatic algae are natural hosts for a wide variety of influenza A. Occasionally, the virus can spread to other species, causing devastating outbreaks in poultry or human influenza pandemics. Type A virus is the most lethal human pathogen of the three influenza types and causes the most serious disease. Influenza A viruses can be subdivided into different serotypes based on antibody responses to these viruses. The serotypes identified in humans (in order of the number of known human pandemic deaths) are as follows: H1N1 (cause of the 1918 Spanish influenza), H2N2 (the cause of the 1957 Asian influenza), H3N2 (the cause of the 1968 Hong Kong flu), H5N1 (pandemic threat during the 2007-2008 influenza season), H7N7 (potential pandemic threat), H1N2 (endemic disease in humans and pigs), H9N2, H7N2, H7N3 and H10N7.
[0072] Influenza virus type B is the cause of seasonal flu and has one type of influenza B virus. Influenza B infects humans almost exclusively and is less common than influenza A. The only other animal known to be susceptible to infection with influenza virus type B is the seal. Because this type of influenza mutates at a rate that is two to three times slower than type A, it is less genetically diverse and has only one influenza B serotype. As a result of this lack of antigenic diversity, some degree of immunity to influenza B is usually acquired at an early age, but influenza B is mutated sufficiently to prevent sustained immunity.
[0073] Influenza virus type C infects humans and pigs and can cause serious illness and local infectious diseases, but is less common than other types and appears to usually cause mild illness in children.
[0074] In the present invention, the influenza A virus, for example, may be any one selected from the group consisting of H5N6, H7N9 and H9N2, but is not limited thereto.
[0075] In a specific exemplary embodiment of the present invention, a recombinant HA protein forming a trimer was prepared using HA proteins derived from influenza A viruses H5N6 and H9N2. Specifically, in order to increase the productivity of HA, except for the transmembrane domain in the HA of H5N6 or H9N2, the amino acid sequence encoding only the ectodomain, that is, the amino acid sequence including the amino acid residues at positions 17 to 531 of the HA of H5N6 (GenBank: AJD09950.1) and the amino acid sequence including the amino acid residues at positions 19 to 524 of the HA of H9N2 (GenBank: AFM47147.1) were selectively used, respectively. For the recombinant vector according to the present invention, in order to prepare a recombinant HA protein forming a trimer, various amino acid sequences of the region consisting of the amino acid residues at positions 17 to 531 of the HA of H5N6 (GenBank: AJD09950.1) can be selectively used, and in the same way, various amino acid sequences of the region consisting of the amino acid residues at positions 19 to 524 of the HA of H9N2 (GenBank: AFM47147.1) can be selectively used.
[0076] In the recombinant vector of the present invention, the protein lacking a transmembrane protein portion in the influenza virus-derived hemagglutinin (HA) may include the amino acid sequence of SEQ ID NO: 2 or the amino acid sequence of SEQ ID NO: 18, but is not limited thereto.
[0077] The gene encoding the protein lacking a transmembrane protein portion in the influenza virus-derived HA may include the nucleotide sequence of SEQ ID NO: 1 or the nucleotide sequence of SEQ ID NO: 17, and specifically, the gene may include a nucleotide sequence having at least 70%, more preferably, at least 80%, even more preferably, at least 90%, and most preferably, at least 95% sequence homology to the nucleotide sequence of SEQ ID NO: 1 or the nucleotide sequence of SEQ ID NO: 17, respectively.
[0078] The “% of sequence homology” for a polynucleotide is determined by comparing two optimally aligned sequences with a comparison region, and a portion of the polynucleotide sequence in the comparison region may include additions or deletions (i.e., gaps) compared to a reference sequence (not including additions or deletions) to the optimal alignment of the two sequences.
[0079] In the recombinant vector of the present invention, Coronin 1 above may be mouse-derived Coronin 1 (mCor 1) (GenBank: EDL17419.1), and the protein of its trimeric motif region may include the amino acid sequence of SEQ ID NO: 4. In the recombinant vector of the present invention, Coronin 1 (mCor 1) is linked to the C-terminus of the ectodomain of influenza virus-derived HA such that a trimer may be formed even when only the ectodomain of HA is expressed.
[0080] The gene encoding the protein of the trimeric motif region of Coronin 1 (mCor 1) may include the nucleotide sequence of SEQ ID NO: 3, and specifically, the gene may include a nucleotide sequence having at least 70%, more preferably, at least 80%, even more preferably, at least 90%, and most preferably, at least 95% sequence homology to the nucleotide sequence of SEQ ID NO: 3.
[0081] The recombinant vector of the present invention may further include a gene encoding a protein of the LysM domain.
[0082] In the recombinant vector of the present invention, the protein of the LysM domain may include the amino acid sequence of SEQ ID NO: 14, and the gene encoding the protein of the LysM domain may include the nucleotide sequence of SEQ ID NO: 13, and specifically, the gene may include a nucleotide sequence having at least 70%, more preferably, at least 80%, even more preferably, at least 90%, and most preferably, at least 95% sequence homology to the nucleotide sequence of SEQ ID NO: 13, respectively.
[0083] In the influenza virus-derived HA according to the present invention, for the effective delivery of antigens and promoting various immune effects on the recombinant HA protein including the protein lacking a transmembrane protein portion and the protein of the trimeric motif region of Coronin 1 (mCor 1), the 220.sup.th to 320.sup.th amino acid residues of the LysM domain (GenBank: WP_011834353), which is a cell wall-binding domain of the LysM peptidoglycan-binding domain-including protein of Lactococcus lactis capable of binding to bacteria such as Lactococcus or chitosan particles, were fused to the C-terminus of the trimeric motif of Coronin 1 (mCor1) using a linker having 6 amino acid residues. Subsequently, a His tag having 6 His residues was fused for isolation and purification of the recombinant protein, and an HDEL motif was fused for ER accumulation to complete the construct tHA (
[0084] The recombinant genes of HA thus constructed were introduced into a plant expression vector, pTEX1, to prepare a plant expression vector (pTEX-tHA and pTEX-mHA, respectively). Afterwards, the constructed expression vectors were introduced into Agrobacterium, and then infiltrated into plants to induce transient expression. The expressed recombinant HA protein may be separated by a Ni.sup.2+-NTA affinity column using a His tag or by binding to Lactococcus using the LysM domain.
[0085] In order to confirm the protein expression in the leaf extract of Nicotiana benthamiana into which these genes were introduced, Western blot analysis was performed by using an anti-His antibody. As shown in
[0086] Next, in order to confirm the formation of a trimer of the protein, mHA in a monomeric form and tHA in a trimeric form were mixed and gel filtration was performed. As a result, as confirmed in
[0087] In a specific exemplary embodiment of the present invention, in order to confirm the binding of LysM of the recombinant protein to Lactococcus, by using GFP as a control protein, a His-tagged GFP-mCor1-LysM construct and a His-tagged GFP-LysM construct were prepared, and these were introduced into pRSET-A, which is an expression vector of E. coli, to construct expression vectors capable of expression in E. coli. The proteins GFP-mCor1-LysM and GFP-LysM were expressed in E. coli, isolated and purified, and the degree of binding to Lactococcus was observed under a fluorescence microscope. As a result, as shown in
[0088] In another specific exemplary embodiment of the present invention, in the Lactococcus surface binding of HA by LysM, the trimerization effect by mCor1 was determined. To this end, a total extract was obtained by grinding the leaf tissue of Nicotiana benthamiana expressing mHA (mH5N6) in the monomeric form and tHA (tH5N6) in the trimeric form, and it was mixed with Lactococcus treated with TCA to induce binding, and after Lactococcus was pelleted and recovered therefrom, it developed by SDS/PAGE and stained with Coomassie Brilliant Blue. As a result, as confirmed in
[0089] The recombinant vector of the present invention may further include any one promoter selected from the group consisting of a 35S promoter derived from cauliflower mosaic virus, a 19S RNA promoter derived from cauliflower mosaic virus, a Mac promoter, an actin protein promoter and ubiquitin protein promoter of a plant, and preferably, it may include a Mac promoter, and more preferably, a MacT promoter, but is not limited thereto.
[0090] The MacT promoter may be a promoter in which A, which is the 3′ terminal base of the Mac promoter nucleotide sequence, is substituted with T, and the MacT promoter may include the nucleotide sequence of SEQ ID NO: 15, and specifically, the gene may include a nucleotide sequence having at least 70%, more preferably, at least 80%, even more preferably, at least 90%, and most preferably, at least 95% sequence homology to the nucleotide sequence of SEQ ID NO: 15.
[0091] The recombinant vector of the present invention may further include an RD29B-t termination site, and the RD29B-t termination site gene may include the nucleotide sequence of SEQ ID NO: 16, and specifically, the gene may include a nucleotide sequence having at least 70%, more preferably, at least 80%, even more preferably, at least 90%, and most preferably, at least 95% sequence homology to the nucleotide sequence of SEQ ID NO: 16.
[0092] In the recombinant vector of the present invention, by inserting the signal sequence of BiP (chaperone binding protein) and HDEL, which is an ER retention signal at the N-terminus and C-terminus of the gene encoding the recombinant protein, respectively, it is possible to have the effect of inducing accumulation in the endoplasmic reticulum (ER) at high concentrations. Accordingly, the recombinant vector of the present invention may further include a gene encoding a BiP and/or a gene encoding a HDEL (His-Asp-Glu-Lu) peptide, wherein the BiP-encoding gene may include a nucleotide sequence of SEQ ID NO: 9, and HDEL (His-Asp-Glu-Lu) may include the nucleotide sequence of SEQ ID NO: 10.
[0093] As used herein, the term “recombinant” refers to a cell in which the cell replicates a heterologous nucleic acid, expresses the nucleic acid, or expresses a peptide, a heterologous peptide, or a protein encoded by the heterologous nucleic acid. Recombinant cells can express genes or gene segments that are not found in the native form of the cells in either the sense or antisense form. Recombinant cells can also express genes found in cells in a natural state, but the genes are modified and re-introduced into cells by artificial means.
[0094] The term “recombinant expression vector” means a bacterial plasmid, phage, yeast plasmid, plant cell virus, mammalian cell virus or other vector. In general, any plasmid and vector may be used as long as it can be replicated and stabilized in the host. An important characteristic of the expression vector is that it has an origin of replication, a promoter, a marker gene and a translation control element. The recombinant expression vector and the expression vector including appropriate transcriptional/translational control signals may be constructed by methods well known to those skilled in the art. The methods include in vitro recombinant DNA technology, DNA synthesis technology and in vivo recombination technology.
[0095] A preferred example of the recombinant vector of the present invention is a Ti-plasmid vector capable of transferring a part of itself, the so-called T-region, into a plant cell when present in a suitable host. Another type of Ti-plasmid vector is currently being used to transfer hybrid DNA sequences into plant cells, or protoplasts from which new plants can be produced that properly insert the hybrid DNA into the genome of the plant. A particularly preferred form of the Ti-plasmid vector is the so-called binary vector as claimed in European Patent No. EP 0120 516 B1 and U.S. Pat. No. 4,940,838. Other suitable vectors that can be used to introduce into a plant host a construct encoding the influenza virus-derived recombinant HA protein forming a trimer designed in the present invention may be selected from viral vectors such as those derived from double-stranded plant viruses (e.g., CaMV) and single-stranded virus, geminiviruses and the like, and for example, incomplete plant viral vectors. The use of such vectors can be advantageous, especially when it is difficult to adequately transform a plant host.
[0096] A second aspect of the present invention relates to a transformant which is transformed with the aforementioned recombinant vector.
[0097] The transformant of the present invention may be a prokaryote or a eukaryote, and for example, yeast (Saccharomyce cerevisiae), E. coli, fungi, insect cells, human cells (e.g., CHO (Chinese hamster ovary) cell line, W138, BHK, COS-7, 293, HepG2, 3T3, RIN and MDCK cell lines) and plant cells may be used, and preferably, it may be Agrobacterium. In the case of insect cells and human cells, the gene encoding a recombinant HA protein forming a trimer may be expressed using an expression vector required for the expression of each type of cells.
[0098] The method of delivering the recombinant vector of the present invention into a host cell may be carried out by the CaCl.sub.2 method, Hanahan method, electroporation method and the like, when the host cell is a prokaryotic cell. In addition, when the host cell is a eukaryotic cell, the vector may be injected into the host cell by microinjection, calcium phosphate precipitation, electroporation, liposome-mediated transfection, DEAE-dextran treatment, gene bombardment and the like.
[0099] A third aspect of the present invention relates to a method for producing an influenza virus-derived recombinant HA protein forming a trimer in a plant, including the steps of:
[0100] (a) constructing the aforementioned recombinant vector;
[0101] (b) introducing the recombinant vector into a cell to prepare a transformant;
[0102] (c) culturing the transformant;
[0103] (d) infiltrating a plant with a culture product in which the transformant is cultured; and
[0104] (e) pulverizing the plant to obtain an influenza virus-derived recombinant hemagglutinin (HA) protein forming a trimer.
[0105] In the method for producing an influenza virus-derived recombinant HA protein forming a trimer according to the present invention, (a) and (b) are the same as described above, and thus, the description thereof will be omitted.
[0106] In the method for producing an influenza virus-derived recombinant HA protein derived forming a trimer according to the present invention, in step (c), any method known in the art may be appropriately selected and used to produce an influenza virus-derived recombinant HA protein forming a trimer according to the present invention.
[0107] In the method for producing an influenza virus-derived recombinant HA protein forming a trimer according to the present invention, step (d) may be carried out, for example, by infiltrating the culture product in which the transformant was cultured into the plant using a chemical cell method, vacuum or syringe infiltration method, and preferably, it may be infiltrated by a syringe infiltration method, but is not limited thereto.
[0108] In the method for producing an influenza virus-derived recombinant HA protein forming a trimer according to the present invention, the plant of step (d) may be selected from food crops including rice, wheat, barley, corn, soybean, potato, wheat, red bean, oat and sorghum; vegetable crops including Arabidopsis thaliana, Chinese cabbage, radish, red pepper, strawberry, tomato, watermelon, cucumber, cabbage, Korean melon, pumpkin, green onion, onion and carrot; special crops including ginseng, tobacco, cotton, sesame, sugar cane, sugar beet, perilla, peanut and rapeseed; fruit trees including apple tree, pear tree, date tree, peach, grape, tangerine, persimmon, plum, apricot and banana; and flowers including rose, carnation, chrysanthemum, lily and tulip.
[0109] A fourth aspect of the present invention relates to an influenza virus-derived recombinant HA protein forming a trimer produced by the above-described production method and a vaccine composition with increased immunogenicity, for preventing, ameliorating or treating influenza virus-infected disease including the same.
[0110] In the vaccine composition of the present invention, the influenza virus-derived recombinant HA protein forming the trimer may be coated on the surface of bacteria including peptidoglycan in the cell wall or chitosan. The bacteria including peptidoglycan in the cell wall may be bacteria that are generally recognized as safe (GRAS), and for example, there are Lactococcus, Lactobacillus, Streptococcus and the like, but the present invention is not limited thereto.
[0111] In a specific exemplary embodiment of the present invention, one or two or more different recombinant HA proteins were coated on the surface of Lactococcus lactis in various ways to effectively deliver antigens.
[0112] To this end, the recombinant HA protein derived from two or more different types of influenza virus, which forms the trimer of the present invention, may be coated on the surface of bacteria including peptidoglycan in the cell wall or chitosan by any one method of (i) to (iii) below:
[0113] i) coating the surface of bacteria including peptidoglycan in the cell wall or chitosan, after mixing two or more different types of influenza virus-derived recombinant HA proteins forming a trimer;
[0114] ii) coating the surface of bacteria including peptidoglycan in the cell wall or chitosan with each of two or more different types of influenza virus-derived recombinant HA proteins forming a trimer, followed by mixing; or
[0115] iii) coating the surface of bacteria including peptidoglycan in the cell wall or chitosan with two or more different types of influenza virus-derived recombinant.
[0116] For example, the vaccine composition of the present invention may be prepared as a single vaccine composition by separately coating Lactococcus with two or more different types of influenza virus-derived recombinant HA proteins that form a trimer, and then mixing Lactococcus separately coated with each different HA recombination protein at the same ratio (e.g., when mixing Lactococcus coated with two different types of HA recombinant proteins, it may be mixed at 1:1), or mixing at any suitable ratio. Alternatively, a single vaccine composition may be prepared by mixing two or more different types of influenza virus-derived recombinant HA proteins at the same ratio or at any suitable ratio, and then coating the surface of Lactococcus. Through this, a vaccine composition for delivering multiple antigens may be prepared by additionally mixing Lactococcus dead cells coated with two or more different types of influenza virus-derived recombinant HA proteins to other Lactococcus dead cells coated with two or more different types of influenza virus-derived recombinant HA proteins.
[0117] Therefore, the recombinant HA protein derived from two or more different types influenza viruses included in the vaccine composition according to the present invention may be derived from one or two or more selected from the group consisting of conventionally known conventional influenza virus type A, type B, type C, Isavirus and Thogotovirus. For example, the influenza A virus may be any one or two or more selected from the group consisting of H5N6, H7N9 and H9N2, but is not limited thereto.
[0118] The vaccine composition of the present invention may further include a cholera toxin B subunit. Through this, it is possible to more effectively induce an immune response by increasing the immunogenicity of the recombinant HA protein of the present invention.
[0119] The vaccine composition of the present invention may be an injection form, but is not limited thereto.
[0120] In the vaccine composition of the present invention, influenza virus-infected disease includes acute respiratory disease caused by influenza virus type A, type B or type C infection or clinical symptoms and complications thereof. Clinical symptoms due to acute respiratory disease caused by influenza virus infection include, for example, respiratory symptoms such as high fever (about 38 to 40° C.), dry cough and sore throat, and systemic symptoms such as headache, muscle pain, fatigue, weakness and loss of appetite. The most common complications are secondary respiratory diseases, such as upper respiratory tract infections such as sinusitis and otitis media, as well as neurological complications such as encephalitis, myelitis, Guillain-Barré syndrome, transverse myelitis, myocarditis, myositis, pneumothorax and the like.
[0121] As used here, the terms “prevention”, “amelioration” and/or “treatment” refer to all actions that inhibit or delays the onset of a disease or condition, all actions that ameliorate or beneficially change the disease or condition state, and all actions that delay, stop or reverse the progression of the disease or condition.
[0122] The vaccine composition of the present invention may be composed of an antigen, a pharmaceutically acceptable carrier, an appropriate adjuvant and other conventional substances, and is administered in an immunologically effective amount. As used herein, the term “immunologically effective amount” refers to an amount sufficient to induce an immune response, but not to cause side effects or serious or excessive immune response, and the exact dosage concentration depends on the particular immunogen and may be determined by one of ordinary skill in the art using known methods to test the development of an immune response. In addition, it may change depending on the dosage form and route, the age, health and weight of the recipient, the nature and severity of symptoms, the type of current treatment and the number of treatments.
[0123] Carriers are known in the art and may include stabilizers, diluents and buffers. Suitable stabilizers include carbohydrates such as sorbitol, lactose, mannitol, starch, sugar, dextran and glucose; proteins such as albumin or casein. Suitable diluents include salts, Hanks balanced salts, Ringer's solution and the like. Suitable buffers include alkali metal phosphates, alkali metal carbonates, alkaline earth metal carbonates and the like. In addition, the vaccine composition of the present invention may further include one or more selected from the group consisting of a solvent, an adjuvant and an excipient. The solvent includes physiological saline or distilled water, the immune enhancer includes Freund's incomplete or complete adjuvant, aluminum hydroxide gel and vegetable and mineral oils, and the excipient includes aluminum phosphate, aluminum hydroxide or aluminum potassium sulfate, but is not limited thereto, and it may further include a substance used in the preparation of vaccines well known to those skilled in the art.
[0124] The vaccine composition of the present invention is administered through a known route of administration. Such methods may include, but are not limited to, oral, transdermal, intramuscular, peritoneal, intravenous, subcutaneous and nasal routes, and it may be administered by any device capable of transporting the active substance to a target cell.
[0125] The vaccine composition of the present invention is capable of inducing a humoral or optionally cell-mediated immune response and/or a combination of the two immune responses.
[0126] A fifth aspect of the present invention relates to a method for preventing, ameliorating or treating influenza virus-infected disease, including administering the various types of the above-described vaccine composition to a subject in need thereof.
[0127] In the method for preventing, ameliorating or treating influenza virus-infected disease according to the present invention, the term “subject” refers to any animal, including humans, already infected with or capable of being infected with influenza virus. Examples include, but are not limited to, humans, dogs, cats, pigs, horses, chickens, ducks, geese, turkeys, seals and the like. By administering the vaccine composition of the present invention to a subject in need thereof, it is possible to effectively prevent or treat acute respiratory disease caused by influenza virus type A, type B or type C infection or clinical symptoms and complications thereof. For example, the vaccine composition of the present invention may treat humans infected with influenza viruses of various influenza virus subtypes or variants. In addition, the composition of the present invention may treat chickens or pigs infected with avian influenza of various influenza virus subtypes or variants. The composition of the present invention may be administered in combination with a conventional therapeutic agent for influenza virus infection and/or cholera toxin B subunit.
[0128] The term “administered in combination” means that the vaccine composition of the present invention is administered to a subject in need thereof together with an existing therapeutic agent for influenza virus-infected disease and/or cholera toxin B subunit. Administering each component together means that each component may be administered simultaneously, separately or sequentially to obtain a desired effect.
[0129] In the method for preventing, ameliorating or treating influenza virus-infected disease according to the present invention, the vaccine composition may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, bucally, vaginally or an implanted reservoir. As used herein, the term “parenteral” includes, but is not limited to, subcutaneous, intravenous, intramuscular, intraarticular, intrasynovial, intrasternal, intrathecal, intrahepatic, intralesional and intracranial injections. In particular, the composition may be administered orally, intraperitoneally or intravenously.
[0130] In the method for preventing, ameliorating or treating influenza virus-infected disease according to the present invention, the administration of the vaccine composition is preferably performed twice or more. For example, after the initial vaccination, booster injections may be performed about 1 to 4 times at intervals of 1 to 10 weeks, but it may be carried out by those skilled in the art by appropriately modifying the same according to the type of animal.
[0131] A sixth aspect of the present invention relates to the use of an influenza virus-derived recombinant HA protein forming a trimer according to the present invention in the preparation of a medicament for preventing, ameliorating or treating influenza virus-infected disease.
[0132] Hereinafter, preferred examples are presented to help the understanding of the present invention. However, the following examples are only provided for easier understanding of the present invention, and the contents of the present invention are not limited by the following examples.
Example 11
[0133] Design of Hemagglutinin (HA) Recombinant Genes Derived from Influenza Virus Surface Proteins Forming Trimer
[0134] In order to induce the expression of the HA of H5N6 or H9N2 in a soluble form in the ER lumen, amino acid positions 17 to 531 of the HA of H5N6 (GenBank: AJD09950.1) and amino acid positions 19 to 524 of the HA of H9N2 (GenBank: AFM47147.1) without any transmembrane domain and ER targeting leader sequence were secured. The ER targeting signal obtained from BiP, which is an Arabidopsis protein, was fused to the 5′-terminus of the HA to enable ER targeting. In addition, the first repeat sequence of the three repeat sequences of LysM, which is a Lactococcus binding domain, from AcmA of Lactococcus lactis was fused to the C-terminus of HA using a linker. Then, mHA was constructed by sequentially fusing an His×6 tag and HDEL, which is an ER retention motif, to the C-terminus of LysM for HA purification and high accumulation in ER (
TABLE-US-00001 TABLE 1 SEQ Name Sequence (5′.fwdarw.3′) ID NO: HA of H5N6 gatcagatttgtattggatatcatgcgaacaactctacagagcaggttgatacaataatggaaaaga 1 Nucleotide atgtgaccgttacacatgctcaagacatattggagaagacgcacaacgggaggctttgtgatctca sequence atggagttaaaccacttatacttaaggactgcagtgttgccggttggcttctgggaaacccaatgtgc gatgagtttattcgtgttcccgaatggagctacatcgtcgagagagctaacccagcaaatgatctgt gttatccagggaatctcaacgattacgaggaacttaagcatctactttcgagaatcaaccatttcgaa aagacacttattattcctaagtctagttggcctaatcacgaaacctcccttggtgtaagtgcagcatgc ccttatcaaggtatgccgtcttttttccgaaacgtggtttggttgactaagaagaatgatgcttacccta ctatcaagatgagctataataacaccaacagggaggaccttcttattttgtggggtattcaccattcta acaatgccgctgaacagactaatttgtacaagaaccctactacttatgtttcagtaggcacgtcaactt tgaatcagagattggtcccaaaaatcgctacccgtagtcaagttaatggtcagagagggaggatgg acttcttttggactattcttaagccaaatgatgctatacattttgagagcaatggaaactttatcgctccc gagtacgcctataagatagtaaagaagggcgattccactatcatgaagtctgaaatggaatatggtc attgcaatacgaagtgtcaaaccccgattggtgcaattaactcatctatgcctttccacaacattcacc cactaactatcggagagtgtcctaaatacgtcaaatcaaataaattggtgcttgctacaggtctgcgc aactcccctttaagggagcgaagaagaaagaggggtttgtttggagctattgcaggcttcattgag ggtggatggcaaggtatggtggatggctggtacggatatcatcattcgaatgaacaggggtctggt tatgcagcggatcgggagagtacacaaaaggccatagatggagttaccaacaaggtaaactctatt attgataaaatgaacacacagtttgaggctgtggggagggagttcaacaaccttgaaaggcgtatc gaaaacctcaacaaaaagatggaagacggctttctggacgtttggacttacaacgcagaattgctc gttcttatggaaaacgaacgtactttggatttccatgattctaacgtcaagaatctctacgataaagtg aggctgcaacttagggacaatgcaaaagaactaggtaacggttgctttgaattttatcacaagtgtg ataatgagtgtatggagagtgtaagaaacgggacttatgactaccctcagtatagtgaggaagcta gactcaagcgcgaggagatttccggagttaagcttgaatcaattggaacataccagatt HA of H5N6 dqicigyhannsteqvdtimeknvtvthaqdilekthngrlcdlngvkplilkdcsvagwllgn 2 Amino acid pmcdefirvpewsyiveranpandlcypgnlndyeelkhllsrinhfektliipksswpnhetsl sequence gvsaacpyqgmpsffrnvvwltkkndayptikmsynntnredllilwgihhsnnaaeqtnly knpttyvsvgtstlnqrlvpkiatrsqvngqrgrmdffwtilkpndaihfesngnfiapeyayki vkkgdstimksemeyghcntkcqtpigainssmpfhnihpltigecpkyvksnklvlatglrn splrerrrkrglfgaiagfieggwqgmvdgwygyhhsneqgsgyaadrestqkaidgvtnkv nsiidkmntqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldftidsnvk nlydkvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeisgvkles igtyqi mCor1 gtgtctaggcttgaggaagatgttagaaatctcaacgcaattgtccagaaacttcaggaaaggttgg 3 Nucleotide ataggctggaggaaactgttcaagctaag sequence mCor1 vsrleedvrnlnaivqklqerldrleetvqak 4 Amino acid sequence Linker 1 gaggcagccgc taaggaagct gcagcgaaa 5 Nucleotide sequence Linker 1 sggsgg 6 Amino acid sequence Linker 2 tcaggaggatcaggagga 7 Nucleotide sequence Linker 2 sggsgg 8 Amino acid sequence BiP atggctcgct cgtttggagc taacagtacc gttgtgttgg cgatcatctt cttcggtgag 9 Nucleotide tgattttccg atcttcttct ccgatttaga tctcctctac attgttgctt aatctcagaa ccttttttcg sequence ttgttcctgg atctgaatgt gtttgtttgc aatttcacga tcttaaaagg ttagatctcg attggtattg acgattggaa tctttacgat ttcaggatgt ttatttgcgt tgtcctctgc aatagaagag gctacgaagt ta HDEL cacgatgagctc 10 Nucleotide sequence HDEL His-Asp-Glu-Leu 11 Amino acid sequence M17 ggcgtgtgtgtgtgttaaaga 12 Nucleotide sequence LysM ggtaatactaactctgggggttcaacgaccaccattacaaacaacaacagtggaacaaattcatctt 13 Nucleotide caaccacctacaccgtgaagagtggcgatacgttgtggggaatcagtcaacgttatggtattagcg sequence ttgctcagatccagtctgcaaataaccttaagtctactataatttatattgggcaaaagctagttctgac tggctcggctagtagcaccaattccggaggtagcaataactcagcttctactacccctacaacctct gtaactccagctaagcctacatcacagactaca LysM gntnsggstttitnnnsgtnsssttytvksgdtlwgisqrygisvaqiqsannlkstiiyigqklvlt 14 Amino acid gsasstnsggsnnsasttpttsvtpakptsqtt sequence MacT agagatctcctttgccccagagatcacaatggacgacttcctctatctctacgatctagtcaggaagt 15 Nucleotide tcgacggagaaggtgacgataccatgttcaccactgataatgagaagattagccttttcaatttcaga sequence aagaatgctaacccacagatggttagagaggcttacgcagcaggtctcatcaagacgatctaccc gagcaataatctccaggagatcaaataccttcccaagaaggttaaagatgcagtcaaaagattcag gactaactgcatcaagaacacagagaaagatatatttctcaagatcagaagtactattccagtatgg acgattcaaggcttgcttcacaaaccaaggcaagtaatagagattggagtctctaaaaaggtagttc ccactgaatcaaaggccatggagtcaaagattcaaatagaggacctaacagaactcgccgtaaag actggcgaacagttcatacagagtctcttacgactcaatgacaagaagaaaatcttcgtcaacatgg tggagcacgacacgcttgtctactccaaaaatatcaaagatacagtctcagaagaccaaagggca attgagacttttcaacaaagggtaatatccggaaacctcctcggattccattgcccagctatctgtca ctttattgtgaagatagtggaaaaggaaggtggctcctacaaatgccatcattgcgataaaggaaag gccatcgttgaagatgcctctgccgacagtggtcccaaagatggacccccacccacgaggagca tcgtggaaaaagaagacgttccaaccacgtcttcaaagcaagtggattgatgtgacgcaagacgt gacgtaagtatctgagctagtttttatttttctactaatttggtcgtttatttcggcgtgtaggacatggca accgggcctgaatttcgcgggtattctgtttctattccaactttttcttgatccgcagccattaacgactt ttgaatagatacgctgacacgccaagcctcgctagtcaaaagtgtaccaaacaacgctttacagca agaacggaatgcgcgtgacgctcgcggtgacgccatttcgccttttcagaaatggataaatagcctt gcttcctattatatcttcccaaattaccaatacattacactagcatctgaatttcataaccaatctcgata caccaaatcgt RD29B aattttactcaaaatgttttggttgctatggtagggactatggggttttcggattccggtggaagtgagt 16 terminator ggggaggcagtggcggaggtaagggagttcaagattctggaactgaagatttggggttttgctttt Nucleotide gaatgtttgcgtttttgtatgatgcctctgtttgtgaactttgatgtattttatctttgtgtgaaaaagagatt sequence gggttaataaaatatttgcttttttggataagaaactcttttagcggcccattaataaaggttacaaatgc aaaatcatgttagcgtcagatatttaattattcgaagatgattgtgatagatttaaaattatcctagtcaa aaagaaagagtaggttgagcagaaacagtgacatctgttgtttgtaccatacaaattagtttagattat tggttaacatgttaaatggctatgcatgtgacatttagaccttatcggaattaatttgtagaattattaatt aagatgttgattagttcaaacaaaaat HA of H9N2 gataaaatttgcattggctaccagtcaacaaactccacagaaactgttgatacactagtagaaaaca 17 Nucleotide atgtccctgtgacacataccaaagaattgctccacacagagcacaatggaatgttatgtgcaacaaa sequence cttgggacaccctcttatcctagacacctgcaccattgaagggttggtgtacggcaatccttcctgtg atttgctactgggagggaaagagtggtcttacattgtcgaaagatcatcagctgttaatgggatgtgc taccctggaagggtagagaatctggaagaactcaggtcctttttcagttctgctcgctcctacaaaag actcctactttttccagaccgtacttggaatgtgactttcaatgggacaagcaaagcatgctcaggct cattctacagaagtatgagatggctgacacacaagaacaattcttaccctattcaagacgcccaatat accaacgactggggaaagaatattctcttcatgtggggcatacaccatccacctactgatactgagc aaatgaatctatacaaaaaagctgatacaacaacaagtataacaacggaagatatcaatcgaacttt caaaccagggatagggccaaggcctcttgtcaatggtcaacaaggaagaattgattattattggtca gtactaaagccaggccagacattgcgaataagatccaatggaaatctaattgccccatggtatgga cacattctttcaggagaaagccatggaagaatcctgaagaccgatttgaatagtggcaactgcataa tacaatgccaaactgagaaaggtggtttgaacacgaccttgccattccaaaatgtcagcaaatatgc atttgggaactgtcccaaatatgttggagtgaagagtctcaaactggcagttggtctaaggaatgtg cctgctacatcaggtagagggcttttcggtgccatagctggattcatagaaggaggttggccagga ctagttgcaggctggtacgggtttcagcactcaaatgatcaaggggttggaatagccgcagacaaa gaatcaactcaagaagcagttgataaaataacatccaaagtaaataatataatcgacaaaatgaaca agcagtatgaaatcattgatcatgagttcagtgagattgaagccagactcaatatgatcaacaataa gattgatgaccaaatacaggacatctgggcgtacaatgcagaattactagtactgcttgaaaaccag aaaacactcgatgatcatgatgcaaatgtgaacaatctgtataataaggtgaagagagcattgggtt caaatgcaatagaggatgggaagggatgcttcgagttgtatcacaaatgtgatgatcaatgcatgg aaacaattagaaacgggacttatgacaggctaaagtataaagaagaatcaaaactagaaaggcag aaaatagaaggggtaaaactggagtctgaagaaacatacaagatt HA of H9N2 dkicigyqstnstetvdtlvennvpvthtkellhtehngmlcatnlghplildtctieglvygnpsc 18 Amino acid dlllggkewsyiverssavngmcypgrvenleelrsffssarsykrlllfpdrtwnvtfngtskac sequence sgsfyrsmrwlthknnsypiqdaqytndwgknilfmwgihhpptdteqmnlykkadtttsitt edinrtfkpgigprplvngqqgridyywsvlkpgqtlrirsngnliapwyghilsgeshgrilkt dlnsgnciiqcqtekgglnttlpfqnvskyafgncpkyvgvkslklavglrnvpatsgrglfgai agfieggwpglvagwygfqhsndqgvgiaadkestqeavdkitskvnniidkmnkqyeiid hefseiearlnminnkiddqiqdiwaynaellvllenqktlddhdanvnnlynkvkralgsnai edgkgcfelyhkcddqcmetirngtydrlkykeesklerqkiegvkleseetyki
Example 2
[0135] Expression and Identification of Hemagglutinin (HA) Recombinant Genes from Influenza Virus Surface Proteins Forming Trimer
[0136] The expressions of mHA and tHA were induced through transient expression in the plant leaves of 4 to 5-week-old tobacco plant Nicotiana benthamiana by using vacuum infiltration. Infiltrated leaves were harvested on day 3, 5 and 7 (dpi) after infiltration, respectively, thoroughly ground in liquid nitrogen and dissolved in 3 volumes of buffer. Total soluble proteins from the infiltrated leaf extract was developed by SDS-PAGE and then subjected to Western blot analysis. As confirmed in
Example 3
[0137] Confirmation of Formation of Trimeric Structure of Hemagglutinin (HA) Recombinant Genes Derived from Influenza Virus Surface Proteins Forming Trimer
[0138] The HA protein on the surface of the virus exists as a homotrimer, exhibiting high stability and immunogenicity. On the other hand, the recombinant HA tends to be expressed as aggregates or monomers, depending on the expression system. In order to mimic the trimer of HA as present on the virus surface, mouse Coronin 1-1A (mCor1, Genbank: EDL17419.1, 32 amino acids), which forms a coiled coil structure and a homotrimer, was added to the C-terminus of HA as shown in
Example 4
[0139] Identification of the Peptidoglycan Binding Ability of Hemagglutinin (HA) Recombinant Genes Derived from Influenza Virus Surface Proteins Forming Trimer
[0140] AcmA, which is a major autolysin of MG1363, a phage of Lactococcus lactis, has a domain called LysM at the C-terminus in triplicate, and the triplicate part of LysM has the ability to bind to peptidoglycan, which a cell wall component of Lactococcus. Three repeats are required for optimal activity on peptidoglycan. However, since the length of the domain is too long when all three repeat sections are included, only one LysM was fused to the C-terminus of GFP and confirmed. As a result, as confirmed in
Example 5
[0141] Identification of the Maximum Binding Amount of Hemagglutinin (HA) Recombinant Genes Derived from Influenza Virus Surface Proteins Forming a Trimer
[0142] Both mHA and tHA, which are recombinant proteins of HA, were highly expressed in Nicotiana benthamiana. Infiltrated leaves were thoroughly ground in liquid nitrogen and dissolved in 10-volume PBS buffer containing 0.5% Triton X-100, 1 mM EDTA and 25% glycerol. After obtaining the total soluble protein from the leaves, and incubating with L. lactis pretreated with TCA at 37° C. for 1 hour in an amount of the total soluble protein corresponding to 200 mg to 2 g of the leaves, it was washed 3 times with a PBS buffer. Lactococcus was precipitated from each sample, placed in an SDS buffer, heated, and then developed by SDS-PAGE with various amounts of BSA, and then stained with Coomassie Brilliant Blue to confirm HA. As a result, as confirmed in
Example 61
[0143] Preparation of Lactococcus Dead Cells and Method of Coating the Hemagglutinin (HA) Recombinant Protein Derived from Influenza Virus Surface Protein Forming a Trimer on the Dead Cells
[0144] After culturing Lactococcus (Korea Culture Center of Microorganisms; KCCM No. 43146) at OD.sub.600 to 1.0, the culture solution was recovered by pelleting the cells through centrifugation, and it was resuspended in an equal volume of 10% trichloroacetic acid (TCA) and treated at 100° C. for 10 minutes. In order to remove TCA, cells were pelleted through centrifugation, washed three times with PBS, and the pellet was resuspended to prepare Lactococcus dead cells. Various amounts of the total soluble protein extract prepared using buffer (PBS pH=7.5, 1 mM EDTA, Triton X-100, cocktail and 25% glycerol) were added and incubated at 37° C. for 1 hour. Lactococcus dead cells were pelleted by centrifugation at 12,000 rpm for 5 minutes, and these were washed three times with a PBS buffer for protein extract.
Example 7
[0145] Identification of Immunogenicity of Antigens Forming a Trimer Using Mice
[0146] Recombinant tH5N6 prepared in Examples 2 and 6, respectively, tH5N6 coated on Lactococcus dead cells, tH9N2, and tH9N2 vaccine coated on Lactococcus dead cells were administered to 6-week-old female C57BL/6 mice (Orient Bio, Korea). Intraperitoneal injection was performed twice at an interval of two weeks. As a control group, PBS and Lactococcus dead cells were administered. A test vaccine was prepared by adding the recombinant vaccine with or without mixing an adjuvant in the composition shown in Table 2 below.
TABLE-US-00002 TABLE 2 Composition Test group (+adjuvant) PBS PBS + Freund’s complete adjuvant Lactococcus dead cells 10.sup.9 Lactococcus cells + 25% glycerol + PBS + Freund’s complete adjuvant tH5N6 tHA 1 μg of H5N6 + Freund’s complete adjuvant + PBS tH5N6 coated on tHA 1 μg of H5N6 + 10.sup.9 Lactococcus cells + 25% glycerol + PBS + Lactococcus dead cells Freund’s complete adjuvant tH9N2 tHA 1 μg of H9N2 + PBS tH9N2 coated on tHA 1 μg of H9N2 + 10.sup.9 Lactococcus cells + 25% glycerol + PBS + Lactococcus dead cells Freund’s complete adjuvant + PBS Test group (−adjuvant) PBS PBS Lactococcus dead cells 10.sup.9 Lactococcus cells + 25% glycerol + PBS tH5N6 tHA 1 μg of H5N6 + PBS tH5N6 coated on tHA 1 μg of H5N6 + 10.sup.9 Lactococcus cells +25% glycerol + PBS Lactococcus dead cells tH9N2 tHA 1 μg of H9N2 + PBS tH9N2 coated on tHA 1 μg of H9N2 + 10.sup.9 Lactococcus cells + 25% glycerol + PBS Lactococcus dead cells
[0147] In order to analyze the humoral immune response induced by the administered test vaccine, the antigen-specific antibody formation was analyzed by the ELISA method by separating it from the serum of the mice at the 4.sup.th week, which was the 2.sup.nd week after the administration of the secondary vaccine at 0 week before immunization, to determine the antibody titer. Total IgG antibody titer was determined by the following method.
[0148] Specifically, after coating the purified recombinant antigen in a 96-well microplate at a concentration of 50 ng/well, 200 μL of a PBST buffer (NaCl 137 mM, KCl 2.7. mM, Na.sub.2HPO.sub.4 10 mM, KH.sub.2PO.sub.4 1.8 mM, Tween 20 1%) containing 3% skim milk was added to prevent non-specific binding, and it was reacted for 2 hours. The microplate was washed, and serum diluted with PBST solution containing 3% skim milk was sequentially added to each well and reacted on a microplate shaker at room temperature for 1 hour. Then, after washing 3 times with 200 μL of a PBST buffer, anti-mouse IgGHRP (horse radish heroxidase, KPL, USA, Bethyl.) was added as a secondary antibody and reacted under the same conditions for 2 hours. After washing the reacted microplate, a color developing reagent TMB (3,3′,5,5′-tetramethyl benzidine) and peroxidase substrate (KPL, USA) were added, and the reaction was carried out at room temperature for 10 minutes, and then, the color reaction was stopped using a 0.18M H.sub.2SO.sub.4 stop solution, and OD was measured at 450 nm using an ELISA reader. The antibody titer was defined as the reciprocal of the antibody dilution factor representing an OD value corresponding to twice the OD value of the negative control group. As a result, as confirmed in
Example 8
[0149] Comparative Analysis of Hemagglutinin (HA) Recombinant Protein Derived from Influenza Virus Surface Protein Coated on the Surface of Lactococcus and the Degree of Inhibition of Hemagglutination of the Water-Soluble Trimer
[0150] PBS was used as a control group, and by using antigens diluted by a factor of two times of tH9N2 (HA trimer of H9N2), tH5N6 (HA trimer of H5N6), Lactococcus dead cells, Lact.-tH9N2 (HA trimer of H9N2 coated on the surface of Lactococcus) and Lact.-tH5N6 (HA trimer of H5N6 coated on the surface of Lactococcus), hemagglutination inhibition assays were performed to analyze hemagglutination. 25 μL of dilution buffer was added to the U-bottom microplate from the first to the last well. After 25 μL of dilution buffer was added to the first well, the pretreated sample was diluted by two-fold from the first well to the second last well by transferring 25 μL. In this case, 25 μL of the pre-treated sample was added to the last well to confirm the non-specific reaction of the sample. Each antigen diluted to 8 HA Units was added in an amount of 25 μL from the first to the last well, sealed, and incubated at room temperature for 45 minutes. 25 μL of 1% chicken blood cells was added to each well and incubated at room temperature for 1 hour before reading. As confirmed in
Example 91
[0151] Confirmation of Antigenicity of Trimers Coated on the Surface of Lactococcus in Poultry
[0152] Six-week-old chickens (Namduk SPF, Korea) were divided into 5 chickens per group, and PBS, Lactococcus dead cells, the HA trimer of soluble H5N6 and the HA trimer of H5N6 coated on the surface of Lactococcus were used as antigens, and after administration by intramuscular injection 1 time, the production of antibodies was confirmed.
[0153] Similarly, the production of antibodies was confirmed after injection into the muscles of chickens in the same manner as above using the HA of H9N2 as an antigen. The composition of the vaccine used in this example is shown in Table 3 below. In this case, H9N2 virus 1×10.sup.7 EID50 was injected as a control group to confirm the generation of the antibody.
TABLE-US-00003 TABLE 3 Test group Composition PBS PBS Lactococcus dead cells 10.sup.9 cells of Lactococcus dead cells + 25% glycerol + PBS tH5N6 tHA 2 μg of H5N6 + PBS tH5N6 coated on tHA 2 μg of H5N6 + 10.sup.9 cells of Lactococcus dead cells + 25% glycerol + Lactococcus dead cells PBS PBS PBS Lactococcus dead cells 10.sup.9 cells of Lactococcus dead cells + 25% glycerol + PBS tH9N2 tHA 2 μg of H9N2 + PBS tH9N2 coated on tHA 2 μg of H9N2 + 10.sup.9 cells of Lactococcus dead cells + 25% glycerol + Lactococcus dead cells PBS Formalin inactivated Formalin-inactivated H9N2 10.sup.7 virus particles H9N2
[0154] In order to analyze the humoral immune response induced by the administered test vaccine, the antibody titer was determined by analyzing by ELISA for antigen-specific antibody formation after separating the chicken serum at the 2.sup.nd, 3.sup.rd and 4.sup.th weeks of immunization, respectively. Total IgG antibody titer was confirmed by the following method.
[0155] Specifically, the purified recombinant antigen was coated on a 96-well microplate at a concentration of 100 ng/well, and then, 1% bovine serum albumin was added to prevent non-specific binding and reacted for 1 hour. The microplate was washed, serially diluted serum was added to each well, and it was reacted at 37° C. for 2 hours, and anti-mouse IgGHRP (horse radish heroxidase, KPL, USA) was added as a secondary antibody, and it was reacted under the same conditions for 1 hour. After washing the reacted microplate, a color developing reagent TMB (3,3′,5,5′-tetramethyl benzidine) and peroxidase substrate (KPL, USA) were added, and the reaction was carried out at room temperature for 10 minutes, and the color reaction was stopped using a stop solution, and the OD was measured at 450 nm using an ELISA reader. The antibody titer was defined as the reciprocal of the antibody dilution factor representing an OD value corresponding to twice the OD value of the negative control group. As confirmed in
Example 10
[0156] Confirmation of Immune Induction after Coating CTB (Cholera Toxin B Subunit), HA Trimer of Soluble H5N6 and HA Trimer of Soluble H9N2 on Lactococcus Dead Cells, Respectively
[0157] After coating CTB (cholera toxin B subunit), the HA trimer of soluble H5N6 and the HA trimer of soluble H9N2 on Lactococcus dead cells, respectively, the immunogenicity was confirmed by antigen intraperitoneal injection of the same into mice (strain name: BALB/c; animal specification: 5 weeks old, female, 20 g; Animal purchase: Samtaco, Korea; Number of animals used: 3 animals/group). iLact in which CTB (1 μg) was coated was used as a control group, and iLact-tH5N6 (0.1 μg)+iLact-tH9N2 (0.1 μg), iLact-tH5N6 (0.5 μg)+iLact-tH9N2 (0.5 μg), CTB (1 μg)+iLact-tH5N6 (0.1 μg)+iLact-tH9N2 (0.1 μg), or CTB (1 μg)+iLact-tH5N6 (0.5 μg)+iLact-tH9N2 (0.5 μg) were prepared as vaccine compositions and intraperitoneally injected twice at an interval of 2 weeks, and afterwards, blood was collected two weeks later and antibodies present in the blood were confirmed by ELISA. In this case, 20 ng of H5N6 and H9N2 antigens were coated on the ELISA plate, respectively. As a result, as shown in
Example 11
[0158] Confirmation of Immune Induction Ability after Separately Coating Lactococcus with HA of H5N6 and HA of H9N2, Respectively, and Mixing Lactococcus
[0159] After coating two different types of HA on the surface of Lactococcus, the efficacy of immunogenicity on each antigen was confirmed when these were mixed and injected into mice. To this end, iLact-tHA.sup.H5N6 was prepared by coating 0.1 μg, 0.5 μg or 1.0 μg of tHA of H5N6 on the surface of Lactococcus, and similarly, after iLact-tHA.sup.H9N2 was prepared by coating 0.1 μg, 0.5 μg or 1.0 μg of tHA of H9N2 on the surface of Lactococcus, the vaccine composition (iLact-tHA.sup.H5N6+iLact-tHA.sup.H9N2) was prepared by mixing at 1:1 for each concentration. The prepared composition was intraperitoneally injected into mice at an interval of 2 weeks to induce an immune response, and blood was collected 2 weeks after the second injection to measure the amount of antibody. After 50 ng of the two types of tHA.sup.H5N6 and tHA.sup.H9N2 antigens were coated on an ELISA plate, the amount of antibody binding to each antigen was measured in the same manner as described in [Example 7]. As a result, strong immunogenicity was confirmed for both antigens as shown in
Example 121
[0160] Confirmation of Immune Induction Ability Through Simultaneous Coating of Lactococcus with Two Types of HA of H5N6 and HA of H9N2
[0161] After coating the surface of Lactococcus by mixing two types of antigens tHA of H5N6 (tHA.sup.H5N6) and tHA of H9N2 (tHA.sup.H9N2) having a concentration of 0.1 μg, 0.5 μg or 1.0 μg, respectively, at a ratio of 1:1, [iLact(tHA.sup.H5N6)+tHA.sup.H9N2)] was intraperitoneally injected into mice at an interval of 2 weeks, and blood was collected 2 weeks after the secondary immunization injection to confirm the formation of antibodies through ELISA. In the ELISA, 50 ng of the antigen used was coated, blood was diluted at an appropriate ratio, and the amount of antibody present in the blood was measured in the same manner as described in [Example 7]. As shown in