METHOD FOR SPECIFIC CLEAVAGE OF C Alpha-C BOND AND SIDE CHAIN OF PROTEIN AND PEPTIDE, AND METHOD FOR DETERMINING AMINO ACID SEQUENCE
20170327533 · 2017-11-16
Inventors
Cpc classification
C07C205/60
CHEMISTRY; METALLURGY
G01N33/6851
PHYSICS
G01N33/6842
PHYSICS
C07C205/59
CHEMISTRY; METALLURGY
International classification
C07C205/59
CHEMISTRY; METALLURGY
Abstract
The present invention provides a method for specifically cleaving a Cα-C bond of a peptide backbone and/or a side chain of a protein and a peptide, and a method for determining amino acid sequences of protein and peptide. A method for specifically cleaving a Cα-C bond of a peptide backbone and/or a side chain bond of a protein or a peptide, comprising irradiating a protein or a peptide with laser light in the presence of at least one hydroxynitrobenzoic acid selected from the group consisting of 3-hydroxy-2-nitrobenzoic acid, 4-hydroxy-3-nitrobenzoic acid, 5-hydroxy-2-nitrobenzoic acid, 3-hydroxy-5-nitrobenzoic acid, and 4-hydroxy-2-nitrobenzoic acid. A method for determining an amino acid sequence of a protein or a peptide, comprising irradiating a protein or a peptide with laser light in the presence of the above specific hydroxynitrobenzoic acid to specifically cleave a Cα-C bond of a peptide backbone and/or a side chain bond, and analyzing generated fragment ions by mass spectrometry.
Claims
1. A method for specifically cleaving a Cα-C bond of a peptide backbone and/or a side chain bond of a protein or a peptide, comprising irradiating a protein or a peptide with laser light in the presence of at least one hydroxynitrobenzoic acid selected from the group consisting of: 3-hydroxy-2-nitrobenzoic acid: ##STR00026## 4-hydroxy-3-nitrobenzoic acid: ##STR00027## 5-hydroxy-2-nitrobenzoic acid: ##STR00028## 3-hydroxy-5-nitrobenzoic acid: ##STR00029## and 4-hydroxy-2-nitrobenzoic acid: ##STR00030##
2. A method for determining an amino acid sequence of a protein or a peptide, comprising: irradiating a protein or a peptide with laser light in the presence of at least one hydroxynitrobenzoic acid selected from the group consisting of: 3-hydroxy-2-nitrobenzoic acid: ##STR00031## 4-hydroxy-3-nitrobenzoic acid: ##STR00032## 5-hydroxy-2-nitrobenzoic acid: ##STR00033## 3-hydroxy-5-nitrobenzoic acid: ##STR00034## and 4-hydroxy-2-nitrobenzoic acid: ##STR00035## to specifically cleave a Cα-C bond of a peptide backbone and/or a side chain bond; and analyzing generated fragment ions by mass spectrometry.
3. A method for determining an amino acid, sequence of a protein or a peptide, comprising: irradiating a protein or a peptide with laser light in the presence of at least one hydroxynitrobenzoic acid selected from, the group consisting of 3-hydroxy-2-nitrobenzoic acid, 4-hydroxy-3-nitrobenzoic acid, 5-hydroxy-2-nitrobenzoic acid, 3-hydroxy-5-nitrobenzoic acid, and 4-hydroxy-2-nitrobenzoic acid as a matrix to specifically cleave a Cα-C bond of a peptide backbone and/or a side chain bond; and analyzing generated fragment ions by MALDI mass spectrometry.
4. The method for determining an amino acid sequence of a protein or a peptide according to claim 2, wherein as the generated fragment ions, a-series ion species and/or x-series ion species are analyzed.
5. The method for determining an amino acid sequence of a protein or a peptide according to claim 2, wherein as the generated fragment, ions, a-series ion species and d-series ion species are analyzed.
6. A reagent for specifically cleaving a Cα-C bond of a peptide backbone and/or a side chain bond of a protein or a peptide, comprising at least one hydroxynitrobenzoic acid selected from the group consisting of: 3-hydroxy-2-nitrobenzoic acid: ##STR00036## 4-hydroxy-3-nitrobenzoic acid: ##STR00037## 5-hydroxy-2-nitrobenzoic acid: ##STR00038## 3-hydroxy-5-nitrobenzoic acid: ##STR00039## and 4-hydroxy-2-nitrobenzoic acid: ##STR00040##
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
(A) 3-hydroxy-2-nitrobenzoic acid (3H2NBA),
(B) 4-hydroxy-3-nitrobenzoic acid (4H3NBA),
(C) 5-hydroxy-2-nitrobenzoic acid (5H2NBA),
(D) 3-hydroxy-5-nitrobenzoic acid (3H5NBA),
(E) 4-hydroxy-2-nitrobenzoic acid (4H2NBA),
(F) 5-nitrosalicylic acid (5-NSA), or
(G) 1,5-diaminonaphthalene (1,5-DAN)
as a matrix, and drying the mixed solution.
MODES FOR CARRYING OUT OF THE INVENTION
[0056] For obtaining amino acid sequence information of peptide chains for a protein or a peptide to be analyzed, it is a requirement that ion species of any one or a plurality of a-, b-, c-, x-, y-, and z-series are detected continuously in mass spectrometry. The following chemical structural formula shows the naming rule of fragmentation of a peptide backbone for a peptide composed of four residues as an example. R.sub.1, R.sub.2, R.sub.3, and R.sub.4 each represent a side chain of an amino acid residue.
##STR00016##
[0057] Next, referring to chemical schemes, generation mechanisms of c-series ion and z-series ion, and, a-series ion and x-series ion by cleavage of a peptide backbone will be described (see scheme 1 of Hon-Patent document 8).
##STR00017##
[0058] The scheme (a) shows a mechanism of generation of c-series ion and z-series ion by cleavage of an N—Cα bond of a peptide backbone. When laser light irradiation is conducted in the condition that a reducing matrix coexists with a protein or peptide sample, a hydrogen radical derived from the matrix molecule and induced by the laser light irradiation is given to the sample molecule (i.e. reducing matrix), and cleavage of an N—Cα bond of the peptide backbone is induced, and mainly, ion species of c-series ion and/or z-series ion are generated. Since proline (Pro, P) has a cyclic structure in the c-series cleavage (including cleavage of N—Cα bond) site, cleavage of an N—Cα bond is very difficult to occur in the case of proline (Pro, P), and a c-series ion is not generated by cleavage on the left side of proline (Pro, P).
[0059] The scheme (b) shows a mechanism of generation of a-series ion and x-series ion by cleavage of a Cα-C bond of a peptide backbone. When laser light irradiation is conducted in the condition that an oxidizing matrix coexists with a protein or peptide sample, hydrogen radical elimination from the sample molecule occurs by the laser light irradiation, and the eliminated hydrogen radical is given to the matrix molecule (oxidizing matrix). Upon cleavage of a Cα-C bond of the peptide backbone caused by hydrogen radical elimination from the sample molecule, ion species of a-series ion and/or x-series ion are generated. Further, d-series ion species are easily generated by cleavage of a side chain from the a-series ion species.
[Matrix]
[0060] In the present invention, a protein or peptide sample is irradiated with laser light in the presence of at least one hydroxynitrobenzoic acid selected from the group consisting of 3-hydroxy-2-nitrobenzoic acid, 4-hydroxy-3-nitrobenzoic acid, 5-hydroxy-2-nitrobenzoic acid, 3-hydroxy-5-nitrobenzoic acid and 4-hydroxy-2-nitrobenzoic acid as a matrix. As the specific hydroxynitrobenzoic acid, only one kind or a combination of two or more kinds may he used. According to the above scheme (b), a Cα-C bond of a peptide backbone and/or a side chain bond are/is specifically cleaved. Hereinafter, more specific chemical schemes are shown while taking 3-hydroxy-2-nitrobenzoic acid (3H2NBA) as an example.
##STR00018##
[0061] When a protein or peptide sample is irradiated with laser light in the presence of at least one hydroxynitrobenzoic acid selected from the group consisting of 3-hydroxy-2-nitrobenzoic acid, 4-hydroxy-3-nitrobenzoic acid, 5-hydroxy-2-nitrobenzoic acid, 3-hydroxy-5-nitrobenzoic acid and 4-hydroxy-2-nitrobenzoic acid as a matrix, hydrogen radical elimination from the sample molecule occurs by the laser light irradiation, and the eliminated hydrogen radical is given to the specific hydroxynitrobenzoic acid molecule described above. The specific hydroxynitrobenzoic acid has a high acceptability of hydrogen radical by a nitro group, and hydrogen radical elimination from the sample molecule easily occurs. Upon cleavage of a Cα-C bond of a peptide backbone caused by the hydrogen radical elimination from the sample molecule, ion species of a-series ion and/or x-series ion are generated. Further, ion species of d-series ion are easily generated by cleavage of a side chain from the a-series ion species.
[0062] The generated ion species of a-series ion and/or x-series ion, and the ion species of d-series ion generated by cleavage of a side chain are subjected to mass spectrometry, and the amino acid sequence of the protein or the peptide can be determined.
[Preparation of Crystal, for Mass Spectrometry]
[0063] A crystal for mass spectrometry can be obtained through the step of forming, on a target plate for mass spectrometry, a liquid droplet of a mixture liquid containing, in a solvent, at least a protein or a peptide to be analyzed, and at least one hydroxynitrobenzoic acid matrix selected from the group consisting of 3-hydroxy-2-nitrobenzoic acid, 4-hydroxy-3-nitrobenzoic acid, 5-hydroxy-2-nitrobenzoic acid, 3-hydroxy-5-nitrobenzoic acid and 4-hydroxy-2-nitrobenzoic acid, and the step of removing the solvent from the formed liquid droplet of the mixture liquid to obtain a non-volatile matter (i.e., at least the analyte and the matrix) contained in the mixture liquid as a residue. The thus obtained residue is a crystal for mass spectrometry. In this specification, the term “crystal for mass spectrometry” is synonymous with the term “residue”.
[0064] As the target for mass spectrometry, a conductive metal plate usually used in MALDI mass spectrometry may be used. Specifically, a stainless plate may be used.
[0065] A specific method for preparing the liquid droplet of the mixture liquid on the target plate is not particularly limited. For example, first, a sample solution containing an analyte, and a matrix solution are prepared separately from each other. Then, these solutions are mixed to obtain a mixture liquid, and the obtained mixture liquid is dropped onto a target plate. Alternatively, these solutions may be mixed on a target plate by dropping these solutions onto the same position on the target plate (on-target mix). In the case of on-target mix, the order of dropping the solutions is not particularly limited.
[0066] The solvent of the mixture liquid may be selected from the group consisting of water, acetonitrile (ACN), trifluoroacetic acid (TFA), methanol (MeOH), ethanol (EtOH), tetrahydrofuran (THF), dimethylsulfoxide (DMSO), and the like. More specifically, as the solvent of the mixture liquid, an aqueous ACN solution, an aqueous ACN-TFA solution, MeOH-TFA, an aqueous MeOH solution, an aqueous EtOH-TFA solution, an aqueous EtOH solution, an aqueous THF-TFA solution, an aqueous THF solution, an aqueous DMSO-TFA solution, an aqueous DMSO solution or the like is used, and more preferably, an aqueous ACN solution or an aqueous ACN-TFA solution may be used. The concentration of ACN in the aqueous ACN-TFA solution may be, for example, 10 to 90 vol %, preferably 25 to 75 vol %, and the concentration of TEA in the aqueous ACN-TFA solution may be, for example, 0.05 to 1 vol %, preferably 0.05 to 0.1 vol %.
[0067] The volume of the liquid droplet of the mixture liquid is not particularly limited, and may be appropriately determined by those skilled in the art. When a well is provided on the target plate, the liquid droplet of the mixture liquid may be formed in the well. In this case, the liquid droplet is formed so as to have a volume that can be held in the well. More specifically, the liquid droplet may be formed so as to have a volume of about 0.1 μL to 2 μL, for example, about 0.5 μL.
[0068] Next, the solvent is removed from the liquid droplet of the mixture liquid on the target plate. The removal of the solvent includes natural evaporation of the solvent. The amount of the matrix contained per one residue (that is, per one crystal for mass spectrometry) generated by evaporation may be, for example, 1 pmol to 1,000 nmol, preferably 10 pmol to 100 nmol as a guide. The amount of the analyte may be in the range of, for example, 1 amol to 100 pmol, or in the range of 100 amol to 50 pmol of sample with respect to 10 nmol of the matrix.
[0069] The residue has a substantially circular shape on a surface in contact with the target plate. That is, the outer edge of the residue is substantially circular. The average diameter of the substantially circular shape may vary depending on the amount of the sample, the volume of the liquid droplet, the amount of the matrix, the composition of the solvent etc., but is for example 0.1 to 3 mm, preferably 0.5 to 2 mm. It is to be noted that the average diameter is the average of the lengths of line segments cut from lines passing through the center of gravity of the substantially circular shape by the outer edge of the residue.
[0070] When an ordinary metallic plate is used as the target for mass spectrometry, the substance to be analyzed mainly exists in the substantial circle in the substantially circular residue obtained by removal of the solvent. Therefore, it is possible to easily conduct ionization of the substance to be analyzed without specifying the laser irradiation position at the time of ionization.
[Mass Spectrometer]
[0071] A mass spectrometer used in the present invention is not particularly limited as long as it is used in combination with a MALDI (Matrix-Assisted Laser Desorption/Ionization) ion source. Examples of such a mass spectrometer include MALDI-TOF (Matrix-Assisted Laser Desorption/Ionization-Time-of-Flight) mass spectrometers, MALDI-QIT (Matrix-Assisted Laser Desorption/Ionization-Quadrupole Ion Trap) mass spectrometers, MALDI-QIT-TOF (Matrix-Assisted Laser Desorption/Ionization-Quadrupole Ion Trap-Time-of-Flight) mass spectrometers, MALDI-Q-TOF (Matrix-Assisted Laser Desorption/Ionization-Quadrupole-Time-of-Flight) mass spectrometers, MALDI-FTICR (Matrix-Assisted Laser Desorption/Ionization-Fourier Transform Ion Cyclotron Resonance) mass spectrometers, and MALDI-Orbitrap (Matrix-Assisted Laser Desorption/Ionization-Orbitrap) mass spectrometers.
EXAMPLES
[0072] Hereinbelow, the present invention will be described specifically with reference to examples, but is not limited to the following examples.
[0073] In the following examples, the following two kinds of peptide samples were used.
[0074] N-Acetyl-Renin Substrate (amino acid sequence: Ac-DRVYIHPFHLLVYS) (SEQ ID NO: 1)
[0075] Amyloid β [1-40] (amino acid sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV) (SEQ ID NO: 2)
[0076] As a matrix, the following seven kinds were used. 3H2NBA (3-hydroxy-2-nitrobenzoic acid), present invention
##STR00019##
[0077] 4H3NBA (4-hydroxy-3-nitrobenzoic acid), present invention
##STR00020##
[0078] 5H2NBA (5-hydroxy-2-nitrobenzoic acid), present invention
##STR00021##
[0079] 3H5NBA (3-hydroxy-5-nitrobenzoic acid), present invention
##STR00022##
[0080] 4H2NBA (4-hydroxy-2-nitrobenzoic acid), present invention
##STR00023##
[0081] 5-NSA (5-nitrosalicylic acid), for comparison
##STR00024##
[0082] 1,5-DAN (1,5-Diaminonaphthalene), for comparison
##STR00025##
[0083] Among the above matrixes, 3H2NBA, 4H3NBA, 5H2NBA, 3H5NBA, 4H2NBA and 5-NSA have a functional group —NO.sub.2. This —NO.sub.2 group exerts the effect of drawing out a hydrogen radical from the peptide sample by laser light irradiation, and causes cleavage
[0084] of a Cα-C bond of a peptide backbone. As a result, a-series ion species and x-series ion species are generated, and further d-series ion species are generated.
[0085] Among the above matrixes, 1,5-DAN has a functional group —NH.sub.2. The —NH.sub.2 group exerts the effect of generating a hydrogen radical derived from the 1,5-DAN molecule by laser light irradiation, and adding the hydrogen radical to the peptide sample, and causes cleavage of an N—Cα bond of a peptide backbone. As a result, c-series ion species and z-series ion species are generated.
[0086] Sample plate: a stainless plate having a thickness of 2 mm was used.
[0087] Mass spectrometer: MALDI-Time-of-Flight mass spectrometer [AXIMA-Performance (registered trademark), available from Shimadzu Corporation] was used.
Example 1
Peptide Sample: N-Acetyl-Renin Substrate
(Ac-DRVYIHPFHLLVYS) (SEQ ID NO: 1)
[0088] Matrix:
3H2NBA (3-hydroxy-2-nitrobenzoic acid), present invention
4H3NBA (4-hydroxy-3-nitrobenzoic acid), present invention
5H2NBA (5-hydroxy-2-nitrobenzoic acid), present invention
3H5NBA (3-hydroxy-5-nitrobenzoic acid), present invention
4H2NBA (4-hydroxy-2-nitrobenzoic acid), present invention
1,5-DAN (1,5-Diaminonaphthalene), for comparison
[Operation]
[0089] (1) As a peptide sample solution, a 20 pmol/μL N-Acetyl-Renin Substrate solution in water was prepared.
[0090] (2) As a matrix solution, a 10 mg/mL solution of 3B2NBA, 4H3NBA, 5H2NBA, 3H5NBA, or 4H2NBA in 75% ACM, water was prepared, and for comparison, a 10 mg/mL solution of 1, 5-DAN in 75% ACN, water was prepared.
[0091] (3) The sample solution (0.5 μL) prepared in (1) was dropped onto a MALDI sample plate, and then the matrix solution (0.5 μL) prepared in (2) was dropped thereonto (on-target mix). The amount of the peptide sample per one well was 10 pmol.
[0092] (4) After the solvent was volatilized, measurement was conducted by a Raster analysis for 40×40=1,600 points in a 1.2 mm-to 1.7 mm-square depending on the extent of the residue on the plate by MALDI TOFMS [AXIMA Performance (registered trademark), available from Shimadzu Corporation)] in a positive ion mode and linear mode.
[Results]
[0093]
[0094] As shown in the spectra of the bottom rows in
[0095] In contrast, as shown in the spectra of the first to the fifth rows in
[0096] As shown in the spectrum of the bottom row in
[0097] In contrast, as mainly shown in
[0098]
Example 2
[0099] Peptide sample: Amyloid β [1-40] (amino acid sequence: DAEFRHDSGYEVHHQKLYFFAEDVGSMKGAIIGLMVGGW) (SEQ ID NO: 2)
[0100] Matrix:
3H2NBA (3-hydroxy-2-nitrobenzoic acid), present invention
4H3NBA (4-hydroxy-3-nitrobenzoic acid), present invention
5H2NBA (5-hydroxy-2-nitrobenzoic acid), present invention
3H5NBA (3-hydroxy-5-nitrobenzoic acid), present invention
4H2NBA (4-hydroxy-2-nitrobenzoic acid), present invention
5-NSA (5-nitrosalicylic acid), for comparison
[Operation]
[0101] (1) As a peptide sample solution, a 20 pmol/μL Amyloid β [1-40] solution in 50% ACM 0.1% TEA water was prepared.
[0102] (2) As a matrix solution, a 10 mg/mL solution of 3H2NSA, 4H3NBA, 5H2NBA, 3H5NBA, or 4H2NBA in 75% ACN, water was prepared, and for comparison, a 10 mg/mL solution of 5-NSA in 75% ACN, water was prepared.
[0103] (3) The sample solution (0.5 μL) prepared in (1) was dropped
[0104] onto a MALDI sample plate, and then the matrix solution (0.5 μL) prepared in (2) was dropped thereon to (on-target mix). The amount of the peptide sample per one well was 10 pmol.
[0105] (4) After the solvent was volatilized, measurement was conducted by a Raster analysis for 40×40=1,600 points in a 1.2 mm-to 1.7 mm-square depending on the extent of the residue on the plate by MALDI TOFMS [AXIMA Performance (registered trademark), available from Shimadzu Corporation)] in a positive ion mode and linear mode.
[Results]
[0106]
[0107] As shown in the spectra of
[0108] In contrast, as shown in the spectra of the top row to the fifth row of
Example 3
[0109] Additional advantageous effects when 3H2NBA, 4H3NBA, 5H2NBA, 3H5NBA, or 4H2NBA is used as a matrix will be shown by referring to
[0110]
[0111]
[0112] As shown in
[0113] As shown in