HIGH AFFINITY ANTIBODIES TARGETING TAU PHOSPHORYLATED AT SERINE 413
20230167168 · 2023-06-01
Assignee
Inventors
- Jeanne E. Baker (Redwood City, CA, US)
- Sophie Parmentier Batteur (Haverford, PA, US)
- Ming-Tang Chen (Dover, MA, US)
- Alan C. Cheng (San Francisco, CA)
- Chung-Ming Hsieh (Newton, MA)
- Carl Mieczkowski (Hercules, CA, US)
- Sokreine Suon (King of Prussia, PA, US)
Cpc classification
A61P25/28
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C07K2317/24
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
A61P25/28
HUMAN NECESSITIES
Abstract
Provided herein are high affinity antibodies or antigen binding fragments thereof that specifically bind to human tau-pS413. Also provided are compositions, kits, methods, and uses involving such antibodies or antigen binding fragments thereof.
Claims
1-33. (canceled)
34. An antibody or antigen binding fragment thereof that binds to tau-pS413, comprising: (a) a heavy chain variable region complementarity determining region 1 (VH-CDR1) comprising the amino acid sequence of SEQ ID NO:41; a heavy chain variable region complementarity determining region 2 (VH-CDR2) comprising the amino acid sequence of SEQ ID NO:42; and a heavy chain variable region complementarity determining region 3 (VH-CDR3) comprising the amino acid sequence of SEQ ID NO:43; and a light chain variable region complementarity determining region 1 (VL-CDR1) comprising the amino acid sequence of SEQ ID NO:29; a light chain variable region complementarity determining region 2 (VL-CDR2) comprising the amino acid sequence of SEQ ID NO:30; and a light chain variable region complementarity determining region 3 (VL-CDR3) comprising the amino acid sequence of SEQ ID NO:31; (b) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; (c) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39; (d) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27; (e) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19; (f) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31; (g) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; (h) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39; (i) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27; (j) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19; (k) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31; (l) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; (m) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39; (n) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27; (o) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19; (p) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31; (q) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; (r) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39; (s) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27; (t) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19; (u) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:21; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:22; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:23; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31; (v) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:21; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:22; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:23; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; (w) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:21; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:22; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:23; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39; (x) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:86; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:87; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:88; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:83; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:84; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:85; (y) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:92; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:93; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:94; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:89; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:90; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:91; (z) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:98; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:99; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:100; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:95; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:96; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:97; (aa) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:104; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:105; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:106; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:101; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:102; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:103; (bb) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO:32; (cc) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; (dd) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40; (ee) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28; (ff) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20; (gg) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32; (hh) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; (ii) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40; (jj) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28; (kk) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20; (ll) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32; (mm) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; (nn) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40; (oo) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28; (pp) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20; (qq) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32; (rr) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; (ss) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40; (tt) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28; (uu) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20; (vv) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:24; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32; (ww) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:24; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; or (xx) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:24; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40.
35. The antibody or antigen-binding fragment of claim 34, comprising: (a) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:44, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:32; (b) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:44, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; (c) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:44, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:40; (d) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:44, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:28; (e) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:44, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:20; (f) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:48, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:32; (g) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:48, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; (h) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:48, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:40; (i) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:48, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:28; (j) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:48, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:20; (k) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:52, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:32; (l) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:52, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; (m) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:52, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:40; (n) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:52, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:28; (o) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:52, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:20; (p) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:32; (q) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; (r) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:40; (s) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:28; (t) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:20; (u) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:24, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:32; (v) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:24, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; or (w) a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:24, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:40.
36. The antibody or antigen binding fragment thereof of claim 34, comprising: (a) a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:32; (b) a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:36; (c) a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:40; (d) a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:28; (e) a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:20; (f) a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:32; (g) a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:36; (h) a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:40; (i) a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:28; (j) a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:20; (k) a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:32; (l) a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:36; (m) a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:40; (n) a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:28; (o) a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:20; (p) a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:32; (q) a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:36; (r) a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:40; (s) a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:28; (t) a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:20; (u) a VH having the amino acid sequence of SEQ ID NO:24, and a VL having the amino acid sequence of SEQ ID NO:32; (v) a VH having the amino acid sequence of SEQ ID NO:24, and a VL having the amino acid sequence of SEQ ID NO:36; or (w) a VH having the amino acid sequence of SEQ ID NO:24, and a VL having the amino acid sequence of SEQ ID NO:40.
37. The antibody or antigen-binding fragment of claim 36, further comprising: (a) a heavy chain constant region having the amino acid sequence of SEQ ID NO:59, 60, 61, 62, 63, 64, 65, 66, 67, or 68; and (b) a light chain constant region having the amino acid sequence of SEQ ID NO:57 or 58.
38. An antibody or antigen binding fragment thereof that binds to tau-pS413, comprising (a) a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; or (b) a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36.
39. An antibody or antigen binding fragment thereof that binds to tau-pS413, comprising a VH comprising the amino acid sequence of SEQ ID NO:56 and a VL comprising the amino acid sequence of SEQ ID NO:36.
40. The antibody of claim 38, comprising: (a) a light chain comprising the amino acid sequence of SEQ ID NO:71 and a heavy chain comprising the amino acid sequence of SEQ ID NO:72; (b) a light chain comprising the amino acid sequence of SEQ ID NO:73 and a heavy chain comprising the amino acid sequence of SEQ ID NO:74; or (c) a light chain comprising the amino acid sequence of SEQ ID NO:75 and a heavy chain comprising the amino acid sequence of SEQ ID NO:76.
41. The antibody or antigen binding fragment thereof of claim 34, having an equilibrium dissociation constant (KD) of 1×10.sup.−8 M or less, 9×10.sup.−9 M or less, 8×10.sup.−9 M or less, 7×10.sup.−9 M or less, 6×10.sup.−9 M or less, 5×10.sup.−9 M or less, 4×10.sup.−9 M or less, 3×10.sup.−9 M or less, or 2×10.sup.−9 M or less, for tau-pS413.
42. The antibody or antigen binding fragment thereof of claim 41, having an KD of 2×10.sup.−9 M or less for tau-pS413.
43. The antibody or antigen binding fragment thereof of claim 42, wherein the KD is measured by Biacore with the antibody or antigen binding fragment thereof being immobilized.
44. An isolated nucleic acid, encoding: (a) the VH of the antibody or antigen binding fragment thereof of claim 36; (b) the VL of the antibody or antigen binding fragment thereof of claim 36; (c) the VH and the VL of the antibody or antigen binding fragment thereof of claim 36; (d) the heavy chain of the antibody or antigen binding fragment thereof of claim 36; (e) the light chain of the antibody or antigen binding fragment thereof of claim 36; or (f) the heavy chain and the light chain of the antibody or antigen binding fragment thereof of claim 36.
45. An expression vector comprising the isolated nucleic acid of claim 44.
46. A host cell comprising the expression vector of claim 45.
47. A method of producing an antibody or antigen binding fragment thereof, comprising: (a) culturing the host cell of claim 46 under conditions wherein the antibody or antigen binding fragment thereof is expressed; and (b) harvesting the antibody or antigen binding fragment thereof.
48. A composition comprising the antibody or antigen binding fragment thereof of claim 34, and a pharmaceutically acceptable carrier.
49. A method of treating tauopathy in a subject, comprising administering to the subject an effective amount of the antibody or antigen binding fragment thereof of claim 34.
50. The method of claim 49, wherein the tauopathy is Alzheimer's disease, corticobasal degeneration, progressive supranuclear palsy, Pick's disease, argyrophilic grain dementia (argyrophilic grain disease), multiple system tauopathy with presenile dementia (MSTD), frontotemporal dementia and parkinsonism linked to chromosome 17 (FTDP-17), dementia with neurofibrillary tangles, diffuse neurofibrillary tangle with calcification (DNTC), white matter tauopathy with globular glial inclusions (WMT-GGI), frontotemporal lobar degeneration with tau pathology (FTLD-tau), Economo's encephalitis sequela, subacute sclerosing panencephalitis, or boxer's encephalopathy.
51. A method of decreasing the amount of tau-pS413 in the brain of a subject, comprising administering to the subject in need thereof an effective amount of the antibody or antigen binding fragment thereof of claim 34.
52. The method of claim 50, further comprising administering to the subject an additional agent.
53. The method of claim 52, wherein the additional agent is selected from the group consisting of cholinesterase inhibitors, donepezil, galantamine, rovastigmine, tacrine, NMDA receptor antagonists, memantine, amyloid beta peptide aggregation inhibitors, antioxidants, gamma-secretase modulators, nerve growth factor (NGF) mimics or NGF gene therapy, PPARγ agonists, HMS-CoA reductase inhibitors, statins, ampakines, calcium channel blockers, GABA receptor antagonists, glycogen synthase kinase inhibitors, intravenous immunoglobulin, muscarinic receptor agonists, nicotinic receptor modulators, active or passive amyloid beta peptide for immunization, phosphodiesterase inhibitors, serotonin receptor antagonists, anti-amyloid beta peptide antibodies, growth hormone, neurotrophic factor, brain-derived neurotrophic factor (BDNF), nerve growth factor (NGF), neurotrophin-4/5, fibroblast growth factor (FGF)-2 and other FGFs, neurotrophin (NT)-3, erythropoietin (EPO), hepatocyte growth factor (HGF), epidermal growth factor (EGF), transforming growth factor (TGF)-alpha, TGF-beta, vascular endothelial growth factor (VEGF), interleukin-1 receptor antagonist (IL-lra), ciliary neurotrophic factor (CNTF), glial-derived neurotrophic factor (GDNF), neurturin, platelet-derived growth factor (PDGF), heregulin, neuregulin, artemin, persephin, interleukins, glial cell line derived neurotrophic factor (GFR), granulocyte-colony stimulating factor (CSF), granulocyte-macrophage-CSF, netrins, cardiotrophin-1, hedgehogs, leukemia inhibitory factor (LIF), midkine, pleiotrophin, bone morphogenetic proteins (BMPs), netrins, saposins, semaphorins, stem cell factor (SCF), or a different anti-tau antibody, or a combination thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0140]
[0141]
[0142]
[0143]
[0144]
[0145]
[0146]
DETAILED DESCRIPTION
[0147] Abbreviations
[0148] Throughout the detailed description and examples of the invention the following abbreviations will be used: [0149] ADCC Antibody-dependent cellular cytotoxicity [0150] CDC Complement-dependent cytotoxicity [0151] CDR Complementarity determining region in the immunoglobulin variable regions [0152] CHO Chinese hamster ovary [0153] EC50 concentration resulting in 50% efficacy or binding [0154] ELISA Enzyme-linked immunosorbent assay [0155] FR Antibody framework region: the immunoglobulin variable regions excluding the CDR regions. [0156] IC50 concentration resulting in 50% inhibition [0157] IgG Immunoglobulin G [0158] Kabat An immunoglobulin alignment and numbering system pioneered by Elvin A. Kabat ((1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.) [0159] mAb Monoclonal antibody [0160] PK Pharmacokinetics [0161] V region The segment of IgG chains which is variable in sequence between different antibodies. It extends to Kabat residue 109 in the light chain and 113 in the heavy chain. [0162] VH Immunoglobulin heavy chain variable region [0163] VL Immunoglobulin light chain variable region
Definitions
[0164] So that the invention may be more readily understood, certain technical and scientific terms are specifically defined below. Unless specifically defined elsewhere in this document, all other technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which this invention belongs.
[0165] As used herein, including the appended claims, the singular forms of words such as “a,” “an,” and “the,” include their corresponding plural references unless the context clearly dictates otherwise. Similarly, the plural forms of words include their corresponding singular references unless the context clearly indicates otherwise.
[0166] The term “tau protein,” when used in the context of human species, refers to six isoforms of human tau protein having the amino acid sequences defined in SEQ ID NOs:1 to 6, i.e., 4R2N (defined in SEQ ID NO:1), 4R1N (defined in SEQ ID NO:2), 4R0N (defined in SEQ ID NO:3), 3R2N (defined in SEQ ID NO:4), 3R1N (defined in SEQ ID NO:5), and 3R0N (defined in SEQ ID NO:6), as well as gene variants thereof. The tau protein according to the present invention also encompasses proteins having similarities or identities of 80% or more to the amino acid sequence of the human tau protein defined in SEQ ID NO:1 in accordance with the BLAST method (with default conditions of PBLAST provided by NCBI) and their isoforms. Such tau proteins also include tau derived from non-human species, such as chimpanzees, macaques, horses, pigs, dogs, mice, rabbits, and rats. It is possible to produce a therapeutic or prophylactic agent targeted to tau derived from such a non-human animal for the purpose of improving the cognitive function of the target animal.
[0167] The term “tau peptide” used herein means a peptide including a part of the amino acid sequence of a tau protein. The position of the tau peptide derived from a tau protein should not be limited. The length of the tau peptide should also not be limited, but should preferably have an amino acid length of four or more, particularly six or more, more particularly eight or more.
[0168] The term “tau” used herein means a tau protein or a tau peptide collectively. In the context of the present invention, the position of an amino acid residue in a tau protein or a tau peptide is indicated by an amino acid number, which is identified based on the amino acid sequence defined in SEQ ID NO:1 for clarification. For example, “serine 413,” “Ser413,” or “S413” refers to the amino acid residue corresponding to Ser413 of SEQ ID NO:1, including the serine residue at amino acid position 413 of SEQ ID NO:1 (4R2N), amino acid position 384 of SEQ ID NO:2 (4R1N), amino acid position 355 of SEQ ID NO:3 (4R0N), amino acid position 382 of SEQ ID NO:4 (3R2N), amino acid position 353 of SEQ ID NO:5 (3R1N), or amino acid position 324 of SEQ ID NO:6 (3R0N). Correspondence of the positions of amino acid residues between tau isoforms is shown in TABLE 1 below.
TABLE-US-00001 TABLE 1 Isoforms of human tau protein Isoform 4R2N 4R1N 4R0N 3R2N 3R1N 3R0N Sequence SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID Amino acid NO: 1 NO: 2 NO: 3 NO: 4 NO: 5 NO: 6 residue Amino acid position/number Asn 410 381 352 379 350 321 Val 411 382 353 380 351 322 Ser 412 383 354 381 352 323 Ser 413 384 355 382 353 324 Thr 414 385 356 383 354 325 Gly 415 386 357 384 355 326 Ser 416 387 358 385 356 327 Ile 417 388 359 386 357 328 Asp 418 389 360 387 358 329 Met 419 390 361 388 359 330 Val 420 391 362 389 360 331 Asp 421 392 363 390 361 332
[0169] While TABLE 1 shows the positions of amino acid residues of the recited isoforms corresponding to positions 410 to 421 of the amino acid sequence defined in SEQ ID NO:1, correspondence of the positions of amino acid residues in other regions can easily be recognized based on, e.g.,
[0170] The statement that an amino acid residue is “phosphorylated” as used herein means that a phosphate group is ester-linked to the side chain of the amino acid residue. Typical amino acid residues that may be phosphorylated include serine (Ser), threonine (Thr), and tyrosine (Tyr).
[0171] The term “tau-pS413,” “tau-PS413,” “tau-pSer413,” “pS413-tau,” “PS413-tau,” or “pSer413-tau,” as used herein, refers to a tau protein or peptide that is phosphorylated at the amino acid residue corresponding to Ser413 of SEQ ID NO:1, including the serine residue at amino acid position 413 of SEQ ID NO:1 (4R2N), amino acid position 384 of SEQ ID NO:2 (4R1N), amino acid position 355 of SEQ ID NO:3 (4R0N), amino acid position 382 of SEQ ID NO:4 (3R2N), amino acid position 353 of SEQ ID NO:5 (3R1N), or amino acid position 324 of SEQ ID NO:6 (3R0N). In some embodiments, tau-pS413 is phosphorylated only at 5413. In certain embodiments, tau-pS413 is phosphorylated at 5413 and one or more additional amino acid residues.
[0172] “Anti-tau-pS413 antibody” as used herein refers to an antibody that specifically binds to a tau-pS413 protein or a tau-pS413 peptide.
[0173] Each of the term “V1-AFM,” “V2-AFM,” “V3-AFM,” “V4-AFM,” “V5-AFM,” “V6-AFM,” “V7-AFM,” or “V8-AFM,” as used herein, refers to an affinity matured variant of HmzTa1505-hIgG4-S228P as described herein, comprising the defined VH and VL as described in TABLE 4, with SEQ ID NOs disclosed in TABLES 5 and 6. Each term encompasses antibodies with any one of known heavy chain constant region (e.g., IgG1, IgG1-LALA, IgG1-LALA-YTE, IgG2, IgG3, IgG4, IgG4-S228P, etc.) or variant thereof and any one of known light chain constant region (e.g., lambda or kappa) or variant thereof.
[0174] The terms “binds” or “binding” refer to an interaction between molecules including, for example, to form a complex. Interactions can be, for example, non-covalent interactions including hydrogen bonds, ionic bonds, hydrophobic interactions, and/or van der Waals interactions. A complex can also include the binding of two or more molecules held together by covalent or non-covalent bonds, interactions, or forces. The strength of the total non-covalent interactions between a single antigen-binding site on an antibody and a single epitope of a target molecule, such as tau, is the “affinity” of the antibody or functional fragment for that epitope or target. Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The ratio of dissociation rate (k.sub.off) to association rate (k.sub.on) of an antibody to a monovalent antigen (k.sub.off/k.sub.on) is the “dissociation constant” (or “equilibrium dissociation constant” as used interchangeably) KD, which is inversely related to affinity. The lower the KD value, the higher the affinity of the antibody. The value of KD varies for different complexes of antibody and antigen and depends on both k.sub.on and k.sub.off. The dissociation constant KD for an antibody provided herein can be determined using any method provided herein or any other method well known to those skilled in the art, such as surface plasmon resonance (SPR) assay, including but not limited to Biacore and KinExA. The affinity at one binding site does not always reflect the true strength of the interaction between an antibody and an antigen. When complex antigens containing multiple, repeating antigenic determinants, such as a polyvalent antigen, come in contact with antibodies containing multiple binding sites, the interaction of antibody with antigen at one site will increase the probability of a reaction at a second site. The strength of such multiple interactions between a multivalent antibody and antigen is called the “avidity.” The avidity of an antibody can be a better measure of its binding capacity than is the affinity of its individual binding sites. For example, high avidity can compensate for low affinity as is sometimes found for pentameric IgM antibodies, which can have a lower affinity than IgG, but the high avidity of IgM, resulting from its multivalence, enables it to bind antigen effectively. Unless indicated otherwise, the term “affinity” or “binding affinity” as used herein refers to monovalent (1:1) interaction between an anti-tau-pS413 antibody and a tau-pS413 protein or peptide. The KD can be measured using SPR with either the anti-tau-pS413 antibody or tau-pS413 immobilized. The KD values disclosed in this specification are measured with the anti-tau-pS413 antibody immobilized.
[0175] The terms “antibodies that specifically bind to tau-pS413,” “antibodies that specifically bind to a tau-pS413 protein or peptide,” and analogous terms are used interchangeably herein and refer to antibodies that specifically bind to a tau-pS413 polypeptide, such as a tau-pS413 protein or peptide (e.g., human tau-pS413 such as a human tau-pS413 protein or peptide). An antibody that specifically binds to tau-pS413 (e.g., human tau-pS413) may be cross-reactive with tau-pS413 derived from another species (e.g., cynomolgus tau-pS413). In certain embodiments, an antibody that specifically binds to tau-pS413 does not cross-react with other [tau] proteins or peptides, such as a tau protein or peptide that is not phosphorylated at S413 or a tau protein or peptide that is phosphorylated at another amino acid residue other than S413. An antibody that specifically binds to tau-pS413 can be identified, for example, by immunoassays, Biacore, or other techniques known to those of skill in the art. An antibody binds specifically to tau-pS413 when it binds to tau-pS413 with higher affinity than to any cross-reactive protein or peptide as determined using experimental techniques, such as radioimmunoassays (MA) and enzyme linked immunosorbent assays (ELISAs). Typically, a specific reaction will be at least twice background signal or noise and may be more than 10 times background. See, e.g., Fundamental Immunology 332-36 (Paul ed., 2d ed. 1989) for a discussion regarding antibody specificity. With regard to the binding of an antibody to a target molecule, the term “specific binding,” “specifically binds to,” or “is specific for” a particular polypeptide or an epitope on a particular polypeptide target means binding that is measurably different from a non-specific interaction. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule, which generally is a molecule of similar structure that does not have binding activity. For example, specific binding to a target can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target.
[0176] “Administrating” or “administration,” as it applies to an animal, human, subject, cell, tissue, organ, or biological fluid, refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal, human, subject, cell, tissue, organ, or biological fluid.
[0177] The term “subject” includes any organism, preferably an animal, more preferably a mammal (e.g., human, rat, mouse, dog, cat, or rabbit). In a preferred embodiment, the term “subjects” refers to a human.
[0178] The term “antibody,” “immunoglobulin,” or “Ig” is used interchangeably herein, and is used in the broadest sense and specifically encompasses, for example, individual monoclonal antibodies (including neutralizing antibodies, full length or intact monoclonal antibodies), antibody compositions with polyepitopic or monoepitopic specificity, polyclonal or monovalent antibodies, multivalent antibodies, multispecific antibodies (e.g., bispecific antibodies so long as they exhibit the desired biological activity), formed from at least two intact antibodies, single chain antibodies, and fragments of the antibodies, as described below. An antibody can be human, humanized, chimeric and/or affinity matured, as well as an antibody from other species, for example, mouse and rabbit, etc. Antibodies also include, but are not limited to, synthetic antibodies, recombinantly produced antibodies, camelized antibodies, intrabodies, anti-idiotypic (anti-Id) antibodies, and functional fragments (e.g., antigen-binding fragments thereof) of any of the above, which refers to a portion of an antibody heavy or light chain polypeptide that retains some or all of the binding activity of the antibody from which the fragment was derived. Non-limiting examples of functional fragments (e.g., antigen-binding fragments thereof) include single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), Fab fragments, F(ab′) fragments, F(ab).sub.2 fragments, F(ab′).sub.2 fragments, disulfide-linked Fvs (dsFv), Fd fragments, Fv fragments, diabody, triabody, tetrabody, and minibody. In particular, antibodies provided herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, for example, antigen-binding domains or molecules that contain an antigen-binding site that binds to a tau-pS413 protein or peptide (e.g., one or more CDRs of an anti-tau-pS413 antibody). Such antibody fragments can be found in, for example, Harlow and Lane, Antibodies: A Laboratory Manual (1989); Mol. Biology and Biotechnology: A Comprehensive Desk Reference (Myers ed., 1995); Huston et al., 1993, Cell Biophysics 22:189-224; Pluckthun and Skerra, 1989, Meth. Enzymol. 178:497-515; and Day, Advanced Immunochemistry (2d ed. 1990). The antibodies provided herein can be of any class (e.g., IgG, IgE, IgM, IgD, and IgA) or any subclass (e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2) of immunoglobulin molecule.
[0179] A “Fab fragment” is comprised of one light chain and the C.sub.H1 and variable regions of one heavy chain. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule. An “Fab fragment” can be the product of papain cleavage of an antibody.
[0180] An “Fc” region contains two heavy chain fragments comprising the C.sub.H1 and C.sub.H2 domains of an antibody. The two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the C.sub.H3 domains.
[0181] A “Fab′ fragment” contains one light chain and a portion or fragment of one heavy chain that contains the VH domain and the C.sub.H1 domain and also the region between the C.sub.H1 and C.sub.H2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab′ fragments to form a F(ab′).sub.2 molecule.
[0182] A “F(ab′).sub.2 fragment” contains two light chains and two heavy chains containing a portion of the constant region between the C.sub.H1 and C.sub.H.sup.2 domains, such that an interchain disulfide bond is formed between the two heavy chains. A F(ab′).sub.2 fragment thus is composed of two Fab′ fragments that are held together by a disulfide bond between the two heavy chains. An “F(ab′).sub.2 fragment” can be the product of pepsin cleavage of an antibody.
[0183] An “Fv fragment” or “Fv region” comprises the variable regions from both the heavy and light chains, but lacks the constant regions.
[0184] The term “monoclonal antibody,” as used herein, refers to a population of substantially homogeneous antibodies, i.e., the antibody molecules comprising the population are identical in amino acid sequence except for possible naturally occurring mutations that may be present in minor amounts. In contrast, conventional (polyclonal) antibody preparations typically include a multitude of different antibodies having different amino acid sequences in their variable domains that are often specific for different epitopes. The modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256: 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). The “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991) Nature 352: 624-628 and Marks et al. (1991) J. Mol. Biol. 222: 581-597, for example. See also Presta (2005) J. Allergy Clin. Immunol. 116:731.
[0185] As used herein, the term “humanized antibody” refers to forms of antibodies that contain sequences from both human and non-human (e.g., murine, rat) antibodies. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the framework (FR) regions are those of a human immunoglobulin sequence. The humanized antibody may optionally comprise at least a portion of a human immunoglobulin constant region (Fc).
[0186] In general, the basic antibody structural unit comprises a tetramer. Each tetramer includes two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function.
[0187] “Effector functions” refer to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: Clq binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
[0188] Typically, human light chains are classified as kappa and lambda light chains. Furthermore, human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).
[0189] “Variable region,” “variable domain,” or “V region” or “V chain” as used herein means the segment of IgG chains which is variable in sequence between different antibodies. A “variable region” of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination. The variable region of the heavy chain may be referred to as “VH.” The variable region of the light chain may be referred to as “VL.” Typically, the variable regions of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), which are located within relatively conserved framework regions (FR). The CDRs are usually aligned by the framework regions, enabling binding to a specific epitope. In general, from N-terminal to C-terminal, both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. The assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5th ed.; NIH Publ. No. 91-3242 (1991) (“Kabat 1”); Kabat (1978) Adv. Prot. Chem. 32:1-75 (“Kabat 2”); Kabat, et al., (1977) J. Biol. Chem. 252:6609-6616 (“Kabat 3”); Chothia, et al., (1987) J Mol. Biol. 196:901-917 (“Chothia 1”) or Chothia, et al., (1989) Nature 342:878-883 (“Chothia 2”).
[0190] A “CDR” refers to one of three hypervariable regions (H1, H2, or H3) within the non-framework region of the antibody V.sub.H β-sheet framework, or one of three hypervariable regions (L1, L2, or L3) within the non-framework region of the antibody V.sub.L β-sheet framework. Accordingly, CDRs are variable region sequences interspersed within the framework region sequences. CDR regions are well known to those skilled in the art and have been defined by, for example, Kabat as the regions of most hypervariability within the antibody variable domains (see Kabat 1-3, supra). CDR region sequences also have been defined structurally by Chothia as those residues that are not part of the conserved β-sheet framework, and thus are able to adapt to a different conformation (see Chothia 1-2, supra). Both Kabat and Chothia methodologies for defining CDR sequences within antibody variable regions are well recognized in the art. CDR region sequences have also been defined by AbM, Contact, and IMGT. The positions of CDRs within a canonical antibody variable region have been determined by comparison of numerous structures (Al-Lazikani et al., 1997, J. Mol. Biol. 273:927-48; Morea et al., 2000, Methods 20:267-79). Because the number of residues within a hypervariable region varies in different antibodies, additional residues relative to the canonical positions are conventionally numbered with a, b, c and so forth next to the residue number in the canonical variable region numbering scheme (Al-Lazikani et al., supra). Such nomenclature is similarly well known to those skilled in the art. Correspondence between the numbering system, including, for example, the Kabat numbering and the IMGT unique numbering system, is well known to one skilled in the art and shown below in TABLE 2. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system. In yet still other embodiments, the CDRs are as defined by any numbering system that is known to those skilled in the art.
TABLE-US-00002 TABLE 2 Correspondence of Amino Acid Positions Between CDR Numbering Systems IMGT Rabat AbM Chothia Contact V.sub.H CDR1 27-38 31-35 26-35 26-32 30-35 V.sub.H CDR2 56-65 50-65 50-58 52-56 47-58 V.sub.H CDR3 105-117 95-102 95-102 95-102 93-101 V.sub.L CDR1 27-38 24-34 24-34 24-34 30-36 V.sub.L CDR2 56-65 50-56 50-56 50-56 46-55 V.sub.L CDR3 105-117 89-97 89-97 89-97 89-96
[0191] “Conservatively modified variants” or “conservative substitution” refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity of the protein. Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987) Molecular Biology of the Gene, The Benjamin/Cummings Pub. Co., p. 224 (4th Ed.)). In addition, substitutions of structurally or functionally similar amino acids are less likely to disrupt biological activity. Exemplary conservative substitutions are set forth in TABLE 3.
TABLE-US-00003 TABLE 3 Exemplary Conservative Amino Acid Substitutions Original residue Conservative substitution Ala (A) Gly; Ser Arg (R) Lys; His Asn (N) Gln; His Asp (D) Glu; Asn Cys (C) Ser; Ala Gln (Q) Asn Glu (E) Asp; Gln Gly (G) Ala His (H) Asn; Gln Ile (I) Leu; Val Leu (L) Ile; Val Lys (K) Arg; His Met (M) Leu; Ile; Tyr Phe (F) Tyr; Met; Leu Pro (P) Ala Ser (S) Thr Thr (T) Ser Trp (W) Tyr; Phe Tyr (Y) Trp; Phe Val (V) Ile; Leu
[0192] The term “epitope,” as used herein, is defined in the context of a molecular interaction between an “antigen binding molecule,” such as an antibody (Ab), and its corresponding “antigen” (Ag). Generally, “epitope” refers to the area or region on an Ag to which an Ab specifically binds, i.e. the area or region in physical contact with the Ab. Physical contact may be defined through distance criteria (e.g. a distance cut-off of 4 Å) for atoms in the Ab and Ag molecules. Epitopes may be linear epitopes or conformational epitopes. Linear epitopes are formed by a continuous sequence of amino acids in a protein. Conformational epitopes are formed of amino acids that are discontinuous in the protein sequence, but which are brought together upon folding of the protein into its three-dimensional structure. Induced epitopes are formed when the three-dimensional structure of the protein is in an altered conformation, such as following activation or binding of another protein or ligand.
[0193] “Isolated nucleic acid” means a DNA or RNA polynucleotide of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature. Isolated nucleic acid molecules “comprising” specified nucleic acid sequences may include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty or more other proteins or portions or fragments thereof, or may include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or may include vector sequences or non-coding sequences.
[0194] The phrase “control sequences” refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to use promoters, polyadenylation signals, and enhancers.
[0195] A nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, “operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
[0196] As used herein, the expressions “cell,” “host cell,” “cell line,” and “cell culture” are used interchangeably and all such designations include progeny.
[0197] “Treat” or “treatment” means to administer an agent, such as a composition containing any of the antibodies or antigen binding fragments thereof of the present invention, internally or externally to a subject or patient having one or more disease symptoms, or being suspected of having a disease, for which the agent has therapeutic activity. Typically, the agent is administered in an amount effective to alleviate one or more disease symptoms in the treated subject or population, whether by inducing the regression of or inhibiting, delaying or slowing the progression of such symptom(s) by any clinically measurable degree. The amount of an agent that is effective to alleviate any particular disease symptom may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the drug to elicit a desired response in the subject. Whether a disease symptom has been alleviated can be assessed by any clinical measurement typically used by physicians or other skilled healthcare providers to assess the severity or progression status of that symptom. The term further includes a postponement of development of the symptoms associated with a disorder and/or a reduction in the severity of the symptoms of such disorder. The terms further include ameliorating existing uncontrolled or unwanted symptoms, preventing additional symptoms, and ameliorating or preventing the underlying causes of such symptoms. Thus, the terms denote that a beneficial result has been conferred on a vertebrate subject with a disorder, disease or symptom, or with the potential to develop such a disorder, disease or symptom.
Tau-pS413
[0198] Tau is a protein encoded by the MAPT gene, which is located on chromosome 17 (17q21) in the human genome. The tau protein is one of the microtubule-binding proteins abundantly expressed in the central nervous system. The tau protein has been found to be a major constituent protein in the paired helical filaments and straight filaments forming NFT in AD, one of the most prominent neurodegenerative diseases, and its intracellular accumulation has been demonstrated in a variety of neuropathological conditions. The diseases caused by such intracellular accumulation of tau are collectively referred to as “tauopathies” (Tetsuaki Arai, “Shinkei Naika” (Japanese document), Vol. 72, special number, (Suppl. 6), 2010, pp. 46-51). Tauopathies include neurodegenerative diseases such as Alzheimer's disease (AD), corticobasal degeneration (CBD) or corticobasal syndrome (CBS), progressive supranuclear palsy, Pick's disease, argyrophilic grain dementia (argyrophilic grain disease), multiple system tauopathy with dementia (MSTD), chromosome 17-linked frontotemporal dementia with Parkinsonism (FTDP-17), neurofibrillary tangle dementia, diffuse neurofibrillary tangles with calcification (DNTC), white matter tauopathy with globular glial inclusions (WMT-GGI), frontotemporal lobar degeneration with tau-positive inclusions (FTLD-tau). Tauopathies also include non-neurodegenerative diseases including: infectious diseases such as Economo's encephalitis sequela and subacute sclerosing panencephalitis; and trauma-induced conditions such as boxer's encephalopathy (Tetsuaki Arai, “Shinkei Naika” (Japanese document), Vol. 72, special number, (Suppl. 6), 2010, pp. 46-51).
[0199] The MAPT gene has been identified as consisting of 13 exons disposed on the genome, which can be expressed as multiple different protein isoforms via alternative splicing (Tetsuaki Arai, “Shinkei Naika” (Japanese document), Vol. 72, special number, (Suppl. 6), 2010, pp. 46-51). The structure of tau comprises an N-terminal acidic domain containing 0-2 repetitive sequences (N) of 29 amino acids depended on alternative splicing of exon 2 and exon 3 (N0-N2), an intermediate domain rich in proline, and a C-terminal microtubule-binding domain (encoded by exons 9 to 12) containing 3 (3R) or 4 (4R) repetitive sequences (R) that contribute to microtubule binding (Alistair Burns et al. (Edit.), Dementia, 3rd Edition, 2005, CRC Press, pp. 408-464; Tetsuaki Arai, “Shinkei Naika” (Japanese document), Vol. 72, special number, (Suppl. 6), 2010, pp. 46-51). Therefore, human tau has six representative isoforms: 3R0N (352 amino acids), 3R1N (381 amino acids), 3R2N (410 amino acids), 4R0N (383 amino acids), 4R1N (412 amino acids), and 4R2N (441 amino acids), depending on the number of 29 amino acid repetitive sequences (N) and microtubule-binding repetitive sequences (R) that it contains. In order to unambiguously identify the position of an amino acid residue in any of these tau isoforms, the amino acid numbers (1 to 441) of the longest isoform, i.e., 4R2N (defined in SEQ ID NO:1), are used as a reference herein. For example, “Ser413” refers to the serine residue at the 413th amino acid position in 4R2N (defined in SEQ ID NO:1), which corresponds to the serine at the 384th amino acid position in 4R1N (defined in SEQ ID NO:2), the 355th amino acid position in 4R0N (defined in SEQ ID NO:3), the 382nd amino acid position in 3R2N (defined in SEQ ID NO:4), the 353rd amino acid position in 3R1N (defined in SEQ ID NO:5), and the 324th amino acid position in 3R0N (defined in SEQ ID NO:6).
[0200] In addition, tau accumulated in neurodegenerative diseases is characterized by being highly modified via phosphorylation. In patients exhibiting mild cognitive impairment, a correlation is observed between the level of phosphorylated tau in the spinal fluid and the degree of pituitary atrophy, suggesting phosphorylated tau as a highly reliable biomarker for neurodegeneration in patients with tauopathy (Wendy Noble et al., Expert Opinion on Drug Discovery, 2011, Vol. 6, No. 8, pp. 797-810). However, there are a large number of sites which can be phosphorylated in tau, while virtually no information exists regarding which antibodies for which phosphorylation sites are effective to treat tauopathy.
[0201] Furthermore, when using an antibody as an active compound for a therapeutic or prophylactic agent, it is necessary to consider the amount of the antibody to be administered in patients, in order to avoid side effects and minimize problems such as, immunogenicity, manufacture capacity, and medical cost. This is especially important in relation to doses for chronic diseases or genetic diseases. In addition, while the brain is the target organ to be treated in cognitive disorders such as AD, systemic administration by intravenous or subcutaneous routes is generally thought to result in a low migration rate of antibodies from the blood to the brain, due to the presence of the blood-brain barrier. Accordingly, there is a significant problem that antibodies used for treatment of cognitive disorders are expected to require high dosages, compared to treatment for diseases involving other organs. Thus, against the backdrop of these challenges, it is particularly unexpected and surprising for the inventors to have generated high affinity anti-tau-pS413 antibodies that can achieve sufficient therapeutic effects without affecting non-pathological tau or having to be administered at very high dosages.
High Affinity Anti-Tau-pS413 Antibodies or Antigen Binding Fragments Thereof
[0202] Previous disclosures of anti-tau-pS413 antibodies include WO 2013/180238 and WO 2018/254390, the entirety of which disclosures are incorporated by reference herein. Distinct from the prior disclosures, the present invention provides higher affinity anti-tau-pS413 antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof. These high affinity anti-tau-pS413 antibodies or antigen binding fragments thereof show increased binding potency compared to previously disclosed anti-tau-pS413 antibodies (e.g., at least 10- to 40-fold increase) to recombinant tau-pS413 protein or peptide, tau transgenic mouse brains, AD patients' brain homogenates, and AD patients' CSF samples. Such high affinity antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof can also effectively prevent the development of tau pathology in hu-iPSC neurons induced by seeding of AD brain homogenates.
[0203] In this disclosure, optimized (e.g., higher affinity) versions of the previously disclosed anti-tau-pS413 antibodies were obtained by affinity maturation to improve potency or by structure-based modeling to identify one or more amino acid mutations (e.g., K54E or K54D) that lowers pI (isoelectric point), improves affinity, and increases production of the antibody molecule. In some embodiments, the optimized (e.g., higher affinity) anti-tau-pS413 antibodies can be obtained by affinity maturation. In certain embodiments, the optimized (e.g., higher affinity) anti-tau-pS413 antibodies can be obtained by structure-based modeling to identify one or more amino acid mutations (e.g., K54E or K54D) that lowers pI, improves affinity, and increases production of the antibody molecule. In other embodiments, the optimized (e.g., higher affinity) anti-tau-pS413 antibodies can be obtained by affinity maturation and structure-based modeling to identify one or more amino acid mutations (e.g., K54E or K54D) that lowers pI, improves affinity, and increases production of the antibody molecule. In additional embodiments, the heavy chain constant region of the optimized (e.g., higher affinity) anti-tau-pS413 antibodies is switched from IgG4-S228P isotype to IgG1-LALA to improve colloidal stability and lower viscosity while maintaining reduced Fc effector function. In further embodiments, a half-life extension YTE mutation is integrated into the Fc region to increase half-life of the optimized (e.g., higher affinity) anti-tau-pS413 antibodies. In yet other embodiments, the heavy chain constant region of the optimized (e.g., higher affinity) anti-tau-pS413 antibodies is switched from IgG4-S228P isotype to IgG1-LALA and a half-life extension YTE mutation is integrated into the Fc region. In a preferred embodiment, an optimized (e.g., higher affinity) anti-tau-pS413 antibody (e.g., V1-AFM-hIgG1-LALA-YTE, V2-AFM-hIgG1-LALA-YTE, V3-AFM-hIgG1-LALA-YTE, V4-AFM-hIgG1-LALA-YTE, V5-AFM-hIgG1-LALA-YTE, V6-AFM-hIgG1-LALA-YTE, V7-AFM-hIgG1-LALA-YTE, or V8-AFM-hIgG1-LALA-YTE) is obtained by 1) affinity maturation, 2) structure-based modeling to identify a mutation (e.g., K54E or K54D) that lowers pI, improves affinity, and increases production of the antibody molecule, 3) switching isotype to IgG1-LALA to improve colloidal stability and lower viscosity while maintaining reduced Fc effector function, and 4) integrating a YTE mutation into the Fc region to extend half-life.
[0204] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31.
[0205] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35.
[0206] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39.
[0207] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27.
[0208] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19.
[0209] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31.
[0210] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35.
[0211] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39.
[0212] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27.
[0213] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19.
[0214] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31.
[0215] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35.
[0216] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39.
[0217] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27.
[0218] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19.
[0219] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31.
[0220] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35.
[0221] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39.
[0222] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27.
[0223] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19.
[0224] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:21; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:22; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:23; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31.
[0225] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:21; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:22; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:23; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35.
[0226] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:21; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:22; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:23; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39.
[0227] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:86; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:87; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:88; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:83; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:84; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:85.
[0228] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:92; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:93; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:94; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:89; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:90; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:91.
[0229] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:98; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:99; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:100; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:95; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:96; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:97.
[0230] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:104; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:105; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:106; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:101; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:102; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:103.
[0231] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0232] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0233] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0234] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0235] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0236] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0237] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0238] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0239] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0240] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0241] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0242] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0243] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0244] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0245] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0246] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0247] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0248] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0249] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0250] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0251] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:24; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0252] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:24; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0253] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:24; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40. In some embodiments, the CDRs are as defined by the Kabat numbering system. In other embodiments, the CDRs are as defined by the IMGT numbering system. In yet other embodiments, the CDRs are as defined by the AbM numbering system. In still other embodiments, the CDRs are as defined by the Chothia numbering system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
[0254] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:44, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:32.
[0255] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:44, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36.
[0256] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:44, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:40.
[0257] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:44, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:28.
[0258] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:44, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:20.
[0259] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:48, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:32.
[0260] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:48, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36.
[0261] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:48, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:40.
[0262] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:48, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:28.
[0263] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:48, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:20.
[0264] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:52, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:32.
[0265] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:52, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36.
[0266] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:52, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:40.
[0267] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:52, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:28.
[0268] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:52, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:20.
[0269] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:32.
[0270] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36.
[0271] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:40.
[0272] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:28.
[0273] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:20.
[0274] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:24, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:32.
[0275] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:24, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36.
[0276] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:24, and a VL having at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:40.
[0277] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:32.
[0278] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:36.
[0279] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:40.
[0280] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:28.
[0281] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:20.
[0282] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:32.
[0283] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:36.
[0284] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:40.
[0285] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:28.
[0286] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:20.
[0287] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:32.
[0288] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:36.
[0289] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:40.
[0290] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:28.
[0291] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:20.
[0292] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:32.
[0293] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:36.
[0294] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:40.
[0295] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:28.
[0296] In still another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:20.
[0297] In one embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:24, and a VL having the amino acid sequence of SEQ ID NO:32.
[0298] In another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:24, and a VL having the amino acid sequence of SEQ ID NO:36.
[0299] In yet another embodiment, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH having the amino acid sequence of SEQ ID NO:24, and a VL having the amino acid sequence of SEQ ID NO:40.
[0300] In various embodiments of the antibody or antigen-binding fragment thereof that binds to tau-pS413 disclosed herein, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:59, 60, 61, 62, 63, 64, 65, 66, 67, or 68. In one embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:59. In another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:60. In yet another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:61. In still another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:62. In one embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:63. In another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:64. In yet another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:65. In still another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:66. In one embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:67. In another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:68. In certain embodiments, the lysine residue at the C-terminus of the heavy chain constant region is present. In other embodiments, the lysine residue at the C-terminus of the heavy chain constant region is absent.
[0301] In certain embodiments, the antibody or antigen-binding fragment thereof further comprises a light chain constant region having the amino acid sequence of SEQ ID NO:57 or 58. In one embodiment, the antibody or antigen-binding fragment thereof further comprises a light chain constant region having the amino acid sequence of SEQ ID NO:57. In one embodiment, the antibody or antigen-binding fragment thereof further comprises a light chain constant region having the amino acid sequence of SEQ ID NO:58.
[0302] In some embodiments, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:59, 60, 61, 62, 63, 64, 65, 66, 67, or 68, and a light chain constant region having the amino acid sequence of SEQ ID NO:57 or 58. In one embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:59, and a light chain constant region having the amino acid sequence of SEQ ID NO:57. In another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:60, and a light chain constant region having the amino acid sequence of SEQ ID NO:57. In yet another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:61, and a light chain constant region having the amino acid sequence of SEQ ID NO:57. In still another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:62, and a light chain constant region having the amino acid sequence of SEQ ID NO:57. In one embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:63, and a light chain constant region having the amino acid sequence of SEQ ID NO:57. In another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:64, and a light chain constant region having the amino acid sequence of SEQ ID NO:57. In yet another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:65, and a light chain constant region having the amino acid sequence of SEQ ID NO:57. In still another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:66, and a light chain constant region having the amino acid sequence of SEQ ID NO:57. In one embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:67, and a light chain constant region having the amino acid sequence of SEQ ID NO:57. In another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:68, and a light chain constant region having the amino acid sequence of SEQ ID NO:57. In yet another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:59, and a light chain constant region having the amino acid sequence of SEQ ID NO:58. In still another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:60, and a light chain constant region having the amino acid sequence of SEQ ID NO:58. In one embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:61, and a light chain constant region having the amino acid sequence of SEQ ID NO:58. In another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:62, and a light chain constant region having the amino acid sequence of SEQ ID NO:58. In yet another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:63, and a light chain constant region having the amino acid sequence of SEQ ID NO:58. In still another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:64, and a light chain constant region having the amino acid sequence of SEQ ID NO:58. In one embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:65, and a light chain constant region having the amino acid sequence of SEQ ID NO:58. In another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:66, and a light chain constant region having the amino acid sequence of SEQ ID NO:58. In yet another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:67, and a light chain constant region having the amino acid sequence of SEQ ID NO:58. In still another embodiment, the antibody or antigen-binding fragment thereof further comprises a heavy chain constant region having the amino acid sequence of SEQ ID NO:68, and a light chain constant region having the amino acid sequence of SEQ ID NO:58. In certain embodiments, the lysine residue at the C-terminus of the heavy chain constant region is present. In other embodiments, the lysine residue at the C-terminus of the heavy chain constant region is absent.
[0303] In certain embodiments, the antibody or antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence of SEQ ID NO:71 and a heavy chain comprising the amino acid sequence of SEQ ID NO:72. In certain embodiments, the lysine residue at the C-terminus of the heavy chain constant region is present. In other embodiments, the lysine residue at the C-terminus of the heavy chain constant region is absent.
[0304] In some embodiments, the antibody or antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence of SEQ ID NO:73 and a heavy chain comprising the amino acid sequence of SEQ ID NO:74. In certain embodiments, the lysine residue at the C-terminus of the heavy chain constant region is present. In other embodiments, the lysine residue at the C-terminus of the heavy chain constant region is absent.
[0305] In other embodiments, the antibody or antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence of SEQ ID NO:75 and a heavy chain comprising the amino acid sequence of SEQ ID NO:76. In certain embodiments, the lysine residue at the C-terminus of the heavy chain constant region is present. In other embodiments, the lysine residue at the C-terminus of the heavy chain constant region is absent.
[0306] In yet other embodiments, the antibody or antigen-binding fragment thereof consists of two light chains comprising the amino acid sequence of SEQ ID NO:71 and two heavy chains comprising the amino acid sequence of SEQ ID NO:72. In certain embodiments, the lysine residue at the C-terminus of the heavy chain constant region is present. In other embodiments, the lysine residue at the C-terminus of the heavy chain constant region is absent.
[0307] In still other embodiments, the antibody or antigen-binding fragment thereof consists of two light chains comprising the amino acid sequence of SEQ ID NO:73 and two heavy chains comprising the amino acid sequence of SEQ ID NO:74. In certain embodiments, the lysine residue at the C-terminus of the heavy chain constant region is present. In other embodiments, the lysine residue at the C-terminus of the heavy chain constant region is absent.
[0308] In yet still other embodiments, the antibody or antigen-binding fragment thereof consists of two light chains comprising the amino acid sequence of SEQ ID NO:75 and two heavy chains comprising the amino acid sequence of SEQ ID NO:76. In certain embodiments, the lysine residue at the C-terminus of the heavy chain constant region is present. In other embodiments, the lysine residue at the C-terminus of the heavy chain constant region is absent.
[0309] In certain embodiments, the antibody or antigen-binding fragment thereof consists of two light chains consisting of the amino acid sequence of SEQ ID NO:71 and two heavy chains consisting of the amino acid sequence of SEQ ID NO:72. In certain embodiments, the lysine residue at the C-terminus of the heavy chain constant region is present. In other embodiments, the lysine residue at the C-terminus of the heavy chain constant region is absent.
[0310] In some embodiments, the antibody or antigen-binding fragment thereof consists of two light chains consisting of the amino acid sequence of SEQ ID NO:73 and two heavy chains consisting of the amino acid sequence of SEQ ID NO:74. In certain embodiments, the lysine residue at the C-terminus of the heavy chain constant region is present. In other embodiments, the lysine residue at the C-terminus of the heavy chain constant region is absent.
[0311] In other embodiments, the antibody or antigen-binding fragment thereof consists of two light chains consisting of the amino acid sequence of SEQ ID NO:75 and two heavy chains consisting of the amino acid sequence of SEQ ID NO:76. In certain embodiments, the lysine residue at the C-terminus of the heavy chain constant region is present. In other embodiments, the lysine residue at the C-terminus of the heavy chain constant region is absent.
[0312] In various embodiments of the antibody or antigen binding fragment thereof described herein, the antibody or antigen binding fragment thereof has an equilibrium dissociation constant (KD) of 1×10.sup.−8 M or less, 9×10.sup.−9 M or less, 8×10.sup.−9 M or less, 7×10.sup.−9 M or less, 6×10.sup.−9 M or less, 5×10.sup.−9 M or less, 4×10.sup.−9 M or less, 3×10.sup.−9 M or less, or 2×10.sup.−9 M or less for tau-pS413. In certain embodiments, the antibody or antigen binding fragment thereof has an equilibrium dissociation constant (KD) of 1×10.sup.−8 M or less for tau-pS413. In some embodiments, the antibody or antigen binding fragment thereof has an equilibrium dissociation constant (KD) of 9×10.sup.−9 M or less for tau-pS413. In other embodiments, the antibody or antigen binding fragment thereof has an equilibrium dissociation constant (KD) of 8×10.sup.−9 M or less for tau-pS413. In certain embodiments, the antibody or antigen binding fragment thereof has an equilibrium dissociation constant (KD) of 7×10.sup.−9 M or less for tau-pS413. In some embodiments, the antibody or antigen binding fragment thereof has an equilibrium dissociation constant (KD) of 6×10.sup.−9 M or less for tau-pS413. In other embodiments, the antibody or antigen binding fragment thereof has an equilibrium dissociation constant (KD) of 5×10.sup.−9 M or less for tau-pS413. In yet other embodiments, the antibody or antigen binding fragment thereof has an equilibrium dissociation constant (KD) of 4×10.sup.−9 M or less for tau-pS413. In still other embodiments, the antibody or antigen binding fragment thereof has an equilibrium dissociation constant (KD) of 3×10.sup.−9 M or less for tau-pS413. In yet still other embodiments, the antibody or antigen binding fragment thereof has an equilibrium dissociation constant (KD) of 2×10.sup.−9 M or less for tau-pS413. In some embodiments, the KD is measured by Surface Plasmon Resonance (SPR) assay. In certain embodiments, the KD is measured by Surface Plasmon Resonance (SPR) assay with the antibody or antigen binding fragment thereof being immobilized. In other embodiments, the KD is measured by Surface Plasmon Resonance (SPR) assay with the antigen being immobilized. In one embodiment, the KD is measured by Biacore. In another embodiment, the KD is measured by KinExA. In one specific embodiment, the KD is measured by Biacore with the antibody or antigen binding fragment thereof being immobilized.
[0313] In certain embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; and has a KD of 1×10.sup.−8 M or less for tau-pS413. In some embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; and has a KD of 9×10.sup.−9 M or less for tau-pS413. In other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; and has a KD of 8×10.sup.−9 M or less for tau-pS413. In certain embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; and has a KD of 7×10.sup.−9 M or less for tau-pS413. In some embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; and has a KD of 6×10.sup.−9 M or less for tau-pS413. In other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; and has a KD of 5×10.sup.−9 M or less for tau-pS413. In yet other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; and has a KD of 4×10.sup.−9 M or less for tau-pS413. In still other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; and has a KD of 3×10.sup.−9 M or less for tau-pS413. In yet still other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35; and has a KD of 2×10.sup.−9 M or less for tau-pS413. In a specific embodiment, the KD is measured by Biacore with the antibody or antigen binding fragment thereof being immobilized.
[0314] In some embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56 and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; and has a KD of 1×10.sup.−8 M or less for tau-pS413. In certain embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56 and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; and has a KD of 9×10.sup.−9 M or less for tau-pS413. In other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56 and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; and has a KD of 8×10.sup.−9 M or less for tau-pS413. In some embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56 and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; and has a KD of 7×10.sup.−9 M or less for tau-pS413. In certain embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56 and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; and has a KD of 6×10.sup.−9 M or less for tau-pS413. In other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56 and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; and has a KD of 5×10.sup.−9 M or less for tau-pS413. In yet other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56 and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; and has a KD of 4×10.sup.−9 M or less for tau-pS413. In still other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56 and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; and has a KD of 3×10.sup.−9 M or less for tau-pS413. In yet still other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56 and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36; and has a KD of 2×10.sup.−9 M or less for tau-pS413. In a specific embodiment, the KD is measured by Biacore with the antibody or antigen binding fragment thereof being immobilized.
[0315] In certain embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56 and a VL comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; and has a KD of 1×10.sup.−8 M or less for tau-pS413. In some embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56 and a VL comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; and has a KD of 9×10.sup.−9 M or less for tau-pS413. In other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56 and a VL comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; and has a KD of 8×10.sup.−9 M or less for tau-pS413. In certain embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56 and a VL comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; and has a KD of 7×10.sup.−9 M or less for tau-pS413. In some embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56 and a VL comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; and has a KD of 6×10.sup.−9 M or less for tau-pS413. In other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56 and a VL comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; and has a KD of 5×10.sup.−9 M or less for tau-pS413. In yet other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56 and a VL comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; and has a KD of 4×10.sup.−9 M or less for tau-pS413. In still other embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56 and a VL comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; and has a KD of 3×10.sup.−9 M or less for tau-pS413. In yet still embodiments, the antibody or antigen binding fragment thereof that binds to tau-pS413 comprises a VH comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:56 and a VL comprising at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO:36; and has a KD of 2×10.sup.−9 M or less for tau-pS413. In a specific embodiment, the KD is measured by Biacore with the antibody or antigen binding fragment thereof being immobilized.
[0316] The present disclosure further includes functional fragments of the anti-tau-pS413 antibodies disclosed herein. Non-limiting examples of functional fragments (e.g., antigen-binding fragments such as tau-pS413-binding fragments) include single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), Fab fragments, F(ab′) fragments, F(ab).sub.2 fragments, F(ab′) 2 fragments, disulfide-linked Fvs (dsFv), Fd fragments, Fv fragments, diabody, triabody, tetrabody, and minibody. In particular, antibodies provided herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, for example, antigen-binding domains or molecules that contain an antigen-binding site that binds to a tau-pS413 antigen (e.g., one or more CDRs of an anti-tau-pS413 antibody). Such antibody fragments can be found in, for example, Harlow and Lane, Antibodies: A Laboratory Manual (1989); Mol. Biology and Biotechnology: A Comprehensive Desk Reference (Myers ed., 1995); Huston et al., 1993, Cell Biophysics 22:189-224; Pluckthun and Skerra, 1989, Meth. Enzymol. 178:497-515; Day, Advanced Immunochemistry (2d ed. 1990); Hudson et al., 2003, Nature Med. 9:129-34.
[0317] Immunoglobulins may be assigned to different classes depending on the amino acid sequences of the constant domain of their heavy chains. There are at least five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgG-1, IgG-2, IgG-3 and IgG-4; IgA-1 and IgA-2. The invention comprises antibodies and antigen binding fragments of any of these classes or subclasses of antibodies.
[0318] In one embodiment, the antibody or antigen binding fragment comprises a heavy chain constant region, e.g. a human constant region, such as γ1, γ2, γ3, or γ4 human heavy chain constant region or a variant thereof. In another embodiment, the antibody or antigen binding fragment comprises a light chain constant region, e.g. a human light chain constant region, such as lambda or kappa human light chain region or variant thereof.
Antibody Engineering of the Fc Region
[0319] The antibodies disclosed herein can also be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or effector function (e.g., antigen-dependent cellular cytotoxicity). Furthermore, the antibodies disclosed herein can be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody. Each of these embodiments is described in further detail below. The numbering of residues in the Fc region is that of the EU index of Kabat.
[0320] The antibodies disclosed herein also include antibodies with modified (or blocked) Fc regions to provide altered effector functions. See, e.g., U.S. Pat. No. 5,624,821; WO2003/086310; WO2005/120571; WO2006/0057702. Such modification can be used to enhance or suppress various reactions of the immune system, with possible beneficial effects in diagnosis and therapy. Alterations of the Fc region include amino acid changes (substitutions, deletions and insertions), glycosylation or deglycosylation, and adding multiple Fc. Changes to the Fc can also alter the half-life of antibodies in therapeutic antibodies, enabling less frequent dosing and thus increased convenience and decreased use of material. See Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734-35.
[0321] In one embodiment, the constant domain (CH1-hinge-CH2-CH3) of human wild type IgG1 is modified with two amino acid substitutions, L234A and L235A (sometimes referred to as “LALA” mutations) that reduce/ablate effector function. In another embodiment, the constant domain (CH1-hinge-CH2-CH3) of human wild type IgG1 is modified with three amino acid substitutions, L234A, L235A and D265S that reduce/ablate effector function. In yet another embodiment, the constant domain (CH1-hinge-CH2-CH3) of human wild type IgG1 is modified with three amino acid substitutions, M252Y, S254T, and T256E that increase half-life of the antibody in serum. In still another embodiment, the constant domain (CH1-hinge-CH2-CH3) of human wild type IgG1 is modified with five amino acid substitutions, L234A, L235A, M252Y, S254T, and T256E that reduce/ablate effector function and increase half-life of the antibody in serum. In yet still another embodiment, the constant domain (CH1-hinge-CH2-CH3) of human wild type IgG1 is modified with six amino acid substitutions, L234A, L235A, D265S, M252Y, S254T, and T256E that reduce/ablate effector function and increase half-life of the antibody in serum. In another embodiment, the constant domain (CH1-hinge-CH2-CH3) of human wild type IgG1 is modified with the amino acid substitution N297A, which eliminates a glycosylation site and reduces/ablates effector function. In still another embodiment, the constant domain (CH1-hinge-CH2-CH3) of human wild type IgG1 with the amino acid substitution N297Q, which eliminates a glycosylation site and reduces/ablates effector function.
[0322] In one embodiment, the antibody is an IgG4 isotype antibody comprising a Serine to Proline mutation at an amino acid position corresponding to position 228 (S228P; EU index) in the hinge region of the heavy chain constant region. This mutation has been reported to abolish the heterogeneity of inter-heavy chain disulfide bridges in the hinge region (Angal et al. supra; position 241 is based on the Kabat numbering system).
[0323] In one embodiment, the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is increased or decreased. This approach is described further in U.S. Pat. No. 5,677,425. The number of cysteine residues in the hinge region of CH1 is altered, for example, to facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
[0324] In another embodiment, the antibody is modified to increase its biological half-life. Various approaches are possible. For example, one or more of the following amino acid mutations can be introduced: T252L, T254S, T256F, as described in U.S. Pat. No. 6,277,375. Alternatively, to increase the biological half-life, the antibody can be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022.
[0325] In yet other embodiments, the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody. For example, one or more amino acids selected from amino acid residues at positions 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen-binding ability of the parent antibody. The effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260.
[0326] In another example, one or more amino acids selected from amino acid residues at positions 329, 331 and 322 can be replaced with a different amino acid residue such that the antibody has altered Clq binding and/or reduced or abolished complement dependent cytotoxicity (CDC). This approach is described in further detail in U.S. Pat. No. 6,194,551.
[0327] In another example, one or more amino acid residues within amino acid positions 231 and 239 are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in PCT Publication WO 94/29351.
[0328] In yet another example, the Fc region is modified to increase or decrease the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase or decrease the affinity of the antibody for an Fcγ receptor by modifying one or more amino acids at the following positions: 238, 239, 243, 248, 249, 252, 254, 255, 256, 258, 264, 265, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 301, 303, 305, 307, 309, 312, 315, 320, 322, 324, 326, 327, 329, 330, 331, 333, 334, 335, 337, 338, 340, 360, 373, 376, 378, 382, 388, 389, 398, 414, 416, 419, 430, 434, 435, 437, 438 or 439. This approach is described further in PCT Publication WO 00/42072. Moreover, the binding sites on human IgG1 for FcγR1, FcγRII, FcγRIII and FcRn have been mapped and variants with improved binding have been described (see Shields et al. (2001) J. Biol. Chem. 276:6591-6604). Specific mutations at positions 256, 290, 298, 333, 334 and 339 were shown to improve binding to FcγRIII. Additionally, the following combination mutants were shown to improve FcγRIII binding: T256A/S298A, S298A/E333A, S298A/K224A and S298A/E333A/K334A.
[0329] In one embodiment, the Fc region is modified to decrease the ability of the antibody to mediate effector function and/or to increase anti-inflammatory properties by modifying amino acid residues at positions 243 and 264. In one embodiment, the Fc region of the antibody is modified by changing the amino acid residues at positions 243 and 264 to alanine. In one embodiment, the Fc region is modified to decrease the ability of the antibody to mediate effector function and/or to increase anti-inflammatory properties by modifying amino acid residues at positions 243, 264, 267 and 328.
[0330] In still another embodiment, the antibody comprises a particular glycosylation pattern. For example, an aglycosylated antibody can be made (i.e., the antibody lacks glycosylation). The glycosylation pattern of an antibody may be altered to, for example, increase the affinity or avidity of the antibody for an antigen. Such modifications can be accomplished by, for example, altering one or more of the glycosylation sites within the antibody sequence. For example, one or more amino acid substitutions can be made that result removal of one or more of the variable region framework glycosylation sites to thereby eliminate glycosylation at that site. Such aglycosylation may increase the affinity or avidity of the antibody for antigen. See, e.g., U.S. Pat. Nos. 5,714,350 and 6,350,861.
[0331] An antibody may also be made in which the glycosylation pattern includes hypofucosylated or afucosylated glycans, such as a hypofucosylated antibodies or afucosylated antibodies have reduced amounts of fucosyl residues on the glycan. The antibody may also include glycans having an increased amount of bisecting GlcNAc structures. Such altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies. Such modifications can be accomplished by, for example, expressing the antibody in a host cell in which the glycosylation pathway was been genetically engineered to produce glycoproteins with particular glycosylation patterns. These cells have been described in the art and can be used as host cells in which to express recombinant antibodies of the invention to thereby produce an antibody with altered glycosylation. For example, the cell lines Ms704, Ms705, and Ms709 lack the fucosyltransferase gene, FUT8 (α (1,6)-fucosyltransferase), such that antibodies expressed in the Ms704, Ms705, and Ms709 cell lines lack fucose on their carbohydrates. The Ms704, Ms705, and Ms709 FUT8.sup.−/− cell lines were created by the targeted disruption of the FUT8 gene in CHO/DG44 cells using two replacement vectors (see U.S. Patent Publication No. 20040110704 and Yamane-Ohnuki et al. (2004) Biotechnol Bioeng 87:614-22). As another example, EP 1176195 describes a cell line with a functionally disrupted FUT8 gene, which encodes a fucosyl transferase, such that antibodies expressed in such a cell line exhibit hypofucosylation by reducing or eliminating the α-1,6 bond-related enzyme. EP 1,176,195 also describes cell lines which have a low enzyme activity for adding fucose to the N-acetylglucosamine that binds to the Fc region of the antibody or does not have the enzyme activity, for example the rat myeloma cell line YB2/0 (ATCC CRL 1662). PCT Publication WO 03/035835 describes a variant CHO cell line, Lec13 cells, with reduced ability to attach fucose to Asn(297)-linked carbohydrates, also resulting in hypofucosylation of antibodies expressed in that host cell (see also Shields et al. (2002) J. Biol. Chem. 277:26733-26740). Antibodies with a modified glycosylation profile can also be produced in chicken eggs, as described in PCT Publication WO 06/089231. Alternatively, antibodies with a modified glycosylation profile can be produced in plant cells, such as Lemna (U.S. Pat. No. 7,632,983). Methods for production of antibodies in a plant system are disclosed in the U.S. Pat. Nos. 6,998,267 and 7,388,081. PCT Publication WO 99/54342 describes cell lines engineered to express glycoprotein-modifying glycosyl transferases (e.g., β(1,4)-N-acetylglucosaminyltransferase III (GnTIII)) such that antibodies expressed in the engineered cell lines exhibit increased bisecting GlcNac structures which results in increased ADCC activity of the antibodies (see also Umana et al. (1999) Nat. Biotech. 17:176-180).
[0332] Alternatively, the fucose residues of the antibody can be cleaved off using a fucosidase enzyme; e.g., the fucosidase α-L-fucosidase removes fucosyl residues from antibodies (Tarentino et al. (1975) Biochem. 14:5516-23).
[0333] Antibodies disclosed herein further include those produced in lower eukaryote host cells, in particular fungal host cells such as yeast and filamentous fungi have been genetically engineered to produce glycoproteins that have mammalian- or human-like glycosylation patterns (see, for example, Choi et al, (2003) Proc. Natl. Acad. Sci. 100: 5022-5027; Hamilton et al., (2003) Science 301: 1244-1246; Hamilton et al., (2006) Science 313: 1441-1443). A particular advantage of these genetically modified host cells over currently used mammalian cell lines is the ability to control the glycosylation profile of glycoproteins that are produced in the cells such that compositions of glycoproteins can be produced wherein a particular N-glycan structure predominates (see, e.g., U.S. Pat. Nos. 7,029,872 and 7,449,308). These genetically modified host cells have been used to produce antibodies that have predominantly particular N-glycan structures (see, for example, Li et al., (2006) Nat. Biotechnol. 24: 210-215).
Antibody Conjugates
[0334] The anti-tau-pS413 antibodies or antigen binding fragments thereof disclosed herein can also be conjugated to one or more agents (e.g., a peptide or chemical moiety). The chemical moiety may be, inter alia, a polymer, a radionuclide, or a therapeutic or prophylactic agent. In particular embodiments, the chemical moiety is a polymer which increases the half-life of the antibody molecule in the body of a subject. Suitable polymers include, but are not limited to, hydrophilic polymers which include but are not limited to polyethylene glycol (PEG) (e.g., PEG with a molecular weight of 2 kDa, 5 kDa, 10 kDa, 12 kDa, 20 kDa, 30 kDa or 40 kDa), dextran and monomethoxypolyethylene glycol (mPEG). Lee, et al., (1999) (Bioconj. Chem. 10:973-981) discloses PEG-conjugated single-chain antibodies. Wen, et al., (2001) (Bioconj. Chem. 12:545-553) disclose conjugating antibodies with PEG that is attached to a radiometal chelator (diethylenetriaminpentaacetic acid (DTPA)).
[0335] The antibodies and antibody fragments disclosed herein may be pegylated, for example to increase its biological (e.g., serum) half-life. To pegylate an antibody, the antibody, or fragment thereof, typically is reacted with a reactive form of polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment. In particular embodiments, the pegylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer). As used herein, the term “polyethylene glycol” is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide. In certain embodiments, the antibody to be pegylated is an aglycosylated antibody. Methods for pegylating proteins are known in the art and can be applied to the antibodies of the invention. See, e.g., EP 0 154 316 and EP 0 401 384.
[0336] The antibodies and antibody fragments disclosed herein may also be conjugated to detectable substances including, but not limited to, various enzymes, such as, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, such as, but not limited to, streptavidin/biotin or avidin/biotin; fluorescent materials, such as, but not limited to, umbelliferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride, or phycoerythrin; luminescent materials, such as, but not limited to, luminol; bioluminescent materials, such as, but not limited to, luciferase, luciferin, or aequorin; chemiluminescent material, such as, but not limited to, an acridinium based compound or a HALOTAG; radioactive materials, such as but not limited to iodine (.sup.131I .sup.125I, .sup.123I, and .sup.121I), carbon (.sup.14C), sulfur (.sup.35S), tritium (.sup.3H), indium (.sup.115In, .sup.113In, .sup.112In, and .sup.111In), technetium (.sup.99Tc), thallium (.sup.201Ti), gallium (.sup.68Ga and .sup.67Ga), palladium (.sup.103Pd), molybdenum (.sup.99Mo), xenon (.sup.133Xe), fluorine (.sup.18F), .sup.153Sm, .sup.177Lu, .sup.159Gd, .sup.149Pm, .sup.140La, .sup.175Yb, .sup.166Ho, .sup.90Y, .sup.47Sc, .sup.186Re, .sup.188Re, .sup.142Pr, .sup.105Rh, .sup.97Ru, .sup.68Ge, .sup.57Co, .sup.65Zn, .sup.85Sr, .sup.32P, .sup.153Gd, .sup.169Yb, .sup.51Cr, .sup.54Mn, .sup.75Se, .sup.113Sn, or .sup.117Sn; positron emitting metals using various positron emission tomographies; and non-radioactive paramagnetic metal ions.
[0337] In other embodiments, the antibodies or antigen binding fragments thereof can be recombinantly fused or chemically conjugated (covalent or non-covalent conjugations) to a heterologous protein or polypeptide (or fragment thereof, for example, to a polypeptide of about 10, about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90, or about 100 amino acids) to generate fusion proteins. In particular, provided herein are fusion proteins comprising an antigen-binding fragment of an antibody provided herein (e.g., a Fab fragment, Fc fragment, Fv fragment, F(ab).sub.2 fragment, a VH domain, a VH CDR, a VL domain, or a VL CDR) and a heterologous protein, polypeptide, or peptide. In one embodiment, the heterologous protein, polypeptide, or peptide that the antibody is fused to is useful for targeting the antibody to a particular cell type, such as a neuron cell. For example, an antibody that binds to a cell surface receptor expressed by a particular neuron cell type may be fused or conjugated to a modified antibody provided herein.
[0338] Any method known in the art for conjugating the antibody molecules to the various moieties may be employed, including those methods described by Hunter, et al., (1962) Nature 144:945; David, et al., (1974) Biochemistry 13:1014; Pain, et al., (1981) J. Immunol. Meth. 40:219; and Nygren, J., (1982) Histochem. and Cytochem. 30:407.
Methods of Using High Affinity Anti-Tau-pS413 Antibodies or Antigen Binding Fragments Thereof
[0339] The present disclosure also includes methods of using the high affinity anti-tau-pS413 antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof described herein. These antibodies can be used in treating, diagnosing, or monitoring progress of tauopathy, or decreasing the amount of tau-pS413 in the brain of a subject having tauopathy.
[0340] In one aspect, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of the antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof described herein.
[0341] In yet still another aspect, provided is a method of decreasing the amount of tau-pS413 in the brain of a subject having tauopathy, comprising administering to the subject in need thereof an effective amount of the antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof of described herein.
[0342] In yet additional embodiments, provided is the use of an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein to treat tauopathy in a subject.
[0343] In yet additional embodiments, provided is the use of an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein to decrease the amount of tau-pS413 in the brain of a subject having tauopathy.
[0344] In yet additional embodiments, provided is the use of an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein for the treatment of tauopathy in a subject.
[0345] In yet additional embodiments, provided is the use of an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein for the preparation of a medicament to treat tauopathy in a subject.
[0346] In yet a further embodiment, provided is an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein for use in a method for treating tauopathy in a subject.
[0347] In yet another embodiment, provided is an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein for use in a method for decreasing the amount of tau-pS413 in the brain of a subject having tauopathy.
[0348] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31.
[0349] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35.
[0350] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39.
[0351] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27.
[0352] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:41; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:42; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:43; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19.
[0353] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31.
[0354] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35.
[0355] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39.
[0356] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27.
[0357] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:45; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:46; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:47; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19.
[0358] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31.
[0359] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35.
[0360] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39.
[0361] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27.
[0362] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:49; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:50; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:51; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19.
[0363] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31.
[0364] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35.
[0365] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39.
[0366] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:25; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:26; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:27.
[0367] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:53; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:54; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:55; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:17; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:18; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:19.
[0368] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:21; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:22; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:23; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:29; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:30; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:31.
[0369] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:21; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:22; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:23; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:33; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:34; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:35.
[0370] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:21; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:22; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:23; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:37; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:38; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:39.
[0371] In another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:86; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:87; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:88; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:83; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:84; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:85.
[0372] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:92; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:93; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:94; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:89; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:90; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:91.
[0373] In still another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:98; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:99; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:100; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:95; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:96; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:97.
[0374] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1 comprising the amino acid sequence of SEQ ID NO:104; a VH-CDR2 comprising the amino acid sequence of SEQ ID NO:105; and a VH-CDR3 comprising the amino acid sequence of SEQ ID NO:106; and a VL-CDR1 comprising the amino acid sequence of SEQ ID NO:101; a VL-CDR2 comprising the amino acid sequence of SEQ ID NO:102; and a VL-CDR3 comprising the amino acid sequence of SEQ ID NO:103.
[0375] In another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32.
[0376] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36.
[0377] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40.
[0378] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28.
[0379] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:44; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20.
[0380] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32.
[0381] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36.
[0382] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40.
[0383] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28.
[0384] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:48; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20.
[0385] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32.
[0386] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36.
[0387] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40.
[0388] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28.
[0389] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:52; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20.
[0390] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32.
[0391] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36.
[0392] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40.
[0393] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:28.
[0394] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:56; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:20.
[0395] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:24; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:32.
[0396] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:24; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:36.
[0397] In one embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH-CDR1, a VH-CDR2, and a VH-CDR3 of a VH comprising the amino acid sequence of SEQ ID NO:24; and a VL-CDR1, a VL-CDR2, and a VL-CDR3 of a VL comprising the amino acid sequence of SEQ ID NO:40.
[0398] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:32.
[0399] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:36.
[0400] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:40.
[0401] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:28.
[0402] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:44, and a VL having the amino acid sequence of SEQ ID NO:20.
[0403] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:32.
[0404] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:36.
[0405] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:40.
[0406] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:28.
[0407] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:48, and a VL having the amino acid sequence of SEQ ID NO:20.
[0408] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:32.
[0409] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:36.
[0410] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:40.
[0411] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:28.
[0412] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:52, and a VL having the amino acid sequence of SEQ ID NO:20.
[0413] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:32.
[0414] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:36.
[0415] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:40.
[0416] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:28.
[0417] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:56, and a VL having the amino acid sequence of SEQ ID NO:20.
[0418] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:24, and a VL having the amino acid sequence of SEQ ID NO:32.
[0419] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:24, and a VL having the amino acid sequence of SEQ ID NO:36.
[0420] In yet another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a VH having the amino acid sequence of SEQ ID NO:24, and a VL having the amino acid sequence of SEQ ID NO:40.
[0421] In still another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a light chain comprising the amino acid sequence of SEQ ID NO:71 and a heavy chain comprising the amino acid sequence of SEQ ID NO:72.
[0422] In still another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a light chain comprising the amino acid sequence of SEQ ID NO:73 and a heavy chain comprising the amino acid sequence of SEQ ID NO:74.
[0423] In still another embodiment, provided is a method of treating tauopathy in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises: a light chain comprising the amino acid sequence of SEQ ID NO:75 and a heavy chain comprising the amino acid sequence of SEQ ID NO:76.
[0424] In some embodiments, the method further comprises administering to the subject an additional agent.
[0425] In particular embodiments, the additional agent is an agent effective to treat the same or different disorder as the anti-tau-pS413 antibodies or antigen-binding fragments thereof disclosed herein are being used to treat. In some embodiments, the additional agent is an agent effective to mitigate one or more side effects of the anti-tau-pS413 antibodies or antigen-binding fragments thereof disclosed herein. Exemplary additional agents include, but are not limited to: cholinesterase inhibitors (such as donepezil, galantamine, rovastigmine, and tacrine), NMDA receptor antagonists (such as memantine), amyloid beta peptide aggregation inhibitors, antioxidants, gamma-secretase modulators, nerve growth factor (NGF) mimics or NGF gene therapy, PPARγ agonists, HMS-CoA reductase inhibitors (statins), ampakines, calcium channel blockers, GABA receptor antagonists, glycogen synthase kinase inhibitors, intravenous immunoglobulin, muscarinic receptor agonists, nicotinic receptor modulators, active or passive amyloid beta peptide for immunization, phosphodiesterase inhibitors, serotonin receptor antagonists, anti-amyloid beta peptide antibodies, growth hormone, neurotrophic factor, brain-derived neurotrophic factor (BDNF), nerve growth factor (NGF), neurotrophin-4/5, fibroblast growth factor (FGF)-2 and other FGFs, neurotrophin (NT)-3, erythropoietin (EPO), hepatocyte growth factor (HGF), epidermal growth factor (EGF), transforming growth factor (TGF)-alpha, TGF-beta, vascular endothelial growth factor (VEGF), interleukin-1 receptor antagonist (IL-lra), ciliary neurotrophic factor (CNTF), glial-derived neurotrophic factor (GDNF), neurturin, platelet-derived growth factor (PDGF), heregulin, neuregulin, artemin, persephin, interleukins, glial cell line derived neurotrophic factor (GFR), granulocyte-colony stimulating factor (CSF), granulocyte-macrophage-CSF, netrins, cardiotrophin-1, hedgehogs, leukemia inhibitory factor (LIF), midkine, pleiotrophin, bone morphogenetic proteins (BMPs), netrins, saposins, semaphorins, stem cell factor (SCF), or a different anti-tau antibody.
[0426] Such combination therapies noted above encompass combined administration (where two or more agents are included in the same or separate formulations), and separate administration, in which case, administration of the anti-tau-pS413 antibody or antigen binding fragment thereof can occur prior to, simultaneously, and/or following, administration of the additional agent and/or adjuvant. The anti-tau-pS413 antibodies or antigen-binding fragments thereof disclosed herein can also be used in combination with other interventional therapies such as, but not limited to, radiation therapy, behavioral therapy, or other therapies known in the art and appropriate for the neurological disorder to be treated or prevented, for example, regenerative medicine approaches that use biotechnologies including gene therapy, gene-modified cell therapy, cell therapy and tissue engineering to restore or establish normal brain function.
[0427] Anti-tau-pS413 antibodies or fragments thereof may also be useful in diagnostic assays for tau-pS413, e.g., detecting its existence in specific neuron cells, brain tissues, CSF, or interstitial fluid (ISF). Such diagnostic methods may be useful in various disease diagnoses or monitoring progress of the disease.
[0428] For example, particular embodiments include ELISA assays incorporating the use of an anti-tau-pS413 antibody or antigen binding fragment thereof disclosed herein.
[0429] An exemplary method comprises the following steps:
[0430] (a) coat a substrate (e.g., surface of a microtiter plate well, e.g., a plastic plate) with a first antibody or antigen binding fragment thereof;
[0431] (b) apply a sample to be tested for the presence of tau-pS413 to the substrate;
[0432] (c) wash the plate, so that unbound material in the sample is removed;
[0433] (d) apply a detectably labeled second antibody (e.g., enzyme-linked antibody);
[0434] (e) wash the substrate, so that the unbound labeled second antibody is removed;
[0435] (f) if the labeled second antibody is enzyme linked, apply a chemical which is converted by the enzyme into a fluorescent signal; and
[0436] (g) detect the presence of the labeled second antibody.
[0437] The anti-tau-pS413 antibodies described herein can be the first antibody or the second antibody, or both the first and the second antibodies in the above exemplary method. In one embodiment, the anti-tau-pS413 antibody described herein is the first antibody, and the second antibody is a different antibody that is specific to tau or phosphorylated tau. In another embodiment, the anti-tau-pS413 antibody described herein is the second antibody, and the first antibody is a different antibody that is specific to tau or phosphorylated tau.
[0438] In a further embodiment, the labeled anti-tau-pS413 antibody is labeled with peroxidase which reacts with ABTS (e.g., 2,2′-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid)) or 3,3′,5,5′-tetramethylbenzidine to produce a color change which is detectable. Alternatively, the labeled anti-tau-pS413 antibody is labeled with a detectable radioisotope (e.g., .sup.3H) which can be detected by scintillation counter in the presence of a scintillant.
[0439] An anti-tau-pS413 antibody described herein may be used in a Western blot or immune-protein blot procedure.
[0440] An exemplary method comprises the following steps:
[0441] (1) contacting a membrane or other solid substrate to be tested for the presence of tau-pS413 or a fragment thereof with an anti-tau-pS413 antibody or fragment described herein;
[0442] (2) washing the membrane one or more times to remove unbound anti-tau-pS413 antibody or fragment and other unbound substances; and
[0443] (3) detecting the bound anti-tau-pS413 antibody or fragment.
[0444] Such a membrane may take the form of a nitrocellulose or vinyl-based (e.g., polyvinylidene fluoride (PVDF)) membrane to which proteins to be tested for the presence of tau-pS413 in a non-denaturing PAGE (polyacrylamide gel electrophoresis) gel or SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) gel have been transferred (e.g., following electrophoretic separation in the gel). Before contact of membrane with the anti-tau-pS413 antibody or fragment, the membrane is optionally blocked, e.g., with non-fat dry milk or the like so as to block non-specific protein binding sites on the membrane.
[0445] Detection of the bound antibody or fragment may be by binding the antibody or fragment with a secondary antibody (an anti-immunoglobulin antibody) which is detectably labeled and, then, detecting the presence of the secondary antibody.
[0446] The anti-tau-pS413 antibodies and antigen binding fragments thereof disclosed herein may also be used for immunohistochemistry. Such a method forms part of the present disclosure and comprises, e.g., (1) contacting a cell or tissue to be tested for the presence of tau-pS413 with an anti-tau-pS413 antibody or antigen binding fragment thereof described herein; and (2) detecting the anti-tau-pS413 antibody or antigen binding fragment thereof on or in the cell or in the tissue. If the anti-tau-pS413 antibody or fragment itself is detectably labeled, it can be detected directly. Alternatively, the anti-tau-pS413 antibody or fragment may be bound by a detectably labeled secondary antibody which is detected.
[0447] The anti-tau-pS413 antibodies and antigen binding fragments thereof disclosed herein may also be used for in vivo imaging. Such a method may include injection of a radiolabeled anti-tau-pS413 antibodies or antigen-binding fragment thereof into the body of a patient to be tested for the presence of tauopathy associated with the presence of tau-pS413 followed by nuclear imaging of the body of the patient to detect the presence of the labeled anti-tau-pS413 antibody or fragment, e.g., at loci comprising a high concentration of the anti-tau-pS413 antibody or fragment which are bound to tau-pS413 in the brain.
[0448] Imaging techniques include SPECT imaging (single photon emission computed tomography) or PET imaging (positron emission tomography). Labels include e.g., iodine-123 (.sup.123I) and technetium-99m (.sup.99mTc), e.g., in conjunction with SPECT imaging or .sup.11C, .sup.13N, .sup.15O or .sup.18F, e.g., in conjunction with PET imaging or Indium-111 (See e.g., Gordon et al., (2005) International Rev. Neurobiol. 67:385-440).
[0449] Thus, in additional embodiments, provided is the use of an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein to diagnose tauopathy in a subject.
[0450] In yet additional embodiments, provided is the use of an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein to monitor progress of tauopathy in a subject.
[0451] In yet additional embodiments, provided is the use of an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein for the diagnosis of tauopathy in a subject.
[0452] In yet additional embodiments, provided is the use of an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein for the monitor of progress of tauopathy in a subject.
[0453] In yet additional embodiments, provided is an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein for use in a method for diagnosing tauopathy in a subject.
[0454] In yet additional embodiments, provided is an antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof as disclosed herein for use in a method for monitoring progress of tauopathy in a subject.
[0455] In some embodiments, the method of diagnosing tauopathy in a subject comprises administering to the subject an effective amount of the antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof described herein; and imaging the brain of the subject.
[0456] In other embodiments, the method of diagnosing tauopathy in a subject comprises obtaining a sample of CSF or ISF from a subject; running an immunodiagnostic assay (e.g., ELISA) with the antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof described herein; and determining whether the subject has tauopathy.
[0457] In certain embodiments, the method of monitoring progress of tauopathy in a subject comprises administering to the subject an effective amount of the antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof described herein; and imaging the brain of the subject.
[0458] In other embodiments, the method of monitoring progress of tauopathy in a subject comprises obtaining a sample of CSF or ISF from a subject; running an immunodiagnostic assay (e.g., ELISA) with the antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof described herein; and determining progress of tauopathy in the subject.
[0459] In some embodiments of the various methods and uses described herein, the tauopathy is a neurodegenerative disease, including but not limited to Alzheimer's disease (AD), corticobasal degeneration (CBD) or corticobasal syndrome (CBS), progressive supranuclear palsy, Pick's disease, argyrophilic grain dementia (argyrophilic grain disease), multiple system tauopathy with presenile dementia (MSTD), frontotemporal dementia and parkinsonism linked to chromosome 17 (FTDP-17), dementia with neurofibrillary tangles, diffuse neurofibrillary tangle with calcification (DNTC), white matter tauopathy with globular glial inclusions (WMT-GGI), or frontotemporal lobar degeneration with tau pathology (FTLD-tau). In one embodiment, the tauopathy is AD. In another embodiment, the tauopathy is CBD. In yet another embodiment, the tauopathy is progressive supranuclear palsy. In still another embodiment, the tauopathy is Pick's disease. In one embodiment, the tauopathy is argyrophilic grain dementia. In another embodiment, the tauopathy is MSTD. In yet another embodiment, the tauopathy is FTDP-17. In still another embodiment, the tauopathy is dementia with neurofibrillary tangles. In one embodiment, the tauopathy is DNTC. In another embodiment, the tauopathy is WMT-GGI. In yet another embodiment, the tauopathy is FTLD-tau.
[0460] In other embodiments of the various methods and uses described herein, the tauopathy is a non-neurodegenerative disease, including but not limited to infectious diseases, such as Economo's encephalitis sequela and subacute sclerosing panencephalitis, and trauma-induced conditions, such as boxer's encephalopathy. In one embodiment, the tauopathy is Economo's encephalitis sequela. In another embodiment, the tauopathy is subacute sclerosing panencephalitis. In yet another embodiment, the tauopathy is boxer's encephalopathy.
Nucleic Acids, Expression Vectors, Cells, and Methods of Making Anti-Tau-pS413 Antibodies or Antigen Binding Fragments Thereof
[0461] Also provided herein are isolated nucleic acids and vectors comprising polynucleotide sequences encoding such high affinity antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) disclosed herein or antigen binding fragments thereof, cells (e.g., host cells) comprising such isolated nucleic acids or vectors, and methods of making such high affinity antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof.
[0462] In one aspect, provided is an isolated nucleic acid encoding various polypeptides disclosed herein.
[0463] In certain embodiments, the isolated nucleic acid encodes the VH (e.g., SEQ ID NO:44, 48, 52, 56, or 24) of various antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof disclosed herein. In some embodiments, the isolated nucleic acid encodes the VL (e.g., SEQ ID NO:32, 36, 40, 28, or 20) of various antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof disclosed herein. In other embodiments, the isolated nucleic acid encodes the VH (e.g., SEQ ID NO:44, 48, 52, 56, or 24) and the VL (e.g., SEQ ID NO:32, 36, 40, 28, or 20) of various antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof disclosed herein.
[0464] In certain embodiments, the isolated nucleic acid encodes the heavy chain (e.g., SEQ ID NO:72, 74 or 76) of various antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof disclosed herein. In some embodiments, the isolated nucleic acid encodes the light chain (e.g., SEQ ID NO:71, 73, or 75) of various antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof disclosed herein. In other embodiments, the isolated nucleic acid encodes the heavy chain (e.g., SEQ ID NO:72, 74 or 76) and the light chain (e.g., SEQ ID NO:71, 73, or 75) of various antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof disclosed herein.
[0465] In one embodiment, the isolated nucleic acid encodes a VH domain comprising the VH-CDR1, VH-CDR2 and VH-CDR3 as disclosed in TABLE 5.
[0466] In another embodiment, the isolated nucleic acid encodes a VL domain comprising the VL-CDR1, VL-CDR2 and VL-CDR3 as disclosed in TABLE 6.
[0467] In yet another embodiment, the isolated nucleic acid encodes a VH domain comprising the VH-CDR1, VH-CDR2 and VH-CDR3 as disclosed in TABLE 5 and a VL domain comprising the VL-CDR1, VL-CDR2 and VL-CDR3 as disclosed in TABLE 6.
[0468] In a specific embodiment, the isolated nucleic acid comprises a nucleotide sequence as set forth in SEQ ID NO:107. In another specific embodiment, the isolated nucleic acid comprises a nucleotide sequence as set forth in SEQ ID NO:108.
[0469] In still another embodiment, the nucleic acids further encode a signal sequence.
[0470] In another aspect, provided is an expression vector comprising one or more of the various isolated nucleic acids disclosed herein, wherein the nucleic acid(s) is operably linked to control sequences that are recognized by a host cell when the host cell is transfected with the expression vector.
[0471] In yet another aspect, provided is host cell comprising one or more of the various isolated nucleic acids or the various expression vectors disclosed herein. In some embodiments, the host cell comprises one or more of the various isolated nucleic acids disclosed herein. In other embodiments, the host cell comprises one or more of the various expression vectors disclosed herein.
[0472] In still another aspect, provided are methods of making the antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof disclosed herein, comprising: culturing a host cell comprising an expression vector encoding the antibody or antigen binding fragment thereof in culture medium under conditions wherein the antibody or antigen binding fragment thereof is expressed.
[0473] Also provided are methods of making the antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof disclosed herein, comprising: expressing an expression vector that comprises one or more isolated nucleic acid(s) disclosed herein under conditions wherein the antibody or antigen binding fragment thereof is expressed.
[0474] Further provided are methods of making the antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof disclosed herein, comprising: expressing one or more isolated nucleic acid(s) disclosed herein under conditions wherein the antibody or antigen binding fragment thereof is expressed.
[0475] In certain embodiments of various methods of making the antibody (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragment thereof disclosed herein, the method further comprises isolating the antigen or antigen binding fragment thereof from the host cell or culture medium, or in vitro expression system.
[0476] Mammalian cell lines available as hosts for expression of the antibodies or fragments disclosed herein are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC). These include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells, HEK-293 cells and a number of other cell lines. Other cell lines that may be used are insect cell lines, such as Sf9 cells, amphibian cells, bacterial cells, plant cells and fungal cells. Various modifications can be introduced into the genome of these cell lines (e.g., glutamine synthetase knockout, auxotrophic mutations, etc.) to achieve desired properties of the host cells and/or desired properties of the expressed antibodies or antigen binding fragments thereof.
[0477] When recombinant expression vectors encoding the heavy chain or antigen binding fragment thereof and/or the light chain or antigen binding fragment thereof are introduced into host cells, the antibody or antigen binding fragment thereof is produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody or antigen binding fragment thereof in the host cells or, more preferably, secretion of the antibody or antigen binding fragment thereof into the culture medium in which the host cells are grown.
[0478] Antibodies can be recovered from the culture medium using standard protein purification methods.
[0479] In general, glycoproteins produced in a particular cell line or transgenic animal will have a glycosylation pattern that is characteristic for glycoproteins produced in the cell line or transgenic animal. Therefore, the particular glycosylation pattern of an antibody will depend on the particular cell line or transgenic animal used to produce the antibody. However, all antibodies encoded by the nucleic acid molecules provided herein, or comprising the amino acid sequences provided herein, comprise the instant invention, independent of the glycosylation pattern the antibodies may have. Similarly, in particular embodiments, antibodies with a glycosylation pattern comprising only non-fucosylated N-glycans may be advantageous, because these antibodies have been shown to typically exhibit more potent efficacy than their fucosylated counterparts both in vitro and in vivo (See for example, Shinkawa et al., J. Biol. Chem. 278: 3466-3473 (2003); U.S. Pat. Nos. 6,946,292 and 7,214,775). These antibodies with non-fucosylated N-glycans are not likely to be immunogenic because their carbohydrate structures are a normal component of the population that exists in human serum IgG.
Pharmaceutical Compositions and Administration
[0480] In another aspect, provided is a composition comprising the anti-tau-pS413 antibodies (e.g., various isotypes of V1-AFM, V2-AFM, V3-AFM, V4-AFM, V5-AFM, V6-AFM, V7-AFM, or V8-AFM) or antigen binding fragments thereof described herein and a pharmaceutically acceptable carrier.
[0481] In some embodiments, the composition further comprises an additional agent.
[0482] In particular embodiments, the additional agent is an agent effective to treat the same or different disorder as the anti-tau-pS413 antibodies or antigen-binding fragments thereof disclosed herein are being used to treat. In some embodiments, the additional agent is an agent effective to relieve side effects of the anti-tau-pS413 antibodies or antigen-binding fragments thereof disclosed herein. Exemplary additional agents include, but are not limited to: cholinesterase inhibitors (such as donepezil, galantamine, rovastigmine, and tacrine), NMDA receptor antagonists (such as memantine), amyloid beta peptide aggregation inhibitors, antioxidants, gamma-secretase modulators, nerve growth factor (NGF) mimics or NGF gene therapy, PPARγ agonists, HMS-CoA reductase inhibitors (statins), ampakines, calcium channel blockers, GABA receptor antagonists, glycogen synthase kinase inhibitors, intravenous immunoglobulin, muscarinic receptor agonists, nicotinic receptor modulators, active or passive amyloid beta peptide for immunization, phosphodiesterase inhibitors, serotonin receptor antagonists, anti-amyloid beta peptide antibodies, growth hormone, neurotrophic factor, brain-derived neurotrophic factor (BDNF), nerve growth factor (NGF), neurotrophin-4/5, fibroblast growth factor (FGF)-2 and other FGFs, neurotrophin (NT)-3, erythropoietin (EPO), hepatocyte growth factor (HGF), epidermal growth factor (EGF), transforming growth factor (TGF)-alpha, TGF-beta, vascular endothelial growth factor (VEGF), interleukin-1 receptor antagonist (IL-lra), ciliary neurotrophic factor (CNTF), glial-derived neurotrophic factor (GDNF), neurturin, platelet-derived growth factor (PDGF), heregulin, neuregulin, artemin, persephin, interleukins, glial cell line derived neurotrophic factor (GFR), granulocyte-colony stimulating factor (CSF), granulocyte-macrophage-CSF, netrins, cardiotrophin-1, hedgehogs, leukemia inhibitory factor (LIF), midkine, pleiotrophin, bone morphogenetic proteins (BMPs), netrins, saposins, semaphorins, stem cell factor (SCF), or a different anti-tau antibody.
[0483] To prepare pharmaceutical or sterile compositions of the anti-tau-pS413 antibody or antigen binding fragment thereof described herein, the antibody or antigen binding fragment thereof is admixed with a pharmaceutically acceptable carrier or excipient. See, e.g., Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary, Mack Publishing Company, Easton, Pa. (1984).
[0484] Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Tablets, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Disperse Systems, Marcel Dekker, NY; Weiner and Kotkoskie (2000) Excipient Toxicity and Safety, Marcel Dekker, Inc., New York, N.Y.).
[0485] Toxicity and therapeutic efficacy of the antibody compositions, administered alone or in combination with another agent, can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD.sub.50 (the dose lethal to 50% of the population) and the ED.sub.50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index (LD.sub.50/ED.sub.50). In particular aspects, antibodies exhibiting high therapeutic indices are desirable. The data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in human. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED.sub.50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration.
[0486] In a further embodiment, a composition comprising an antibody or antibody fragment disclosed herein is administered to a subject in accordance with the Physicians' Desk Reference 2003 (Thomson Healthcare; 57th edition (Nov. 1, 2002)).
[0487] The mode of administration can vary. Suitable routes of administration include oral, rectal, transmucosal, intestinal, parenteral, intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or intra-arterial.
[0488] In particular embodiments, the anti-tau-pS413 antibody or antigen binding fragment thereof can be administered by an invasive route such as by injection (see above). In further embodiments of the invention, the anti-tau-pS413 antibody or antigen binding fragment thereof, or pharmaceutical composition thereof, is administered intravenously, subcutaneously, intrathecally, intramuscularly, or intracerebrally. In one specific embodiment, the anti-tau-pS413 antibody or antigen binding fragment thereof, or pharmaceutical composition thereof, is administered intravenously. In another specific embodiment, the anti-tau-pS413 antibody or antigen binding fragment thereof, or pharmaceutical composition thereof, is administered subcutaneously. In yet another specific embodiment, the anti-tau-pS413 antibody or antigen binding fragment thereof, or pharmaceutical composition thereof, is administered intrathecally. In still another specific embodiment, the anti-tau-pS413 antibody or antigen binding fragment thereof, or pharmaceutical composition thereof, is administered intramuscularly. In still another specific embodiment, the anti-tau-pS413 antibody or antigen binding fragment thereof, or pharmaceutical composition thereof, is administered intracerebrally.
[0489] Compositions can be administered with medical devices known in the art. For example, a pharmaceutical composition of the invention can be administered by injection with a hypodermic needle, including, e.g., a prefilled syringe or autoinjector.
[0490] The pharmaceutical compositions disclosed herein may also be administered by infusion.
[0491] The administration regimen depends on several factors, including the serum or tissue turnover rate of the therapeutic antibody, the ratio of the therapeutic antibody that crosses the blood-brain barrier, the level of symptoms, the immunogenicity of the therapeutic antibody, and the accessibility of the target cells in the biological matrix. Preferably, the administration regimen delivers sufficient therapeutic antibody to effect improvement in the target disease state, while simultaneously minimizing undesired side effects. Accordingly, the amount of biologic delivered depends in part on the particular therapeutic antibody and the severity of the condition being treated. Guidance in selecting appropriate doses of therapeutic antibodies is available (see, e.g., Wawrzynczak (1996) Antibody Therapy, Bios Scientific Pub. Ltd, Oxfordshire, UK; Kresina (ed.) (1991) Monoclonal Antibodies, Cytokines and Arthritis, Marcel Dekker, New York, N.Y.; Bach (ed.) (1993) Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases, Marcel Dekker, New York, N.Y.; Baert, et al. (2003) New Engl. J. Med. 348:601-608; Milgrom et al. (1999) New Engl. J. Med. 341:1966-1973; Slamon et al. (2001) New Engl. J. Med. 344:783-792; Beniaminovitz et al. (2000) New Engl. J. Med. 342:613-619; Ghosh et al. (2003) New Engl. J. Med. 348:24-32; Lipsky et al. (2000) New Engl. J. Med. 343:1594-1602).
[0492] Determination of the appropriate dose is made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment. Generally, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects. In general, it is desirable that a biologic that will be used is derived from the same species as the animal targeted for treatment, thereby minimizing any immune response to the reagent. In the case of human subjects, for example, chimeric, humanized and fully human antibodies are may be desirable.
[0493] As previously described, the anti-tau-pS413 antibodies or antigen binding fragments thereof may be coadministered with one or more additional agents. The antibody may be linked to the agent (as an immunocomplex) or can be administered separately from the agent (fixed dose). In the latter case (separate administration), the antibody can be administered before, after, or concurrently with the agent or can be co-administered with other known therapies.
Kits
[0494] Also provided herein are kits comprising an antibody (e.g., an anti-tau-pS413 antibody) provided herein, or a composition (e.g., a pharmaceutical composition) thereof, packaged into suitable packaging material. A kit optionally includes a label or packaging insert including a description of the components or instructions for use in vitro, in vivo, or ex vivo, of the components therein.
[0495] The term “packaging material” refers to a physical structure housing the components of the kit. The packaging material can maintain the components sterilely, and can be made of material commonly used for such purposes (e.g., paper, corrugated fiber, glass, plastic, foil, ampoules, vials, tubes, etc.).
[0496] Kits provided herein can include labels or inserts. Labels or inserts include “printed matter,” e.g., paper or cardboard, separate or affixed to a component, a kit or packing material (e.g., a box), or attached to, for example, an ampoule, tube, or vial containing a kit component. Labels or inserts can additionally include a computer readable medium, such as a disk (e.g., hard disk, card, memory disk), optical disk such as CD- or DVD-ROM/RAM, DVD, MP3, magnetic tape, or an electrical storage media such as RAM and ROM or hybrids of these such as magnetic/optical storage media, FLASH media, or memory type cards. Labels or inserts can include information identifying manufacturer information, lot numbers, manufacturer location, and date.
[0497] Kits provided herein can additionally include other components. Each component of the kit can be enclosed within an individual container, and all of the various containers can be within a single package. Kits can also be designed for cold storage. A kit can further be designed to contain antibodies provided herein, or cells that contain nucleic acids encoding the antibodies provided herein. The cells in the kit can be maintained under appropriate storage conditions until ready to use.
GENERAL METHODS
[0498] Standard methods in molecular biology are described in Sambrook, Fritsch and Maniatis (1982 & 1989 2.sup.nd Edition, 2001 3.sup.rd Edition) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Sambrook and Russell (2001) Molecular Cloning, 3.sup.rd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Wu (1993) Recombinant DNA, Vol. 217, Academic Press, San Diego, Calif.). Standard methods also appear in Ausbel, et al. (2001) Current Protocols in Molecular Biology, Vols. 1-4, John Wiley and Sons, Inc. New York, N.Y., which describes cloning in bacterial cells and DNA mutagenesis (Vol. 1), cloning in mammalian cells and yeast (Vol. 2), glycoconjugates and protein expression (Vol. 3), and bioinformatics (Vol. 4).
[0499] Methods for protein purification including immunoprecipitation, chromatography, electrophoresis, centrifugation, and crystallization are described (Coligan, et al. (2000) Current Protocols in Protein Science, Vol. 1, John Wiley and Sons, Inc., New York). Chemical analysis, chemical modification, post-translational modification, production of fusion proteins, glycosylation of proteins are described (see, e.g., Coligan, et al. (2000) Current Protocols in Protein Science, Vol. 2, John Wiley and Sons, Inc., New York; Ausubel, et al. (2001) Current Protocols in Molecular Biology, Vol. 3, John Wiley and Sons, Inc., NY, N.Y., pp. 16.0.5-16.22.17; Sigma-Aldrich, Co. (2001) Products for Life Science Research, St. Louis, Mo.; pp. 45-89; Amersham Pharmacia Biotech (2001) BioDirectory, Piscataway, N.J., pp. 384-391). Production, purification, and fragmentation of polyclonal and monoclonal antibodies are described (Coligan, et al. (2001) Current Protocols in Immunology, Vol. 1, John Wiley and Sons, Inc., New York; Harlow and Lane (1999) Using Antibodies, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Harlow and Lane, supra). Standard techniques for characterizing ligand/receptor interactions are available (see, e.g., Coligan, et al. (2001) Current Protocols in Immunology, Vol. 4, John Wiley, Inc., New York).
[0500] Monoclonal, polyclonal, and humanized antibodies can be prepared (see, e.g., Sheperd and Dean (eds.) (2000) Monoclonal Antibodies, Oxford Univ. Press, New York, N.Y.; Kontermann and Dubel (eds.) (2001) Antibody Engineering, Springer-Verlag, New York; Harlow and Lane (1988) Antibodies A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., pp. 139-243; Carpenter, et al. (2000) J. Immunol. 165:6205; He, et al. (1998) J. Immunol. 160:1029; Tang et al. (1999) J. Biol. Chem. 274:27371-27378; Baca et al. (1997) J. Biol. Chem. 272:10678-10684; Chothia et al. (1989) Nature 342:877-883; Foote and Winter (1992)J Mol. Biol. 224:487-499; U.S. Pat. No. 6,329,511).
[0501] An alternative to humanization is to use human antibody libraries displayed on phage or human antibody libraries in transgenic mice (Vaughan et al. (1996) Nature Biotechnol. 14:309-314; Barbas (1995) Nature Medicine 1:837-839; Mendez et al. (1997) Nature Genetics 15:146-156; Hoogenboom and Chames (2000) Immunol. Today 21:371-377; Barbas et al. (2001) Phage Display: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Kay et al. (1996) Phage Display of Peptides and Proteins: A Laboratory Manual, Academic Press, San Diego, Calif.; de Bruin et al. (1999) Nature Biotechnol. 17:397-399).
[0502] Methods for flow cytometry, including fluorescence activated cell sorting (FACS), are available (see, e.g., Owens, et al. (1994) Flow Cytometry Principles for Clinical Laboratory Practice, John Wiley and Sons, Hoboken, N.J.; Givan (2001) Flow Cytometry, 2.sup.nd ed.; Wiley-Liss, Hoboken, N.J.; Shapiro (2003) Practical Flow Cytometry, John Wiley and Sons, Hoboken, N.J.). Fluorescent reagents suitable for modifying nucleic acids, including nucleic acid primers and probes, polypeptides, and antibodies, for use, e.g., as diagnostic reagents, are available (Molecular Probes (2003) Catalogue, Molecular Probes, Inc., Eugene, Oreg.; Sigma-Aldrich (2003) Catalogue, St. Louis, Mo.).
[0503] Standard methods of histology of the immune system are described (see, e.g., Muller-Harmelink (ed.) (1986) Human Thymus: Histopathology and Pathology, Springer Verlag, New York, N.Y.; Hiatt, et al. (2000) Color Atlas of Histology, Lippincott, Williams, and Wilkins, Phila, Pa.; Louis, et al. (2002) Basic Histology: Text and Atlas, McGraw-Hill, New York, N.Y.).
[0504] Software packages and databases for determining, e.g., antigenic fragments, leader sequences, protein folding, functional domains, glycosylation sites, and sequence alignments, are available (see, e.g., GenBank, Vector NTI® Suite (Informax, Inc, Bethesda, Md.); GCG Wisconsin Package (Accelrys, Inc., San Diego, Calif.); DeCypher® (TimeLogic Corp., Crystal Bay, Nev.); Menne, et al. (2000) Bioinformatics 16: 741-742; Menne, et al. (2000) Bioinformatics Applications Note 16:741-742; Wren, et al. (2002) Comput. Methods Programs Biomed. 68:177-181; von Heijne (1983) Eur. J. Biochem. 133:17-21; von Heijne (1986) Nucleic Acids Res. 14:4683-4690).
Example 1. Affinity Maturation and Point Mutation
[0505] HmzTa1505-hIgG4-S228P is a humanized antibody that was generated from the mouse parental antibody Ta1505-mIgG2a, the details of which are documented in WO 2018/254390.
[0506] Affinity maturation of HmzTa1505-hIgG4-S228P was performed via yeast display screening of a structure-based designed affinity maturation library. The library design was guided by the apo Ta1505 Fab crystal structure with the introduction of 79:7:7:7 non-equimolar (doped) partially randomized mutations at the DNA level to solvent-exposed heavy chain and light chain CDR residues. Three initial libraries were created and screened; the libraries consisted of mutations in CDR-H1/H2 (9 residues total), CDR-H3 (8 residues total), and CDR-VL (12 residues total). FACS sorting of yeast cells labeled with biotinylated tau-pS413 peptide and anti-kappa light chain was used to isolate leads with increased affinity while maintaining phospho-specificity. FACS sorted outputs from the initial libraries were later combined to generate a final combined VH/VL yeast display library for synergistic improvement and screened in the same manner. Thirty hits from the combined library were reformatted to hIgG4-S228P isotype and produced recombinantly, followed by Biacore and protein analytics. One of the top hits was V1-AFM-hIgG4-5228P, which showed a 10-fold improvement in monovalent affinity and >40× improvement in binding to phosphorylated Tau in AD patient cerebrospinal fluid (CSF), compared to HmzTa1505-hIgG4-S228P (see TABLE 8).
[0507] VH or VL from the top hits of affinity maturation were switched and matched with VL or VH of another top hit to generate more antibody variants.
[0508] An additional mutation (K54E or K54D) in various VHs was identified via structure-based design with the goal of identifying mutations that lowered the isoelectric point (pI) while maintaining or improving the affinity. The designs were guided by computational saturation mutagenesis and a co-crystal of Ta1505 Fab bound to a tau-pS413 peptide.
[0509] For example, addition of K54E to the VH of V1-AFM generated V6-AFM. V6-AFM-hIgG1-LALA-YTE showed lower pI (8.54) compared to V1-AFM-hIgG1-LALA-YTE (pI=8.87). Compared to V1-AFM, V6-AFM exhibited improved monovalent affinity to tau-pS413 on all 3 isotypes tested (hIgG1-LALA, hIgG1-LALA-YTE, and hIgG4-S228P) (see TABLE 8). Surprisingly, V6-AFM even exhibited improved production of the antibody molecules on IgG1-LALA isotype (data not shown) and IgG1-LALA-YTE isotype (
[0510] In another embodiment, K54E mutation in the VH of V2-AFM was replaced with K54D. Compared with a reference antibody (pI=8.28) having K at position 54 of the VH of V2-AFM, both E and D mutations at position 54 reduced the pI to 7.58. In addition, K54E and K54D mutations increased the KD of the reference antibody by 1.9- and 1.4-fold, respectively.
[0511] Finally, different heavy chain isotype constant regions (e.g., IgG1, IgG1-LALA, IgG1-LALA-YTE, IgG4, IgG4-S228P) were added to the VH of various exemplary antibodies.
[0512] Exemplary antibodies generated are described in TABLE 4. Corresponding SEQ ID NOs for various VH and VH-CDRs (defined by the Kabat numbering system) are listed in TABLE 5 and SEQ ID NOs for various VL and VL-CDRs (defined by the Kabat numbering system) are listed in TABLE 6. To illustrate how different CDR numbering systems affect the sequences of CDRs in an antibody, CDRs of V8-AFM defined by commonly used numbering systems are listed in TABLE 7.
TABLE-US-00004 TABLE 4 Exemplary antibodies Heavy Antibody Chain Description Name Isotype VH VL (heavy chain/light chain) Ta1505- mIgG2a Ta1505-VH Ta1505-VL Mouse × [MAPT_H] mIgG2a mAb (Ta1505) IgG2a/Kappa V0- hIgG1 VH11 VL46 Humanized × [MAPT_H] hIgG1 mAb (Ta1505 VL46/VH11) IgG1/Kappa (CX) V0- hIgG4 VH11 VL46 Humanized × [MAPT_H] hIgG4- (S228P) mAb (Ta1505 VL46/VH11) S228P IgG4 S228P/Kappa (CX) HmzTa1 hIgG4 VH11 VL46_G34A_S28N Humanized × [MAPT_H] 505- (S228P) mAb (Ta1505- hIgG4- VL46_G34A_S28N/VH11) S228P IgG4 S228P/Kappa (CX) V1- hIgG4 VH11_A59V_VD68G VL46_G34A_S28N_Q27H_S32R_H98Y Humanized Modified × [MAPT_H] AFM- (S228P) mAb (Ta1505-VH11_A59V_D68G/ hIgG4- VL46_G34A_S28N_Q27H_S32R_H98Y) S228P IgG4 S228P/Kappa (CX) V1- hIgG1 VH11_A59V_VD68G VL46_G34A_S28N_Q27H_S32R_H98Y Humanized × [MAPT_H] AFM- (LALA) mAb (Ta1505-VH11_A59V_D68G/ hIgG1- VL46_G34A_S28N_Q27H_S32R_H98Y) LALA IgG1 L234A L235A/Kappa (CX) V1- hIgG1 VH11_A59V_VD68G VL46_G34A_S28N_Q27H_S32R_H98Y Humanized × [MAPT_H] AFM- (LALA mAb (Ta1505-VH11_A59V_D68G/ hIgG1- YTE) VL46_G34A_S28N_Q27H_S32R_H98Y) LALA- IgG1 L234A L235A YTE/Kappa (CX) YTE V2- hIgG1 VH11_D68G_K54E VL46_G34A_S28N_Q27H_S32R_H98Y Humanized Modified × [MAPT_H] hIgG1- (LALA) mAb (Ta1505-VH11_D68G_K54E/ LALA VL46_G34A_S28N_Q27H_S32R_H98Y) IgG1 L234A L235A/Kappa (CX) V2- hIgG1 VH11_D68G_K54E VL46_G34A_S28N_Q27H_S32R_H98Y Humanized Modified × [MAPT_H] hIgG1- (LALA mAb (Ta1505-VH11_D68G_K54E/ LALA- YTE) VL46_G34A_S28N_Q27H_S32R_H98Y) YTE IgG1 L234A L235A YTE/Kappa (CX) V3- hIgG4 VH11_D68G VL46_G34A_S28K_S32R_H98Y Humanized × [MAPT_H] AFM- (S228P) mAb (Ta1505-VH11_D68G/Ta1505- hIgG4- VL46_G34A_S28K_S32R_H98Y) IgG4 S228P S228P/Kappa (CX) V4- hIgG1 VH11_D68G_K54E VL46_G34A_S28K_S32R_H98Y Humanized Modified × [MAPT_H] AFM- (LALA) mAb (Ta1505-VH11_D68G_K54E/ hIgG1- VL46_G34A_S28K_S32R_H98Y) IgG1 LALA L234A L235A/Kappa (CX) V4- hIgG1 VH11_D68G_K54E VL46_G34A_S28K_S32R_H98Y Humanized Modified × [MAPT_H] AFM- (LALA mAb (Ta1505-VH11_D68G_K54E/ hIgG1- YTE) VL46_G34A_S28K_S32R_H98Y) IgG1 LALA- L234A L235A YTE/Kappa (CX) YTE V5- hIgG4 VH11_A59V_VD68G VL46_G34A_S28K_S32R_H98Y Humanized × [MAPT_H] AFM- (S228P) mAb (Ta1505-VH11_A59V_D68G/ hIgG4- VL46_G34A_S28K_S32R_H98Y) IgG4 S228P S228P/Kappa (CX) V6- hIgG4 VH11_A59V_D68G_K54E VL46_G34A_S28N_Q27H_S32R_H98Y Humanized Modified × [MAPT_H] AFM- (S228P) mAb (Ta1505-VH11_A59V_D68G_K54E/ hIgG4- VL46_G34A_S28N_Q27H_S32R_H98Y) S228P IgG4 S228P/Kappa (CX) V6- hIgG1 VH11_A59V_D68G_K54E VL46_G34A_S28N_Q27H_S32R_H98Y Humanized Modified × [MAPT_H] AFM- (LALA) mAb (Ta1505-VH11_A59V_D68G_K54E/ hIgG1- VL46_G34A_S28N_Q27H_S32R_H98Y) LALA IgG1 L234A L235A/Kappa (CX) V6- hIgG1 VH11_A59V_D68G_K54E VL46_G34A_S28N_Q27H_S32R_H98Y Humanized Modified × [MAPT_H] AFM- (LALA mAb (Ta1505-VH11_A59V_D68G_K54E/ hIgG1- YTE) VL46_G34A_S28N_Q27H_S32R_H98Y) LALA- IgG1 L234A L235A YTE/Kappa (CX) YTE V7- hIgG4 VH11 VL46_G34A_S28N_Q27R_S32R_H98Y Humanized × [MAPT_H] mAb AFM- (S228P) (Ta1505-VH11/ hIgG4- VL46_G34A_S28N_Q27R_S32R_H98Y) S228P IgG4 S228P/Kappa (CX) V7- hIgG1 VH11 VL46_G34A_S28N_Q27R_S32R_H98Y Humanized × [MAPT_H] AFM- (LALA) mAb (Ta1505-VH11/ hIgG1- VL46_G34A_S28N_Q27R_S32R_H98Y) LALA IgG1 L234A L235A/Kappa (CX) V7- hIgG1 VH11 VL46_G34A_S28N_Q27R_S32R_H98Y Humanized × [MAPT_H] AFM- (LALA mAb (Ta1505-VH11/ hIgG1- YTE) VL46_G34A_S28N_Q27R_S32R_H98Y) LALA- IgG1 L234A L235A YTE/Kappa (CX) YTE V8- hIgG4 VH11_A59V_D68G_K54E VL46_G34A_S28K_S32R_H98Y Humanized Modified × [MAPT_H] AFM- (S228P) mAb (Ta1505-VH11_A59V_D68G_K54E/ hIgG4- VL46_G34A_S28K_S32R_H98Y) IgG4 S228P S228P/Kappa (CX) V8- hIgG1 VH11_A59V_D68G_K54E VL46_G34A_S28K_S32R_H98Y Humanized Modified × [MAPT_H] AFM- (LALA) mAb (Ta1505-VH11_A59V_D68G_K54E/ hIgG1- VL46_G34A_S28K_S32R_H98Y) IgG1 LALA L234A L235A/Kappa (CX) V8- hIgG1 VH11_A59V_D68G_K54E VL46_G34A_S28K_S32R_H98Y Humanized Modified × [MAPT_H] AFM- (LALA mAb (Ta1505-VH11_A59V_D68G_K54E/ hIgG1- YTE) VL46_G34A_S28K_S32R_H98Y) IgG1 LALA- L234A L235A YTE/Kappa (CX) YTE
TABLE-US-00005 TABLE 5 SEQ ID NOs for VH and VH-CDRs (defined by the Kabat numbering system) Heavy chain name VH-CDR1 VH-CDR2 VH-CDR3 VH VH11_D68G SEQ ID SEQ ID SEQ ID SEQ ID NO: 41 NO: 42 NO: 43 NO: 44 VH11_A59V_D68G SEQ ID SEQ ID SEQ ID SEQ ID NO: 45 NO: 46 NO: 47 NO: 48 VH11_D68G_K54E SEQ ID SEQ ID SEQ ID SEQ ID NO: 49 NO: 50 NO: 51 NO: 52 VH11_A59V_D68G_K54E SEQ ID SEQ ID SEQ ID SEQ ID NO: 53 NO: 54 NO: 55 NO: 56 VH11 SEQ ID SEQ ID SEQ ID SEQ ID NO: 21 NO: 22 NO: 23 NO: 24
TABLE-US-00006 TABLE 6 SEQ ID NOs for VL and VL-CDRs (defined by the Kabat numbering system) Light chain name VL-CDR1 VL-CDR2 VL-CDR3 VL VL46_G34A_S28N_Q27R_S32R_H98Y SEQ ID SEQ ID SEQ ID SEQ ID NO: 29 NO: 30 NO: 31 NO: 32 VL46_G34A_S28K_S32R_H98Y SEQ ID SEQ ID SEQ ID SEQ ID NO: 33 NO: 34 NO: 35 NO: 36 VL46_G34A_S28N_Q27H_S32R_H98Y SEQ ID SEQ ID SEQ ID SEQ ID NO: 37 NO: 38 NO: 39 NO: 40 VL46_G34A_S28N SEQ ID SEQ ID SEQ ID SEQ ID NO: 25 NO: 26 NO: 27 NO: 28 VL46 SEQ ID SEQ ID SEQ ID SEQ ID NO: 17 NO: 18 NO: 19 NO: 20
TABLE-US-00007 TABLE 7 CDR sequences of V8-AFM defined by different numbering systems CDR name Kabat AbM Chothia Contact IMGT VL-CDR1 RSSQKIVH RSSQKIVHR RSSQKIVH VHRNANTY QKIVHRNA RNANTYLE NANTYLE RNANTYLE LEWY NTY (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID NO: 33) NO: 83) NO: 89) NO: 95) NO: 101) VL-CDR2 TVSNRFS TVSNRFS TVSNRFS LLIYTVSNRF TV (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID NO: 34) NO: 84) NO: 90) NO: 96) NO: 102) VL-CDR3 FQGSYLPLT FQGSYLPLT FQGSYLPLT FQGSYLPL FQGSYLPLT (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID NO: 35) NO: 85) NO: 91) NO: 97) NO: 103) VH-CDR1 SFALN GFTFSSFALN GFTFSSF SSFALN GFTFSSFA (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID NO: 53) NO: 86) NO: 92) NO: 98) NO: 104) vH-CDR2 HIRSETNN HIRSETNNY RSETNNYV WVGHIRSE IRSETNNYV YVTFYAA VTF (SEQ ID TNNYVTF (SEQ ID SVKG (SEQ ID NO: 93) (SEQ ID NO: 105) (SEQ ID NO: 54) NO: 87) NO: 99) VH-CDR3 RGPRDSW RGPRDSWFG RGPRDSWF VRRGPRDS VRRGPRDS FGY Y GY WFG WFGY (SEQ (SEQ ID (SEQ ID (SEQ (SEQ ID NO: 55) NO: 88) NO: 94) ID NO: 100) ID NO: 106)
[0513] Sequence alignment among exemplary VHs is shown in
Example 2. Determination of Binding Affinity to Tau-pS413 Peptide by Surface Plasmon Resonance (SPR)
[0514] SPR assay was used to determine the monovalent binding affinities of mAbs to a tau-pS413 peptide (SEQ ID NO:109). Antibodies were amine coupled to a CMS sensor chip at approximately 1000 RUs each. Binding assays were performed using HBS-EP running buffer containing 3 mM EDTA and 0.05% Tween-20, pH 7.4. Titrating concentrations (200 nM top for HmzTa1505-hIgG4-S228P, 80 nM top for all other mAbs, 6-point, 2.5-fold dilution series and two zeros) of the tau-pS413 peptide were injected over the immobilized mAbs. For each injection, the tau-pS413 peptide was allowed to associate for 180 seconds, followed by dissociation for 900 seconds. Each sample injection was followed by an injection of 20 mM sodium acetate, pH 3.5, for 60 seconds to regenerate the surface for subsequent injection. All assays were run on Biacore T200 and/or 4000 instruments (GE Healthcare) and the data were fit to a 1:1 binding model using Biaevaluation software. Affinity was calculated from association and dissociation rate constants as K.sub.D=k.sub.off/k.sub.on.
[0515] All mAbs bound the tau-pS413 peptide (TABLE 8). All affinity matured antibody variants (V1-AFM through V8-AFM) exhibited about 2- to about 30-fold affinity increase compared to HmzTa1505-hIgG4-S228P.
TABLE-US-00008 TABLE 8 Binding affinity of exemplary antibodies to tau-pS413 peptide KD of HmzTa1505- hIgG4-S228P/KD Antibody name KD (M) mean (fold-change) Ta1505-mIgG2a 9.40E−09 3.09 V0-hIgG1 2.43E−08 1.19 V0-hIgG4-S228P 3.93E−08 0.74 HmzTa1505-hIgG4-S228P 2.90E−08 1.00 V1-AFM-hIgG4-S228P 2.81E−09 10.31 V1-AFM-hIgG1-LALA 1.40E−09 20.66 V1-AFM-hIgG1-LALA-YTE 1.74E−09 16.67 V2-AFM-hIgG1-LALA 1.87E−09 15.51 V2-AFM-hIgG1-LALA-YTE 1.96E−09 14.80 V3-AFM-hIgG4-S228P 1.31E−08 2.22 V4-AFM-hIgG1-LALA 6.83E−09 4.25 V4-AFM-hIgG1-LALA-YTE 3.26E−09 8.89 V5-AFM-hIgG4-S228P 3.57E−09 8.12 V6-AFM-hIgG4-S228P 1.35E−09 21.43 V6-AFM-hIgG1-LALA 1.02E−09 28.50 V6-AFM-hIgG1-LALA-YTE 9.75E−10 29.77 V7-AFM-hIgG4-S228P 4.34E−09 6.69 V7-AFM-hIgG1-LALA 4.36E−09 6.65 V7-AFM-hIgG1-LALA-YTE 3.82E−09 7.59 V8-AFM-hIgG4-S228P 2.26E−09 12.81 V8-AFM-hIgG1-LALA 1.76E−09 16.52 V8-AFM-hIgG1-LALA-YTE 1.92E−09 15.13
Example 3. The High Affinity Anti-Tau-pS413 Antibodies Bind Specifically to Tau Peptide Phosphorylated at Serine 413
[0516] Binding specificity of the high affinity antibodies described herein was assessed with various tau peptides by a peptide-coated ELISA. Plates were coated with 50 μl of 1 μg/ml peptides 69AXY, 70AXY, 74AXY, 84AWK, 25AWF, or 24AWF in PBS for overnight at 4° C. On the next day, the plates were washed 3 times, blocked with 200 μl of superblock for 1 hr at room temperature, then washed 3 times again. Antibodies were diluted at 1:5 serial dilution in ELISA buffer starting from 10 μg/ml. The plates were incubated with 50 μl of serially diluted antibodies at room temperature for 1 hr and washed 3 times. Then the plates were incubated with 50 μl of goat anti-mouse IgG-HRP (Southern Biotech, cat #1030-05) or goat anti-human IgG-HRP (Jackson Immunologics, cat #109-036-0980) diluted 1:3000 in ELISA buffer for 45 minutes at room temperature, washed 5 times, then developed with ABTS for 5 mins at room temperature and read at OD 405 nM.
[0517] The bindings of exemplary antibodies (V8-AFM-IgG1-LALA, V8-AFM-IgG1-LALA-YTE, V8-AFM-IgG4-S228P, V5-AFM-IgG4-S228P) are shown in
Example 4. Binding Affinity of the High Affinity Anti-Tau-pS413 Antibodies to FcRn at pH 6 and pH 7.4
[0518] SPR assay was used to determine the binding affinity of the high affinity antibodies described herein to human and cynomolgus monkey (cyno) FcRn at pH 6.0 and 7.4. Anti-human kappa antibody was amine coupled to a CMS chip. Each antibody was captured to 200-300 RUs. Binding assays were performed using PBS running buffer containing 0.05% Tween-20, adjusted to either pH 6.0 or 7.4. Titration samples were also prepared using the corresponding pH buffer for the assay. Titrating concentrations (1200 nM top, 6-point, 3-fold dilution series and two zeros) of human or cyno FcRn were injected over the captured mAbs. Each sample injection was followed by two 30-second injections of 10 mM glycine, pH 1.5 and a 12-second injection of 10 mM NaOH to regenerate the surface for subsequent antibody capture and injection. All assays were run on Biacore T200 and/or 4000 instruments (GE Healthcare) and the data were fit to a steady-state approximation model using Biaevaluation software. Affinity at pH 6.0 was calculated as equivalent to concentration at half maximal binding signal in the steady-state approximation (TABLE 9). At pH 7.4, no binding was detectable as expected (data not shown).
[0519] Affinities for the high affinity anti-tau-pS413 antibodies at pH 6.0 were in a typical range for FcRn. Due to YTE mutation, V8-AFM-IgG1-LALA-YTE showed about 6.5- and about 11-fold higher affinities against human and cyno FcRn, respectively (TABLE 9).
TABLE-US-00009 TABLE 9 Binding affinities of anti-tau-pS413 antibodies to human and cyno FcRn Human FcRn Cyno FcRn fold change fold change (relative to (relative to Human HmzTa1505- Cyno HmzTa1505- Antibody name FcRn hIgG4-S228P) FcRn hIgG4-S228P) V8-AFM- 2.3E−07 1 1.6E−07 1.6 hIgG1 LALA V8-AFM- 3.4E−08 6.5 2.4E−08 11 hIgG1 LALA-YTE V8-AFM- 2.1E−07 1 2.6E−07 1 hIgG4-S228P HmzTa1505- 2.2E−07 1 2.6E−07 1 hIgG4-S228P
Example 5. Binding Affinities of the High Affinity Anti-Tau-pS413 Antibodies to Brain Homogenates and CSF Samples from AD Patients and Preclinical Models by Competitive ELISA
[0520] Binding affinities of various anti-tau-pS413 antibodies described herein for endogenous tau species were determined in brain homogenates and CSF samples from AD patients and preclinical models. Briefly, samples were pre-incubated with different concentrations of various anti-tau-pS413 antibodies, or respective isotype controls. Following a one-hour pre-incubation period, the antigen-antibody (Ag-Ab) mixture was added to plates pre-coated with a total tau capture antibody (Innotest ELISA kit). Unbound (“free”) tau-pS413 in the brain homogenate or CSF sample was then detected by biotinylated Ta1505-mIgG2a antibody.
[0521] P2 extracts (fractions) were prepared as follows. Ten grams of pre-frontal cortex tissue (ABS Inc) were immersed in artificial CSF buffer (aCSF: 119 mM NaCl, 2.5 mM KCl, 1 mM NaH.sub.2PO.sub.4, 1.3 mM MgSO.sub.4, 2.5 mM CaCl.sub.2, 26 mM NaHCO.sub.3, 11 mM glucose, 10 mM HEPES, pH 7.4 and sterile water) with protease and phosphatase inhibitors (Pierce) at the dilution of tissue/buffer 1:5 (w/v). Tissue was homogenized by GentleMACS Dissociator. The lysed tissue was centrifuged at 3000 g for 20 minutes at 4° C. The supernatants were transferred to polycarbonate 50 ml centrifuge tubes and spun at 27,000 g for 20 minutes at 4° C. The supernatants were collected (S1 fraction) and further centrifuged at 150,000 g for 20 minutes at 4° C. The pellets were resuspended, P2 fraction, in aCSF buffer with protease and phosphatase inhibitors and sonicated for a few seconds using a probe sonicator. The concentration of the P2 fraction was determined by BCA protein assay (Pierce) and the P2 fraction were aliquoted and stored at −80° C.
[0522]
TABLE-US-00010 TABLE 10 Binding affinity of anti-tau-pS413 antibodies to AD brain homogenates Antibody name EC50 (M) HmzTa1505-hIgG4-S228P 6.50E−10 V1-AFM-hIgG4-S228P 3.23E−11 V1-AFM-hIgG1-LALA-YTE 3.10E−11 V2-AFM-hIgG1-LALA 3.90E−11 V3-AFM-hIgG4-S228P 2.55E−11 V5-AFM-hIgG4-S228P 3.10E−11 V6-AFM-hIgG4-S228P 2.23E−11 V7-AFM-hIgG1-LALA-YTE 4.10E−11 V8-AFM-hIgG1-LALA-YTE 2.60E−11 V8-AFM-hIgG1-LALA 2.60E−11 V8-AFM-hIgG4-S228P 2.50E−11
[0523] The high affinity anti-tau-pS413 antibodies described herein also bind to tau species in brain homogenates from mutant tau mice (rTg(tauP301L)4510) (Ramsden M et al., 2005, J. Neurosci. 25 (46) 10637-10647) and in the CSF from post-mortem AD patients and African Green Monkeys. Tissue homogenates were prepared using 1% sarkosyl buffer with several high-speed centrifugation steps to enrich for insoluble proteins including tau. Binding measures could not be assessed in CSF of the tau mutant mice because of the limited volume. The “effective” binding potencies of HmzTa1505-hIgG4-S228P and V8-AFM-hIgG1-LALA-YTE for the endogenous tau in the various biological specimens are about 2- to about 10-fold higher than the respective potencies for recombinant phosphorylated tau protein monomer used as standard (TABLE 11). These results suggest anti-tau-pS413 antibodies bind with an avidity component to the target tau species. The binding potencies of V8-AFM-hIgG1-LALA-YTE for these biological tau species are also about 30- to about 200-fold higher than those of HmzTa1505-hIgG4-S228P (TABLE 11).
TABLE-US-00011 TABLE 11 Binding potencies to tau species in brain homogenates and CSF samples from AD patients and preclinical models HmzTa1505- V8-AFM- hIgG4- hIgG1-LALA- S228P YTE EC50 EC50 Samples Description (nM) (nM) phosphorylated 35 AWM (1 ng) 6.73 0.055 tau protein monomer AD brain P2 high speed pellet 0.65 0.022 (50 ng proteins) Tau mutant SI Tau seeds (4 ng 0.67 0.004 mice brain protein) AD post AD patients (75 μl 0.82 (average, 0.004 (average, mortem CSF of neat CSF) n = 3) n = 2) Fresh African 4 AGMs (75 μl of 2.08 (average, 0.008 (average, Green Monkey neat CSF) n = 4) n = 2) (AGM) CSF
Example 6. In Vitro Cellular Potency of Neutralization of Seeding Assay in Hu-iPSC Neurons
[0524] To evaluate and compare the activities of HmzTa1505-hIgG4-S228P and representative high affinity antibodies V1-AFM-hIgG4-S228P and V8-AFM-hIgG1-LALA-YTE in disease cellular system, a model of tau pathology seeding was developed in human iPSC-derived neurons using (P2) extracts from brain homogenates of AD patients. This neutralization assay consisted of immunodepleting Tau species from P2 AD brain homogenates with tau antibodies or isotype control before seeding the P2 extract in hu-iPSC neuronal culture. The immunodepletion was performed using Dynabeads protein G after pre-incubation of 4 μg of total protein of P2 extract with various concentration of mAbs or corresponding isotype control (3 nM to 3 pM) of tau antibodies or isotype control for 4 hours. Five days after treatment, neurons were immuno-stained with MC1 antibody, a tau mAb specific for pathological tau conformation (provided by Dr. Peter Davies, Department of Pathology; Albert Einstein College of Medicine). Tau pathology was quantified with high-content image analysis based on immuno-staining of MC1 antibody (Representative images in
[0525] The immuno-depleted samples were tested in AlphaLISA® assay to confirm the successful immuno-depletion of total tau (Tau5/HT7 antibody pair,
[0526] Five days after treatment, neurons were immuno-stained with MC1 antibody. High-content image analysis showed that neutralization with HmzTa1505-hIgG4-S228P, V1-AFM-hIgG4-S228P, or V8-AFM-hIgG1-LALA-YTE significantly decreased MC1 tau pathology in neurons; however, maximum inhibition ˜70-90% of tau pathology was observed with 0.1 nM of high affinity variant V1-AFM-hIgG4-S228P or V8-AFM-hIgG1-LALA-YTE versus 3 nM of HmzTa1505-hIgG4-S228P (
Example 7. Efficacy of Anti-Tau-pS413 Antibodies in an AD-Derived Tau Hippocampal Injection Model Using Tau Transgenic Mice
[0527] Previous studies demonstrated a significant reduction in tau pathology following administration of Ta1505-mIgG2a with a trend towards decreases in pathology with increasing doses (see WO 2018/254390). The aim of this study was to determine if the murinized high affinity anti-tau-pS413 antibodies (e.g., V8-AFM-mIgG1), which showed a 40-fold increase binding potency for AD P2 brain extracts (0.013 nM for AFM-mIgG1 versus 0.51 nM for pTa1505, data not shown), was able to reduce tau pathology at lower doses than the parental antibody. An in vivo seeding model was used to evaluate the effect of Ta1505-mIgG1 (40 mg/kg, 10 mg/kg, 5 mg/kg), V8-AFM-mIgG1 (40 mg/kg, 10 mg/kg, 5 mg/kg, 1 mg/kg), or mIgG1 isotype control (40 mg/kg) on the development of tau pathology. Following the antibody treatment, Tg4510 mice (WT:Car) mice were injected into the hippocampus with Sarkosyl Insoluble (SI) Tau preparation from rTg(tauP301L)4510 mice (Car:Car) mice to elicit the transmission and of tau pathology around the injection site and spreading to other brain regions. Mice were then treated weekly with antibody injections. Thirty days after the initial dose, animals were necropsied and brain tissues were stained for tau hyperphosphorylated at amino acid positions 5202 and T205 (AT-8 at a dilution of 1:1500 revealed with chromogenic staining). Tau pathology was evaluated in the injected region of the hippocampus. Seven sections of each animal's hippocampus were quantified by Halo software for % of positive staining per area.
[0528]
TABLE-US-00012 TABLE 12 Plasma and CSF concentrations for mAb treatments groups at day 30 CSF/ Antibody Dose Plasma (nM) CSF (nM) plasma name (mg/kg) Mean SD Mean SD ratio V8-AFM-mIgG1 40 307.8 157..4 0.30 0.23 0.10% V8-AFM-mIgG1 10 116.7 76.3 0.35 0.65 0.30% V8-AFM-mIgG1 5 41.5 48.4 0.06 0.02 0.144% V8-AFM-mIgG1 1 38.8 45.8 BLQ BLQ BLQ Ta1505-mIgG1 40 6203 786.4 6.05 3.70 0.098% Ta1505-mIgG1 10 1558 383.3 1.21 0.50 0.078% Ta1505-mIgG1 5 1019 315.5 1.28 1.79 0.13%
TABLE-US-00013 TABLE 13 Percentage of reduction in tau pathology Treatment (antibody, dose) Percent reduction from mIgG1 control V8-AFM-mIgG1, 40 mg/kg 35% V8-AFM-mIgG1, 10 mg/kg 22% V8-AFM-mIgG1, 5 mg/kg 16% V8-AFM-mIgG1, 1 mg/kg 14% Ta1505-mIgG1, 40 mg/kg 45% Ta1505-mIgG1, 10 mg/kg 20% Ta1505-mIgG1, 5 mg/kg −2%
Example 8. Ex-Vivo Detection of Target Engagement by Anti-Tau-pS413 Antibodies in CSF Samples from Heathy Volunteers and AD Patients
[0529] An ultra-sensitive electro-chemiluminescent (ECL) assay on the Meso Scale Discovery S-Plex Platform was developed to measure a baseline level of tau-pS413 in human CSF and free (i.e., unbound) tau-pS413 in the presence of tau-pS413-specific antibodies. The method can be used to demonstrate target engagement by anti-tau-pS413 antibodies as a reduction in free tau-pS413 signal. In this sandwich immunoassay, biotinylated mouse monoclonal anti-tau-pS413 antibody Ta1505 was coated onto MSD 96-well S-PLEX SECTOR Plates (Mesoscale Discovery, cat No. L45SA) at 1 μg/mL with 1×S-PLEX Coating Reagent C1 (Mesoscale Discovery Cat No C20H0). CSF samples were diluted 1:2 in Diluent 100 (Mesoscale Discovery Cat. No R50AA) with 0.12 mg/mL Heterophilic S Blocking Reagent 1 (Scantibodies Cat No. 3KC534-075). After washing the coated plate with 1×PBST, 75 μL samples were loaded per well in addition to 75 μL Diluent 100 with 1×S-PLEX Blocking Reagent 51 (Mesoscale Discovery Cat No. R93AG). Samples were incubated overnight at 4° C. on an orbital shaker (700 rpm). After wash steps, the detection antibody, Turbo Boost-tagged Ta1505, was added to each well at 0.2 μg/mL in MSD Diluent 101 (Mesoscale Discovery Cat No. R51AD) and incubated for 1 hour at room temperature on orbital shaker (700 rpm). Color enhancement and development steps were performed following MSD S-PLEX protocol. Plates were read on MESO SECTOR™ 5600 instrument for electro-chemiluminescent signal (A.U.).
[0530] The ex-vivo binding of anti-tau-pS413 antibody was evaluated by quantitating tau-pS413 after incubating human non-AD or AD CSF samples with V8-AFM-hIgG1-LALA-YTE at titrated concentrations (0.085 fM to 50 nM) using the tau-pS413 MSD S-PLEX assay. The assay signal reduced with increasing concentration of V8-AFM-hIgG1-LALA-YTE (
[0531] All references cited herein are incorporated by reference to the same extent as if each individual publication, database entry (e.g. GenBank sequences or GeneID entries), patent application, or patent, was specifically and individually indicated to be incorporated by reference. This statement of incorporation by reference is intended by Applicants, pursuant to 37 C.F.R. § 1.57(b)(1), to relate to each and every individual publication, database entry (e.g. GenBank sequences or GeneID entries), patent application, or patent, each of which is clearly identified in compliance with 37 C.F.R. § 1.57(b)(2), even if such citation is not immediately adjacent to a dedicated statement of incorporation by reference. The inclusion of dedicated statements of incorporation by reference, if any, within the specification does not in any way weaken this general statement of incorporation by reference. Citation of the references herein is not intended as an admission that the reference is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents.
[0532] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and the accompanying figures. Such modifications are intended to fall within the scope of the appended claims.
[0533] The foregoing written specification is considered to be sufficient to enable one skilled in the art to practice the invention. Various modifications of the invention in addition to those shown and described herein will become apparent to those skilled in the art from the foregoing description and fall within the scope of the appended claims.
SEQUENCE LISTING
[0534] The present specification is being filed with a computer readable form (CRF) copy of Sequence Listing The CRF entitled 24996USNP-SEQTXT-21MAY2021-ST25.txt, which was created on May 21, 2021 and is 113,796 bytes in size, is identical to the paper copy of the Sequence Listing and is incorporated herein by reference in its entirety. TABLE 14 below summaries all sequences disclosed in the specification.
TABLE-US-00014 TABLE 14 Sequences disclosed in the specification SEQ Sequence (SEQ ID NO: 107 and 108 ID Sequence are nucleotide sequences, the NO Description rest are amino acid sequences) 1 Human tau isoform MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAG 4R2N LKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGA PGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQAR MVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANA TRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRS RTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPD LKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSK DNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTF RENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMV DSPQLATLADEVSASLAKQGL 2 Human tau isoform MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAG 4R1N LKESPLQTPTEDGSEEPGSETSDAKSTPTAEAEEAGIGDTPS LEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPR GAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGY SSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSA KSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKK LDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCG SLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPG GGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRH LSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL 3 Human tau isoform MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAG 4R0N LKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKA KGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPS SGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKV AVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKH QPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVY KPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQS KIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVY KSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASL AKQGL 4 Human tau isoform MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAG 3R2N LKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGA PGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQAR MVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANA TRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRS RTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPD LKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSL GNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGG NKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLS NVSSTGSIDMVDSPQLATLADEVSASLAKQGL 5 Human tau isoform MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAG 3R1N LKESPLQTPTEDGSEEPGSETSDAKSTPTAEAEEAGIGDTPS LEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPR GAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGY SSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSA KSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKP VDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKI GSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKS PVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAK QGL 6 Human tau isoform MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAG 3R0N LKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKA KGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPS SGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKV AVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKH QPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKS EKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAK AKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQL ATLADEVSASLAKQGL 7 Ta1505, VL-CDR1 RSSQNIVHSNGNTYLE 8 Ta1505, VL-CDR2 TVSNRFS 9 Ta1505, VL-CDR3 FQGSHLPLT 10 Ta1505, VL DILMTQTPLSLPVSLGDQASISCRSSQNIVHSNGNTYLEWYL QKPGQSPKVLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVE AEDLGVYYCFQGSHLPLTFGGGTKLELK 11 Ta1505, light chain DILMTQTPLSLPVSLGDQASISCRSSQNIVHSNGNTYLEWYL QKPGQSPKVLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVE AEDLGVYYCFQGSHLPLTFGGGTKLELKRADAAPTVSIFPPS SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSW TDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPI VKSFNRNEC 12 Ta1505, VH-CDR1 SFALN 13 Ta1505, VH-CDR2 HIRSKTNNYATFYADSVKD 14 Ta1505, VH-CDR3 RGPRDSWFGY 15 Ta1505, VH EVQLVESGGGLVQPKGSLKLSCAASGFAFNSFALNWVRQAPG KSLEWVVHIRSKTNNYATFYADSVKDRFTVSRDDSQSMVYLQ MNNLKTEDTGIYYCVRRGPRDSWFGYWGQGTLVTVSA EVQLVESGGGLVQPKGSLKLSCAASGFAFNSFALNWVRQAPG 16 Ta1505, heavy chain KSLEWVVHIRSKTNNYATFYADSVKDRFTVSRDDSQSMVYLQ MNNLKTEDTGIYYCVRRGPRDSWFGYWGQGTLVTVSAAKTTA PSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLS SGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPAS STKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIK DVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQ THREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPI ERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMP EDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKN WVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 17 VL46, VL-CDR1 RSSQSIVHSNGNTYLE 18 VL46, VL-CDR2 TVSNRFS 19 VL46, VL-CDR3 FQGSHLPLT 20 VL46, VL DIVMTQSPLSLPVTLGEPASISCRSSQSIVHSNGNTYLEWYL QKPGQSPQLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVE AEDLGVYYCFQGSHLPLTFGGGTKVEIK 21 VH11, VH-CDR1 SFALN 22 VH11, VH-CDR2 HIRSKTNNYATFYAASVKD 23 VH11, VH-CDR3 RGPRDSWFGY 24 VH11, VH EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPG KGLEWVGHIRSKTNNYATFYAASVKDRFTVSRDDSQNTAYLQ MNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVSS 25 VL46_G34A_S28N, RSSQNIVHSNANTYLE VL-CDR1 26 VL46_G34A_S28N, TVSNRFS VL-CDR2 27 VL46_G34A_S28N, FQGSHLPLT VL-CDR3 28 VL46_G34A_S28N, DIVMTQSPLSLPVTLGEPASISCRSSQNIVHSNANTYLEWYL VL QKPGQSPQLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVE AEDLGVYYCFQGSHLPLTFGGGTKVEIK 29 VL46_G34A_S28N_ RSSRNIVHRNANTYLE Q27R_S32R_H98Y, VL-CDR1 30 VL46_G34A_S28N_ TVSNRFS Q27R_S32R_H98Y, VL-CDR2 31 VL46_G34A_S28N_ FQGSYLPLT Q27R_S32R_H98Y, VL-CDR3 32 VL46_G34A_S28N_ DIVMTQSPLSLPVTLGEPASISCRSSRNIVHRNANTYLEWYL Q27R_S32R_H98Y, QKPGQSPQLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVE VL AEDLGVYYCFQGSYLPLTFGGGTKVEIK 33 VL46_G34A_S28K_ RSSQKIVHRNANTYLE S32R_H98Y, VL-CDR1 34 VL46_G34A_S28K_ TVSNRFS S32R_H98Y, VL-CDR2 35 VL46_G34A_S28K_ FQGSYLPLT S32R_H98Y, VL-CDR3 36 VL46_G34A_S28K_ DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYL S32R_H98Y, VL QKPGQSPQLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVE AEDLGVYYCFQGSYLPLTFGGGTKVEIK 37 VL46_G34A_S28N_ RSSHNIVHRNANTYLE Q27H_S32R_H98Y, VL-CDR1 38 VL46_G34A_S28N_ TVSNRFS Q27H_S32R_H98Y, VL-CDR2 39 VL46_G34A_S28N_ FQGSYLPLT Q27H_S32R_H98Y, VL-CDR3 40 VL46_G34A_S28N_ DIVMTQSPLSLPVTLGEPASISCRSSHNIVHRNANTYLEWYL Q27H_S32R_H98Y, QKPGQSPQLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVE VL AEDLGVYYCFQGSYLPLTFGGGTKVEIK 41 VH11_D68G, SFALN VH-CDR1 42 VH11_D68G, VH- HIRSKTNNYATFYAASVKG CDR2 43 VH11_D68G, VH- RGPRDSWFGY CDR3 44 VH11_D68G, VH EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPG KGLEWVGHIRSKTNNYATFYAASVKGRFTVSRDDSQNTAYLQ MNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVSS 45 VH11_A59V_D68G, SFALN VH-CDR1 46 VH11_A59V_D68G, HIRSKTNNYVTFYAASVKG VH-CDR2 47 VH11_A59V_D68G, RGPRDSWFGY VH-CDR3 48 VH11_A59V_D68G, EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPG VH KGLEWVGHIRSKTNNYVTFYAASVKGRFTVSRDDSQNTAYLQ MNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVSS 49 VH11_K54E_D68G, SFALN VH-CDR1 50 VH11_K54E_D68G, HIRSETNNYATFYAASVKG VH-CDR2 51 VH11_K54E_D68G, RGPRDSWFGY VH-CDR3 52 VH11_K54E_D68G, EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPG VH KGLEWVGHIRSETNNYATFYAASVKGRFTVSRDDSQNTAYLQ MNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVSS 53 VH11_K54E_A59V_ SFALN D68G, VH-CDR1 54 VH11 K54E_A59V_ HIRSETNNYVTFYAASVKG D68G, VH-CDR2 55 VH11 K54E_A59V_ RGPRDSWFGY D68G, VH-CDR3 56 VH11 K54E_A59V EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPG D68G, VH KGLEWVGHIRSETNNYVTFYAASVKGRFTVSRDDSQNTAYLQ MNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVSS 57 Human lambda light GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAW chain, constant region KADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRS YSCQVTHEGSTVEKTVAPTECS 58 Human kappa light RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK chain, constant region VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV YACEVTHQGLSSPVTKSFNRGEC 59 Human IgG1 heavy ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN chain, constant region SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 60 Human_IgG1_LALA, ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN constant region SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEaaGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 61 Human_IgG1_ ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN LALA_D265S, SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN constant region VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEaaGGPSVFLF PPKPKDTLMISRTPEVTCVVVsVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 62 Human_IgG1_YTE, ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN constant region SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLyItRePEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 63 Human_IgG1_LALA_ ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN YTE, constant SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN region VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEaaGGPSVFLF PPKPKDTLyItRePEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 64 Human_IgG1_N297A, ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN constant region SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 65 Human_IgG1_N297Q, ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWN constant region SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYqSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 66 Human IgG2, ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN constant region SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCN VDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKT KPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAP IEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 67 Human_IgG4, ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN constant region SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCN VDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDK SRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 68 Human_IgG4_S228P, ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWN constant region SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCN VDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAK TKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDK SRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 69 VL46_G34A_S28N_ DIVMTQSPLSLPVTLGEPASISCRSSQNIVHSNANTYLEWYL kappa light chain QKPGQSPQLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVE AEDLGVYYCFQGSHLPLTFGGGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESV TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV TKSFNRGEC 70 VH11_IgG4-S228P EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPG heavy chain KGLEWVGHIRSKTNNYATFYAASVKDRFTVSRDDSQNTAYLQ MNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVSSASTKG PSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALT SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKP SNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPRE EQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKT ISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQE GNVFSCSVMHEALHNHYTQKSLSLSLGK 71 V8-AFM-hIgG1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYL LALA, light chain QKPGQSPQLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVE AEDLGVYYCFQGSYLPLTFGGGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESV TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV TKSFNRGEC 72 V8-AFM-hIgG1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPG LALA, heavy chain KGLEWVGHIRSETNNYVTFYAASVKGRFTVSRDDSQNTAYLQ MNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP SNTKVDKKVEPKSCDKTHTCPPCPAPEaaGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 73 V8-AFM-hIgG1 DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYL LALAYTE, light QKPGQSPQLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVE chain AEDLGVYYCFQGSYLPLTFGGGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESV TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV TKSFNRGEC 74 V8-AFM-hIgG1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPG LALA YTE, heavy KGLEWVGHIRSETNNYVTFYAASVKGRFTVSRDDSQNTAYLQ chain MNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP SNTKVDKKVEPKSCDKTHTCPPCPAPEaaGGPSVFLFPPKPK DTLyItRePEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 75 V8-AFM-hIgG4, DIVMTQSPLSLPVTLGEPASISCRSSQKIVHRNANTYLEWYL light chain QKPGQSPQLLIYTVSNRFSGVPDRFSGSGSGTDFTLKISRVE AEDLGVYYCFQGSYLPLTFGGGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESV TEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV TKSFNRGEC 76 V8-AFM-hIgG4, EVQLVESGGGLVQPGGSLRLSCAASGFTFSSFALNWVRQAPG heavy chain KGLEWVGHIRSETNNYVTFYAASVKGRFTVSRDDSQNTAYLQ MNSLKTEDTATYYCVRRGPRDSWFGYWGQGTLVTVSSASTKG PSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALT SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKP SNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPRE EQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKT ISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQE GNVFSCSVMHEALHNHYTQKSLSLSLGK 77 PD17(P) PRHLSNVS(pS)TGSIDMVD 78 PD17 PRHLSNVSSTGSIDMVD 79 T-pS396/400/404GC GCRENAKAKTDHGAEIVYK(pS)PVV(pS)GDT(pS)PRHL 80 T-pT212pS214GC GCGSPGTPGSRSR(pT)P(pS)LPTPPTREPK 81 pSer412Cys NV(pS)STGSC 82 T-pT217GC GCGSRSRTPSLP(PT)PPTREPKKVAVV 83 VL-CDR1, AbM RSSQKIVHRNANTYLE 84 VL-CDR2, AbM TVSNRFS 85 VL-CDR3, AbM FQGSYLPLT 86 VH-CDR1, AbM GFTFSSFALN 87 VH-CDR2, AbM HIRSETNNYVTF 88 VH-CDR3, AbM RGPRDSWFGY 89 VL-CDR1, Chothia RSSQKIVHRNANTYLE 90 VL-CDR2, Chothia TVSNRFS 91 VL-CDR3, Chothia FQGSYLPLT 92 VH-CDR1, Chothia GFTFSSF 93 VH-CDR2, Chothia RSETNNYV 94 VH-CDR3, Chothia RGPRDSWFGY 95 VL-CDR1, Contact VHRNANTYLEWY 96 VL-CDR2, Contact LLIYTVSNRF 97 VL-CDR3, Contact FQGSYLPL 98 VH-CDR1, Contact SSFALN 99 VH-CDR2, Contact WVGHIRSETNNYVTF 100 VH-CDR3, Contact VRRGPRDSWFG 101 VL-CDR1, IMGT QKIVHRNANTY 102 VL-CDR2, IMGT TV 103 VL-CDR3, IMGT FQGSYLPLT 104 VH-CDR1, IMGT GFTFSSFA 105 VH-CDR2, IMGT IRSETNNYV 106 VH-CDR3, IMGT VRRGPRDSWFGY 107 DNA encoding light atgtccgtgcctacacaggttctgggactgctgctgctgtgg chain ctgaccgacgccagatgcgacatcgtgatgacccagtctcca ctgagcctgcctgtgacactgggagagccagcctccatctcc tgccggtcctctcagaaaatcgtgcaccggaacgccaacacc tacctggaatggtatctgcagaagcccggccagtctcctcag ctgctgatctacaccgtgtccaaccggttctctggcgtgccc gatagattctccggctctggctctggcaccgacttcaccctg aagatctccagagtggaagccgaggacctgggcgtgtactac tgcttccaaggctcctacctgcctctgacctttggcggcgga acaaaggtggaaatcaagcggacagtggccgctccttccgtg ttcatcttcccaccttccgacgagcagctgaagtccggcaca gcttctgtcgtgtgcctgctgaacaacttctaccctcgggaa gccaaggtgcagtggaaggtggacaatgccctgcagtccggc aactcccaagagtctgtgaccgagcaggactccaaggacagc acctacagcctgtcctccacactgaccctgtccaaggccgac tacgagaagcacaaggtgtacgcctgcgaagtgacccatcag ggcctgtctagccctgtgaccaagtctttcaaccggggcgag tgt 108 DNA encoding heavy atggaatggtcctgggtgttcctgttcttcctgtccgtgacc chain accggcgtgcactctgaagtgcagctggttgaatctggcggc ggattggttcagcctggcggatctctgagactgtcttgtgcc gcctccggcttcaccttctctagcttcgctctgaactgggtc cgacaggctcctggcaaaggactggaatgggtcggacacatc agatccgagacaaacaactacgtgaccttctacgccgccagc gtgaagggcagattcaccgtgtccagagatgactcccagaac accgcctacctgcagatgaactccctgaaaaccgaggacacc gccacctactactgcgtgcgaagaggccctcgggacagttgg ttcggatattggggacagggcaccctcgtgaccgtgtcctct gcttctaccaagggacccagcgtgttccctctggctccttcc agcaagtctacctctggcggaacagctgctctgggctgcctg gtcaaggactactttcctgagcctgtgacagtgtcctggaac tctggcgctctgacatctggcgtgcacacctttccagctgtg ctgcagtcctccggcctgtactctctgtcctctgtcgtgaca gtgccctccagctctctgggaacccagacctacatctgcaat gtgaaccacaagccttccaacaccaaggtggacaagaaggtg gaacccaagtcctgcgacaagacccacacctgtcctccatgt cctgctccagaagctgctggcggcccttccgtgtttctgttc cctccaaagcctaaggacaccctgtacatcacccgcgagcct gaagtgacctgcgtggtggtggatgtgtctcacgaggacccc gaagtgaagttcaattggtacgtggacggcgtggaagtgcac aacgccaagaccaagcctagagaggaacagtacaactccacc tacagagtggtgtccgtgctgaccgtgctgcaccaggattgg ctgaacggcaaagagtacaagtgcaaggtgtccaacaaggcc ctgcctgctcctatcgaaaagaccatctccaaggccaagggc cagcctagggaaccccaggtttacaccttgcctccatctcgg gacgagctgaccaagaaccaggtgtccctgacctgcctcgtg aagggattctacccctccgatatcgccgtggaatgggagtct aatggccagcctgagaacaactacaagacaacccctcctgtg ctggactccgacggctcattctttctgtactccaagctgaca gtggacaagtccagatggcagcagggcaacgtgttctcctgc agcgtgatgcacgaggccctgcacaatcactacacccagaag tccctgtctctgtcccctggcaaa 109 Peptide GAEIVYK(pS)PVVSGDT(pS)PRHLSNVS(pS)TGSIDMVD (pS)PQLATLADEVSASLAKQGL