Parent Phytase Variant

20230167422 · 2023-06-01

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided is a parent phytase variant, which relates to the technical field of protein engineering. The variant, relative to the parent phytase thereof, has one or more amino acid substitutions at positions corresponding to positions 295, 349, and 374 of SEQ ID NO: 1. Compared to the parent phytase, the variant has increased thermal stability.

    Claims

    1. A parent phytase variant, wherein (a) the variant, relative to a parent phytase thereof, has one or more amino acid substitutions at positions corresponding to positions 295, 349, and 374 of SEQ ID NO: 1, and the amino acid sequence of the parent phytase has at least 80% sequence identity to SEQ ID NO: 98; (b) the variant has phytase activity; and (c) the variant has increased thermal stability compared to the parent phytase.

    2. The parent phytase variant of claim 1, wherein the amino acid sequence of the parent phytase has at least 90% sequence identity to SEQ ID NO: 98.

    3. The parent phytase variant of claim 2, wherein the amino acid sequence of the parent phytase is selected from: SEQ ID NO: 2, SEQ ID NO: 98, SEQ ID NO: 102, SEQ ID NO: 107, SEQ ID NO: 112, or SEQ ID NO: 115.

    4. The parent phytase variant of claim 3, wherein the amino acid at position 295 of the variant is substituted with P, Y, G, K, L or Q.

    5. The parent phytase variant of claim 3, wherein the amino acid at position 349 of the variant is substituted with K, L, G, H, R or T.

    6. The parent phytase variant of claim 3, wherein the amino acid at position 374 of the variant is substituted with R, V, N, S, T, F, K, P or Y.

    7. The parent phytase variant of claim 1, wherein the variant, relative to the parent phytase thereof, comprises an amino acid substitution selected from the group consisting of: T295P; Q349K; E374R; T295Y; Q349L; E374V; T295P+Q349K; T295P+E374R; T295P+Q349L; T295P+E374V; T295Y+Q349K; T295Y+E374R; T295Y+Q349L; T295Y+E374V; Q349L+E374R; Q349K+E374R; Q349L+E374V; Q349K+E374V; T295P+Q349K+E374R; T295Y+Q349K+E374R; T295P+Q349L+E374R; T295Y+Q349L+E374R; T295P+Q349K+E374V; T295Y+Q349K+E374V; T295P+Q349L+E374V; T295Y+Q349L+E374V.

    8. The parent phytase variant of claim 7, wherein the variant has at least 90% sequence identity to the amino acid sequence of the parent phytase thereof.

    9. The parent phytase variant of claim 1, wherein the variant further comprises at least one pair of introduced disulfide bonds.

    10. The parent phytase variant of claim 9, wherein the variant comprises disulfide bonds formed between an amino acid residue at a position corresponding to position 346 of SEQ ID NO: 1 and an amino acid residue at a position corresponding to position 393 of SEQ ID NO: 1.

    11. The parent phytase variant of claim 1, wherein the amino acid sequence of the variant is selected from SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, SEQ ID NO: 106, SEQ ID NO: 108, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 111, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 116, SEQ ID NO: 117 or SEQ ID NO: 118.

    12. A nucleic acid, encoding the parent phytase variant of claim 1.

    13. A vector, comprising the nucleic acid of claim 12.

    14. A host cell, comprising the vector of claim 13.

    15. The host cell of claim 14, wherein the host cell is a fungal cell, a bacterial cell or a plant cell.

    16. The host cell of claim 15, which is a fungal cell selected from a Pichia pastoris cell or an Aspergillus niger cell.

    17. A method for producing the parent phytase variant, wherein the method comprises: (a) culturing a host cell comprising a nucleic acid encoding the parent phytase variant of claim 1 under a condition suitable for expression of the parent phytase variant; and (b) recovering the parent phytase variant.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0051] The specific embodiments of the present invention will be further described in detail below in conjunction with the drawings.

    [0052] FIG. 1 shows a plasmid map of pPIC9K-APPA-Y0.

    [0053] FIG. 2 shows detection results of thermal stability of the parent phytase and variants thereof in example 1.

    [0054] FIG. 3 shows detection results of thermal stability of variants with site-directed saturation mutations on an amino acid at position 295 in example 3.

    [0055] FIG. 4 shows detection results of thermal stability of variants with site-directed saturation mutations on an amino acid at position 349 in example 3.

    [0056] FIG. 5 shows detection results of thermal stability of variants with site-directed saturation mutations on an amino acid at position 374 in example 3.

    [0057] FIG. 6 shows detection results of thermal stability of variants with combinations of mutations in example 4.

    [0058] FIG. 7 shows detection results of thermal stability of variants of parent phytase APPA-An1 in example 5.

    [0059] FIG. 8 shows detection results of thermal stability of variants of parent phytase APPA-An5 in example 6.

    [0060] FIG. 9 shows detection results of thermal stability of variants of parent phytase APPA-An10 in example 7.

    [0061] FIG. 10 shows detection results of thermal stability of variants of parent phytase APPA-An15 in example 8.

    [0062] FIG. 11 shows detection results of thermal stability of variants of parent phytase APPA-An18 in example 9.

    DETAILED DESCRIPTION OF EMBODIMENTS

    [0063] In order to illustrate the present invention more clearly, the present invention is further described below in conjunction with preferred examples and the drawings. A person skilled in the art should understand that the content specifically described below is illustrative and not restrictive, and is not intended to limit the scope of protection of the present invention.

    Example 1 Construction of Mutant Expression Strains of Pichia pastoris

    [0064] The present invention cites the amino acid sequence of the phytase mutant named APPA-M2-0 in patent WO 2019228441, and the amino acid sequence thereof is as shown in SEQ ID NO: 2 of the present invention. This phytase mutant is named as APPA-Y0 in the present invention. APPA-Y0 is a phytase mutant obtained by subjecting Escherichia coli-derived wild-type phytase (the amino acid sequence thereof is as shown in SEQ ID NO: 1) to mutation, screening, glycosylation and introduction of disulfide bond sites, and the specific method is as described in WO 2019228441. The mutant has excellent thermal stability. This example involves further mutation and screening on the basis of the APPA-Y0 sequence.

    [0065] The nucleic acid sequence of APPA-Y0 expressed in Pichia pastoris was synthesized by GenScript Biotech Co., Ltd., and the gene was cloned into a Pichia pastoris vector, wherein the expression vector was pPIC9K, and the Alpha factor of Saccharomyces cerevisiae was used as a signal peptide. The phytase expression plasmid pPIC9K-APPA-Y0 is as shown in FIG. 1.

    [0066] In the first round of variant screening, APPA-Y0 was used as a parent phytase. In order to improve the thermal stability of the parent phytase, the inventors designed the following 37 mutants on the basis of the amino acid sequence and protein structure analysis of APPA-Y0, as shown in Table 1. In the design, each variant comprised one amino acid substitution relative to the parent phytase APPA-Y0, and these variants were named APPA-Y1 to APPA-Y37 with amino acid sequences as shown in SEQ ID NOs: 3-39, respectively.

    TABLE-US-00001 TABLE 1 Phytase variants constructed in the first round Mutant name Mutation site Sequence number APPA-Y0 Parent SEQ ID NO: 2 APPA-Y1 A25P SEQ ID NO: 3 APPA-Y2 M29L SEQ ID NO: 4 APPA-Y3 K43P SEQ ID NO: 5 APPA-Y4 R50K SEQ ID NO: 6 APPA-Y5 G52A SEQ ID NO: 7 APPA-Y6 L58M SEQ ID NO: 8 APPA-Y7 D69Q SEQ ID NO: 9 APPA-Y8 G97A SEQ ID NO: 10 APPA-Y9 E98Q SEQ ID NO: 11 APPA-Y10 A105F SEQ ID NO: 12 APPA-Y11 A109D SEQ ID NO: 13 APPA-Y12 T118Q SEQ ID NO: 14 APPA-YI3 S120T SEQ ID NO: 15 APPA-Y14 P121M SEQ ID NO: 16 APPA-Y15 N137I SEQ ID NO: 17 APPA-Y16 T156M SEQ ID NO: 18 APPA-Y17 R159L SEQ ID NO: 19 APPA-Y18 T191P SEQ ID NO: 20 APPA-Y19 V211L SEQ ID NO: 21 APPA-Y20 Q225Y SEQ ID NO: 22 APPA-Y21 S240W SEQ ID NO: 23 APPA-Y22 N244Y SEQ ID NO: 24 APPA-Y23 Q258F SEQ ID NO: 25 APPA-Y24 S266Y SEQ ID NO: 26 APPA-Y25 T295P SEQ ID NO: 27 APPA-Y26 S296K SEQ ID NO: 28 APPA-Y27 I300L SEQ ID NO: 29 APPA-Y28 L307I SEQ ID NO: 30 APPA-Y29 Q346F SEQ ID NO: 31 APPA-Y30 Q349K SEQ ID NO: 32 APPA-Y31 L352Y SEQ ID NO: 33 APPA-Y32 F354Y SEQ ID NO: 34 APPA-Y33 M360L SEQ ID NO: 35 APPA-Y34 K363A SEQ ID NO: 36 APPA-Y35 T370C SEQ ID NO: 37 APPA-Y36 E374R SEQ ID NO: 38 APPA-Y37 T397I SEQ ID NO: 39

    [0067] The variant plasmids were named pPIC9K-APPA-Y1 to pPIC9K-APPA-Y37 according to the variant names in the table above. In order to express the parent phytase and the variants thereof, Pichia pastoris GS115 and plasmids were manipulated by using the Pichia expression kit (Invitrogen) with reference to specifications thereof. Specifically, Pichia pastoris GS115 strains were subjected to a plate culture at 30° C. for 48 h by using a YPD medium (1% yeast extract, 2% protein, 2% glucose, and 1.5% agar), and then single clones were picked to 4 mL of a YPD liquid medium (1% yeast extract, 2% protein, and 2% glucose), cultured at 30° C. at 200 rpm for 12 h, transferred to an Erlenmeyer flask containing 30 mL of a YPD liquid medium, and cultured at 30° C. at 220 rpm for 4-5 h. After an OD600 value was detected to be in a range of 1.1-1.3, a culture solution was centrifuged at 4° C. at 9,000 rpm for 2 min. 4 mL of thalli were respectively collected into sterile EP tubes. Supernatants were gently removed. Residual supernatants were thoroughly absorbed by a sterile filter paper. Then the thalli were resuspended in 1 mL of pre-cooled sterile water and centrifuged at 4° C. at 9,000 rpm for 2 min, and supernatants were removed. The above steps were repeated. The thalli were resuspended in 1 mL of pre-cooled sorbitol (1 mol/L). Centrifugation at 4° C. at 9,000 rpm was performed for 2 min. Supernatants were removed. The thalli were resuspended in 100-150 μl of pre-cooled sorbitol (1 mol/L). Hereto, preparation of competent cells was completed. The expression plasmid pPIC9K-APPA-Y0 and other 37 variants were linearized with BglII. Linearized fragments were purified and recovered, and then transformed into the above-mentioned Pichia pastoris GS115 competent cells by an electroporation method. The mixture was evenly plated on an MD plate, which was inverted and cultured at 30° C. for 2-3 days. All the colonies were washed off the plate by sterile water, and then plated on a YPD (0.5 mg/mL-8 mg/mL) plate containing different concentrations of geneticin for screening multiple copies of transformants. The recombinant strains of Pichia pastoris were obtained by screening on the MD plate and were named as APPA-Y0 and APPA-Y1 to APPA-Y37. The above-mentioned clones obtained by screening were respectively transferred to BMGY mediums, cultured in a shaker at 30° C. at 250 rpm for 24 h, then transferred to BMMY mediums, and maintained at 30° C., 250 rpm, and 0.5% methanol was added every day to induce expression for 120 h. The thalli were removed by centrifuging at 9000-12000 rpm for 10 min to obtain fermentation supernatants containing phytase APPA-Y0 and other 37 variants. The results of SDS-PAGE shown that four variants, APPA-Y1, APPA-Y7, APPA-Y8 and APPA-Y16, were not expressed, and the remaining APPA-Y0 and other 33 variants were expressed.

    Example 2 Determination of Thermal Stability

    [0068] Phytase activity determination conforms to the standards of GBT18634-2009 document. The 33 variant samples and the parent phytase APPA-Y0 in example 1 were diluted to 100 U/mL with water. 9 mL of water was added to a 25 mL colorimetric tube; 1 mL of an enzyme sample was pipetted with a pipette, quickly added to the test tube and mixed quickly with a mixer, and the test tube was placed in a constant temperature water bath at 85° C. for exactly 5 min. The samples were quickly cooled to room temperature and diluted with water. The residual activity of each sample was determined, so as to calculate the residual activity of the enzyme at different treatment temperatures. The enzyme activity before thermal treatment was set as 100%, and the obtained thermal stability data are as shown in FIG. 2.

    [0069] According to the above-mentioned experimental results, the introduction of mutation sites had a significant effect on phytase.

    [0070] The introduction of some mutation sites resulted in abnormal expression of phytase, such as APPA-Y1, APPA-Y7, APPA-Y8 and APPA-Y16;

    [0071] the introduction of some mutation sites may result in reduced thermal stability of phytase, for example, the thermal stability of APPA-Y22 and APPA-Y29 was significantly lower than that of APPA-Y0;

    [0072] and the introduction of some mutation sites also resulted in significantly improved thermal resistance of phytase, such as APPA-Y2 (M29L), APPA-Y4 (R50K), APPA-Y5 (G52A), APPA-Y6 (L58M), APPA-Y10 (A105F), APPA-Y12 (T118Q), APPA-Y25 (T295P), APPA-Y28 (L3071), APPA-Y30 (Q349K), APPA-Y33 (M360L), and APPA-Y36 (E374R), wherein APPA-Y25 (T295P), APPA-Y30 (Q349K), and APPA-Y36 (E374R) had the best performance, with about 19%-22% improved residual activity of the variants compared to the parent phytase APPA-Y0.

    Example 3 Saturation Mutation on 3 Mutation Sites in Example 2

    [0073] The 3 mutation sites T295P, Q349K and E374R corresponding to 3 mutant strains APPA-Y25, APPA-Y30, and APPA-Y36 with the most improved thermal resistance in example 2 were subjected to saturation mutation, that is, the amino acids at positions 295, 349 and 374 were mutated into other 18 amino acids. The corresponding sequence names were as shown in tables 2-4 below.

    TABLE-US-00002 TABLE 2 Site-directed saturation mutation on amino acid at position 295 Mutant name Mutation site Sequence number APPA-Y25-1 T295A SEQ ID NO: 44 APPA-Y25-2 T295C SEQ ID NO: 45 APPA-Y25-3 T295D SEQ ID NO: 46 APPA-Y25-4 T295E SEQ ID NO: 47 APPA-Y25-5 T295F SEQ ID NO: 48 APPA-Y25-6 T295G SEQ ID NO: 49 APPA-Y25-7 T295H SEQ ID NO: 50 APPA-Y25-8 T295I SEQ ID NO: 51 APPA-Y25-9 T295K SEQ ID NO: 52 APPA-Y25-10 T295L SEQ ID NO: 53 APPA-Y25-11 T295M SEQ ID NO: 54 APPA-Y25-12 T295N SEQ ID NO: 55 APPA-Y25-13 T295Q SEQ ID NO: 56 APPA-Y25-14 T295R SEQ ID NO: 57 APPA-Y25-15 T295S SEQ ID NO: 58 APPA-Y25-16 T295V SEQ ID NO: 59 APPA-Y25-17 T295W SEQ ID NO: 60 APPA-Y25-18 T295Y SEQ ID NO: 61

    TABLE-US-00003 TABLE 3 Site-directed saturation mutation on amino acid at position 349 Mutant name Mutation site Sequence number APPA-Y30-1 Q349A SEQ ID NO: 62 APPA-Y30-2 Q349C SEQ ID NO: 63 APPA-Y30-3 Q349D SEQ ID NO: 64 APPA-Y30-4 Q349E SEQ ID NO: 65 APPA-Y30-5 Q349F SEQ ID NO: 66 APPA-Y30-6 Q349G SEQ ID NO: 67 APPA-Y30-7 Q349H SEQ ID NO: 68 APPA-Y30-8 Q349I SEQ ID NO: 69 APPA-Y30-9 Q349L SEQ ID NO: 70 APPA-Y30-10 Q349M SEQ ID NO: 71 APPA-Y30-11 Q349N SEQ ID NO: 72 APPA-Y30-12 Q349P SEQ ID NO: 73 APPA-Y30-13 Q349R SEQ ID NO: 74 APPA-Y30-14 Q349S SEQ ID NO: 75 APPA-Y30-15 Q349T SEQ ID NO: 76 APPA-Y30-16 Q349V SEQ ID NO: 77 APPA-Y30-17 Q349W SEQ ID NO: 78 APPA-Y30-18 Q349Y SEQ ID NO: 79

    TABLE-US-00004 TABLE 4 Site-directed saturation mutation on amino acid at position 374 Mutant name Mutation site Sequence number APPA-Y36-1 E374A SEQ ID NO: 80 APPA-Y36-2 E374C SEQ ID NO: 81 APPA-Y36-3 E374D SEQ ID NO: 82 APPA-Y36-4 E374F SEQ ID NO: 83 APPA-Y36-5 E374G SEQ ID NO: 84 APPA-Y36-6 E374H SEQ ID NO: 85 APPA-Y36-7 E374I SEQ ID NO: 86 APPA-Y36-8 E374K SEQ ID NO: 87 APPA-Y36-9 E374L SEQ ID NO: 88 APPA-Y36-10 E374M SEQ ID NO: 89 APPA-Y36-11 E374N SEQ ID NO: 90 APPA-Y36-12 E374P SEQ ID NO: 91 APPA-Y36-13 E374Q SEQ ID NO: 92 APPA-Y36-14 E374S SEQ ID NO: 93 APPA-Y36-15 E374T SEQ ID NO: 94 APPA-Y36-16 E374V SEQ ID NO: 95 APPA-Y36-17 E374W SEQ ID NO: 96 APPA-Y36-18 E374Y SEQ ID NO: 97

    [0074] According to the method in example 1, each variant was expressed using Pichia pastoris, and then the thermal stability of each variant was determined according to the method in example 2. The results were as shown in FIG. 3-FIG. 5.

    [0075] The results in the figures showed that performing saturation mutation on amino acids at 3 positions respectively had a significant effect on the variant.

    [0076] Some mutations even resulted in abnormal expression, such as APPA-Y25-2, APPA-Y25-17, APPA-Y30-3, APPA-Y30-5, APPA-Y30-8, APPA-Y30-12 and APPA-Y30-18;

    [0077] in addition, the introduction of some mutation sites may result in reduced thermal stability of phytase, for example, the thermal stability of APPA-Y30-2, APPA-Y36-2 and APPA-Y36-9 was significantly lower than that of APPA-Y0;

    [0078] and furthermore, the introduction of some mutation sites significantly improved thermal resistance of phytase, such as APPA-Y25-6 (T295G), APPA-Y25-9 (T295K), APPA-Y25-10 (T295L), APPA-Y25-13 (T295Q), APPA-Y25-18 (T295Y), APPA-Y30-9 (Q349L), APPA-Y30-6 (Q349G), APPA-Y30-7 (Q349H), APPA-Y30-13 (Q349R), APPA-Y30-15 (Q349T), APPA-Y36-11 (E374N), APPA-Y36-14 (E374S), APPA-Y36-15 (E374T), APPA-Y36-16 (E374V), APPA-Y36-4 (E374F), APPA-Y36-8 (E374K), APPA-Y36-12 (E374P), and APPA-Y36-18 (E374Y).

    [0079] It can be seen from the experimental data of example 2 and example 3 that, when a single amino acid substitution was introduced on the basis of the parent phytase, the introduction of mutation sites T295P, Q349K, E374R, T295Y, Q349L or E374V provided better effects, which significantly improved the thermal stability of phytase.

    Example 4 Combinations of Mutation Sites

    [0080] The 3 mutant sites T295P, Q349K and E374R corresponding to the 3 mutant strains APPA-Y25, APPA-Y30 and APPA-Y36 in example 2 were combined, and the corresponding variants were constructed according to the method in example 1 and expressed in Pichia pastoris. The specific mutations were as shown in table 5 below. The thermal stability was determined according to the detection method in example 2. The obtained thermal stability data were as shown in FIG. 6. It can be seen from the detection results that the phytase variants subjected to the combined mutations had significantly improved thermal resistance compared with the parent phytase APPA-Y0. The combination of some mutations increased thermal resistance of the variants by 16%-27% compared with APPA-Y0, indicating that a suitable combination can create a more stable mutant, which can be expected to have good performance in feed granulation.

    TABLE-US-00005 TABLE 5 Phytase variants subjected to combinations of mutations Sequence name Mutation site Sequence number APPA-Y38 T295P + Q349K SEQ ID NO: 40 APPA-Y39 T295P + E374R SEQ ID NO: 41 APPA-Y40 Q349K + E374R SEQ ID NO: 42 APPA-Y41 T295P + Q349K + E374R SEQ ID NO: 43

    Example 5 Expression of Variants of Parent Phytase APPA-An1 in Aspergillus niger

    [0081] APPA-An1 is another mutant having excellent thermal resistance obtained by mutation of wild-type phytase from Escherichia coli, and the amino acid sequence thereof was as shown in SEQ ID NO: 98.

    TABLE-US-00006 QSEEELKLESVVIVSRHGVRAPTKFTQLMQDVTPYAWPTWPVKLGELTP RGGELIAYLGHYWRQRLVADELLPNQTCPQPGQVAIIADVDERTRKTGE AFAAGLAPGCAITVHHQADTSSPDPLFNPLKTGVCQLDVARVTRAILER AGGSIADFTNHYQPAFRELERVLNFSQSPLCKNREKQNEPCSLTQALPS ELKVSADNVSLTGAWSLASMLTEIFLLQQAQGMPEPGWGRITDSHQWNT LLSLHNAYFDLLQRTPEVARSAATPLLDLIKTALTPNGTQKSAYGVTLP TSVLFIAGHDTNLANLGGALELNWTLPGQPDNYPPGGELVFERWRRLSD NSCWIQVSLVFQTLQQMRDKTPLSLNTPPGEVKLTLPGCEERNAQGMCS CAGFTQIVNEARIPACSL*

    [0082] In order to test whether the mutation sites discovered in the present invention can also function on the existing phytase mutants and further improve the stability of phytase, this example involved using APPA-An1 as a parent phytase, adding amino acid substitutions Q349K and E374R, alone or in combination, to the amino acid sequence of APPA-An1, wherein each mutant was named according to APPA-An2 to APPA-An4, as shown in the table below. The above-mentioned phytase mutants were expressed in Aspergillus niger according to the method described in patent application CN 107353327 A. After the supernatant from the shake flask was obtained, the thermal stability was determined as described in example 2, and incubation was performed at 85° C. for 5 minutes. The experimental results were as shown in FIG. 7. The experimental results showed that the 3 variants all showed a significant improvement in stability performance and demonstrate more excellent stability than the parent phytase APPA-An1, that is, a phytase variant with a higher stability can be obtained by introducing 1-2 mutation sites of the present invention into the parent phytase, and can be expected to have good performance in feed granulation.

    TABLE-US-00007 TABLE 6 Variants of parent APPA-An1 Mutant name Mutation site Sequence number APPA-An1 Parent SEQ ID NO: 98 APPA-An2 Q349K SEQ ID NO: 99 APPA-An3 E374R SEQ ID NO: 100 APPA-An4 Q349K + E374R SEQ ID NO: 101

    Example 6 Expression of Variants of Parent Phytase APPA-An5 in Aspergillus niger

    [0083] APPA-An5 is another mutant having excellent thermal resistance obtained by mutation of wild-type phytase, and the amino acid sequence thereof was as shown in SEQ ID NO: 102. In order to test whether the mutation sites discovered in the present invention can also function on the existing phytase mutants and further improve the stability of phytase, this example involved using APPA-An5 as a parent phytase, adding T295P, Q349K and E374R, alone or in combination, to the amino acid sequence of APPA-An5, wherein each mutant was named according to APPA-An6 to APPA-An9, as shown in table 7. The above-mentioned phytase variants were expressed in Aspergillus niger according to the method in example 5. After the supernatant from the shake flask was obtained, the thermal stability was determined as described in example 2, and incubation was performed at 85° C. for 5 minutes. The experimental results were as shown in FIG. 8. It has been found that the 4 mutants all showed a significant improvement in stability performance and demonstrated more excellent stability than the parent APPA-An5, that is, a phytase mutant with a higher stability can be obtained by introducing 1-2 mutation sites of the present invention into the parent phytase, and can be expected to have good performance in feed granulation.

    TABLE-US-00008 TABLE 7 Phytase mutants Mutant name Mutation site Sequence number APPA-An5 Parent SEQ ID NO: 102 APPA-An6 T295P SEQ ID NO: 103 APPA-An7 Q349K SEQ ID NO: 104 APPA-An8 E374R SEQ ID NO: 105 APPA-An9 Q349K + E374R SEQ ID NO: 106

    Example 7 Expression of Variants of Parent Phytase APPA-An10 in Aspergillus niger

    [0084] APPA-An10 is another mutant having excellent thermal resistance obtained by mutation of wild-type phytase and screening, and the amino acid sequence thereof was as shown in SEQ ID NO: 107. In order to test whether the mutation sites discovered in the present invention can also function on the existing phytase mutants and further improve the stability of phytase, this example involved using APPA-An10 as a parent phytase, adding T295P, Q349K and E374R, alone or in combination, to the amino acid sequence of APPA-An10, wherein each mutant was named according to APPA-An11 to APPA-An14, as shown in table 8. The above-mentioned phytase variants were expressed in Aspergillus niger according to the method in example 5. After the supernatant from the shake flask was obtained, the thermal stability was determined as described in example 2, and incubation was performed at 85° C. for 5 minutes. The experimental results were as shown in FIG. 9. It has been found that the 4 mutants all showed a significant improvement in stability performance and demonstrate more excellent stability than the parent APPA-An10, that is, a phytase mutant with a higher stability can be obtained by introducing 1-3 mutation sites of the present invention into the parent phytase, and can be expected to have good performance in feed granulation.

    TABLE-US-00009 TABLE 8 Phytase mutants Mutant name Mutation site Sequence number APPA-An10 Parent SEQ ID NO: 107 APPA-An11 E374R SEQ ID NO: 108 APPA-An12 T295P + Q349K SEQ ID NO: 109 APPA-An13 T295P + E374R SEQ ID NO: 110 APPA-An14 T295P + Q349K + E374R SEQ ID NO: 111

    Example 8 Expression of Variants of Parent Phytase APPA-An15 in Aspergillus niger

    [0085] APPA-An15 is another mutant having excellent thermal resistance obtained by mutation of wild-type phytase and screening, and the amino acid sequence thereof was as shown in SEQ ID NO: 112. In order to test whether the mutation sites discovered in the present invention can also function on the existing phytase mutants and further improve the stability of phytase, this example involved using APPA-An15 as a parent phytase, adding T295P and E374R separately to the amino acid sequence of APPA-An15, wherein each mutant was named according to APPA-An16 to APPA-An17, as shown in the table below. The above-mentioned phytase variants were expressed in Aspergillus niger according to the method in example 5. After the supernatant from the shake flask was obtained, the thermal stability was determined as described in example 2, and incubation was performed at 85° C. for 5 minutes. The experimental results were as shown in FIG. 10. It has been found that the 2 mutants all showed a significant improvement in stability performance and demonstrated more excellent stability than the parent APPA-An15, that is, a phytase mutant with a higher stability can be obtained by introducing 1 mutation site of the present invention into the parent phytase, and can be expected to have good performance in feed granulation.

    TABLE-US-00010 TABLE 9 Phytase mutants Mutant name Mutation site Sequence number APPA-An15 Parent SEQ ID NO: 112 APPA-An16 T295P SEQ ID NO: 113 APPA-An17 E374R SEQ ID NO: 114

    Example 9 Expression of Variants of Parent Phytase APPA-An18 in Aspergillus niger

    [0086] APPA-An18 is another mutant having excellent thermal resistance obtained by mutation of wild-type phytase and screening, and the amino acid sequence thereof was as shown in SEQ ID NO: 115. In order to test whether the mutation sites discovered in the present invention can also function on the existing phytase mutants and further improve the stability of phytase, this example involved using APPA-An18 as a parent phytase, adding T295P, Q349K and E374R, alone or in combination, to the amino acid sequence of APPA-An18, wherein each mutant was named according to APPA-An19 to APPA-An21, as shown in table 10. The above-mentioned phytase variants were expressed in Aspergillus niger according to the method in example 5. After the supernatant from the shake flask was obtained, the thermal stability was determined as described in example 2, and incubation was performed at 85° C. for 5 minutes. The experimental results were as shown in FIG. 11. It has been found that the 3 mutants all showed a significant improvement in stability performance and demonstrated more excellent stability than the parent APPA-An18, that is, a phytase mutant with a higher stability can be obtained by introducing 1-3 mutation sites of the present invention into the parent phytase, and can be expected to have good performance in feed granulation.

    TABLE-US-00011 TABLE 10 Phytase mutants Mutant name Mutation site Sequence number APPA-An18 Parent SEQ ID NO: 115 APPA-An19 Q349K SEQ ID NO: 116 APPA-An20 Q349K + E374R SEQ ID NO: 117 APPA-An21 T295P + Q349K + E374R SEQ ID NO: 118

    [0087] Obviously, the above-mentioned examples of the present invention are merely examples used for clearly describing the present invention, instead of limiting the implementations of the present invention. For a person of ordinary skill in the art, it would also be possible to make other different forms of changes or variations on the basis of the above-mentioned description, and it is not possible to exhaust all embodiments here. Any obvious changes or variations derived from the technical solution of the present invention are still within the scope of protection of the present invention.