Polynucleotides for preparing ANGPTL 3/8 complexes

11492395 · 2022-11-08

Assignee

Inventors

US classification

  • 1/1

Cpc classification

A61B5/02125 A61B5/02125
Loading...
A61B5/05 A61B5/05
Loading...
C07K2317/33 C07K2317/33
Loading...
A61P3/00 A61P3/00
Loading...
C07K2317/76 C07K2317/76
Loading...
C07K2317/21 C07K2317/21
Loading...
A61B5/02438 A61B5/02438
Loading...
A61B5/02444 A61B5/02444
Loading...
C07K16/22 C07K16/22
Loading...
A61K2039/505 A61K2039/505
Loading...
A61B5/681 A61B5/681
Loading...
C07K2317/92 C07K2317/92
Loading...
A61P3/04 A61P3/04
Loading...
A61B5/6843 A61B5/6843
Loading...
A61P3/10 A61P3/10
Loading...
C07K2317/56 C07K2317/56
Loading...
C07K2317/565 C07K2317/565
Loading...

International classification

C07K16/22 C07K16/22
Loading...
A61B5/00 A61B5/00
Loading...
A61B5/05 A61B5/05
Loading...
A61B5/024 A61B5/024
Loading...
A61B5/021 A61B5/021
Loading...
A61P3/00 A61P3/00
Loading...

Abstract

Angiopoietin-like protein (ANGPTL)3/8 fusion proteins are disclosed. Nucleic acid constructs encoding ANGPTL3/8 fusion proteins also are disclosed. Methods of making and using the same also are disclosed, especially for generating antibodies against ANGPTL3 and/or ANGPTL8.

Claims

1. A polynucleotide comprising a nucleic acid sequence encoding a polypeptide comprising the amino acid sequence of SEQ ID NO:18.

2. An expression cassette comprising the polynucleotide of claim 1.

3. A host cell comprising the expression cassette of claim 2.

4. The host cell of claim 3, wherein the host cell is a mammalian cell.

5. A polynucleotide comprising a nucleic acid sequence encoding a polypeptide comprising the amino acid sequence of SEQ ID NO:19 and a nucleic acid sequence encoding a polypeptide comprising the amino acid sequence of SEQ ID NO:20.

6. An expression cassette comprising the polynucleotide of claim 5.

7. A host cell comprising the expression cassette of claim 6.

8. The host cell of claim 7, wherein the host cell is a mammalian cell.

Description

BRIEF DESCRIPTION OF THE SEVERAL VIEW OF THE DRAWINGS

(1) The advantages, effects, features and objects other than those set forth above will become more readily apparent when consideration is given to the detailed description below. Such detailed description makes reference to the following drawing(s), where:

(2) FIG. 1 shows an image of a SDS-page gel showing ANGPTL3/8 complex run under reduced and non-reduced conditions.

DETAILED DESCRIPTION OF THE INVENTION

(3) Reference to an element by the indefinite article “a” or “an” does not exclude the possibility that more than one element is present, unless the context clearly requires that there be one and only one element. The indefinite article “a” or “an” thus usually means “at least one.”

Definitions

(4) As used herein, “about” means within a statistically meaningful range of a value or values such as, for example, a stated concentration, length, molecular weight, pH, sequence similarity, time frame, temperature, volume, etc. Such a value or range can be within an order of magnitude typically within 20%, more typically within 10%, and even more typically within 5% of a given value or range. The allowable variation encompassed by “about” will depend upon the particular system under study, and can be readily appreciated by one of skill in the art.

(5) As used herein, “affinity” means a strength of an Ab's binding to an epitope on an ANGPTL3/8 complex.

(6) As used herein, “angiopoietin-like protein 3” or “ANGPTL3” means a protein having an amino acid sequence including SEQ ID NO:2.

(7) As used herein, “angiopoietin-like protein 8” or “ANGPTL8” means a protein having an amino acid sequence including SEQ ID NO:4.

(8) As used herein, “ANGPTL3/8 complex” means a multi-protein complex of one or more ANGPTL3 compounds that are bound to one or more ANGPTL8 compounds.

(9) As used herein, “anti-ANGPTL3/8 complex Ab” or “anti-ANGPTL3/8 complex Ab” means an Ab that simultaneously recognizes and binds to an area on both ANGPTL3 and ANGPTL8, especially when in the form of the ANGPTL3/8 complex. Generally, an anti-ANGPTL3/8 complex Ab will usually not bind to other ANGPTL family members (e.g., ANGPTL1, ANGPTL2, ANGPTL4, ANGPTL5, ANGPTL6 or ANGPTL7). Moreover, and as noted elsewhere, an anti-ANGPTL3/8 complex Ab also will not bind to ANGPTL3 or ANGPTL8 alone at specified concentrations, as described in the single point ELISA assay below.

(10) As used herein, “bind” or “binds” means an ability of a protein to form a type of chemical bond or attractive force with another protein or molecule as determined by common methods known in the art. Binding can be characterized by an equilibrium dissociation constant (K.sub.D) of about 1×10.sup.−6 M or less (i.e., a smaller K.sub.D denotes a tighter binding). Methods of determining whether two molecules bind are well known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, and the like. Here, an anti-ANGPTL3/8 complex Ab binds only the ANGPTL3/8 complex and does not bind ANGPTL3 alone or ANGPTL8 alone. Whether an Ab binds only to the ANGPTL3/8 complex and not to ANGPTL3 alone or ANGPTL8 alone can be determined in standard ELISA assays in a single point format, as described below and binding may be characterized by Biacore, as described below. While the Abs herein are human, they may, however, exhibit cross-reactivity to other ANGPTL3/8 complexes from other species, for example, cynomolgus monkey ANGPTL3/8 complex, mouse ANGPTL3/8 complex, or rat ANGPTL3/8 complex.

(11) As used herein, “effective amount” means an amount or dose of a compound or a pharmaceutical composition containing the same, which upon single or multiple dose administration to an individual, will elicit a biological or medical response of or desired therapeutic effect on a tissue, system, animal, mammal or human that is being sought by the researcher, veterinarian, medical doctor or other clinician. In some instances, an effective amount of a compound herein or compositions including the same to an individual in need thereof would result in increasing LPL activity. A dose can include a higher initial loading dose, followed by a lower dose. A dose can be administered in any therapeutically effective interval, such as multiple times a day, once daily, every other day, three times a week, two times a week, one time a week, once every two weeks, once a month, once every two months, etc. A dose constituting an effective amount could be between 0.01 mg/kg and 100 mg/kg.

(12) As used herein, “equilibrium dissociation constant” or “K.sub.D” means a quantitative measurement of Ab affinity to a particular antigen interaction, such as affinity of an Ab to ANGPTL3/8 complex, especially a measure of a propensity of an Ab/ANGPTL3/8 complex conjugate to separate reversibly into its component parts. Likewise, and as used herein, “equilibrium association constant” or “K.sub.a” means an inverse of KID.

(13) As used herein, “functional” means that and ANGPTL3 fusion protein, ANGPTL8 fusion protein or ANGPTL3/8 complex has biological activity akin to that of a native ANGPTL3, a native ANGPTL8 or a native ANGPTL3/8 complex including, for example, inhibiting LPL or acting as an antigen to which an Ab can be made and directed.

(14) As used herein, “glucose metabolism-related disease or disorder” means diabetes and the like.

(15) As used herein, “lipid metabolism-related disease or disorder” means a condition associated with abnormal lipid metabolism such as dyslipidemia, hyperlipidemia and hyperlipoproteinemia, including hypertriglyceridemia, hypercholesterolemia, chylomicronemia, mixed dyslipidemia (obesity, metabolic syndrome, diabetes, etc.), lipodystrophy and lipoatrophy. The term also encompasses certain cardiovascular diseases such as atherosclerosis and coronary artery disease, acute pancreatitis, NASH, obesity and the like.

(16) As used herein, “half-maximal effective concentration” or “EC.sub.50” means a concentration of an Ab (typically expressed in molar units (M)) that induces a response halfway between a baseline and a maximum after a predetermined period of time. The EC.sub.50 described herein is ideally 3.0 nM or less.

(17) As used herein, “nucleic acid construct” or “expression cassette” means a nucleic acid molecule having at least a control sequence operably linked to a coding sequence. In this manner, a control sequence such as a promoter is in operable interaction with nucleic acid sequences encoding at least one polypeptide of interest such as the ANGPTL3 fusion proteins described herein and/or the ANGPTL8 fusion proteins described herein. Such nucleic acid constructs can be in the form of an expression or transfer cassette. A nucleic acid construct can include an oligonucleotide or polynucleotide composed of deoxyribonucleotides, ribonucleotides or combinations thereof having incorporated therein the nucleotide sequences for one or more polypeptides of interest.

(18) As used herein, “operably linked” means that the elements of a nucleic acid construct are configured so as to perform their usual function. Thus, control sequences (i.e., promoters) operably linked to a coding sequence are capable of effecting expression of the coding sequence. The control sequences need not be contiguous with the coding sequence, so long as they function to direct the expression thereof (i.e., maintain proper reading frame). Thus, for example, intervening untranslated, yet transcribed sequences, can be present between a promoter and a coding sequence, and the promoter sequence still can be considered “operably linked” to the coding sequence.

(19) As used herein, “control sequence” or “control sequences” means promoters, polyadenylation signals, transcription and translation termination sequences, upstream regulatory domains, origins of replication, internal ribosome entry sites (“IRES”), enhancers, and the like, which collectively provide for replication, transcription and translation of a coding sequence in a recipient host cell. Not all of these control sequences need always be present so long as the selected coding sequence is capable of being replicated, transcribed and translated in an appropriate host cell.

(20) As used herein, “coding sequence” or “coding sequences” means a nucleic acid sequence that encodes for one or more polypeptides of interest, and is a nucleic acid sequence that is transcribed (in the case of DNA) and translated (in the case of RNA) into a polypeptide in vitro or in vivo when placed under the control of appropriate regulatory sequences. The boundaries of the coding sequence(s) are determined by a start codon at a 5′ (amino) terminus and a translation stop codon at a 3′ (carboxy) terminus. A coding sequence can include, but is not limited to, viral nucleic acid sequences, cDNA from prokaryotic or eukaryotic mRNA, genomic DNA sequences from prokaryotic or eukaryotic DNA, or even synthetic DNA sequences.

(21) With respect to control and coding sequences, they can be native/analogous to the host cell or each other. Alternatively, the control and coding sequences can be heterologous to host cell or each other.

(22) As used herein, “promoter” means a nucleotide region composed of a nucleic acid regulatory sequence, where the regulatory sequence is derived from a gene or synthetically created and is capable of binding RNA polymerase and initiating transcription of a downstream (3′-direction) coding sequence. A number of promoters can be used in nucleic acid constructs, including a native promoter for one or more polypeptides of interest. Alternatively, promoters can be selected based upon a desired outcome. Such promoters can include, but are not limited to, inducible promoters, repressible promoters and constitutive promoters.

(23) As used herein, “variant” means a polynucleotide or a polypeptide having one or more modifications such as an addition, deletion, insertion and/or substitution of one or more specific nucleic acid or amino acid residues when compared to a reference nucleic acid or amino acid sequence. A variant therefore includes one or more alterations when compared to the reference nucleic acid or amino acid sequence. Here, the anti-ANGPTL3/8 complex Ab can have a LC or HC variation. In particular, the Ab can be a LC variant having a D31S mutation (SEQ ID NO:21), a D33A mutation (SEQ ID NO:22), a D33T mutation (SEQ ID NO:23); a M56T mutation (SEQ ID NO:24) or a E99Q mutation (SEQ ID NO:25) with respect to a LC having an amino acid sequence of SEQ ID NO:5. Likewise, the LC variant can be a combination any two of the above such as, for example, D31S and D33A mutations, D31S and D33T mutations, D31S and M56T mutations, D31S and E99Q mutations, D33A and M56T mutations, D33A and E99Q mutations, D33T and M56T mutations, D33T and E99Q mutations, and M56T and E99Q, again with respect to a LC having an amino acid sequence of SEQ ID NO:5. Moreover, the LC variant can be a combination of any three of the above such as, for example, D31S, D33A and M56T mutations, D31S, D33A and E99Q mutations, D31S, D33T and M56T mutations, D31S, D33T and E99Q mutations, D33A, M56T and E99Q mutations, and D33T, M56T and E99Q mutations, again with respect to a LC having an amino acid sequence of SEQ ID NO:5. Furthermore, the LC variant can be a combination of any four of the above such as, for example, D31S, D33A, M56T and E99Q mutations; and D31S, D33T, M56T and E99Q mutations, again with respect to a LC having an amino acid sequence of SEQ ID NO:5.

(24) As used herein, “vector” means a replicon, such as a plasmid, phage or cosmid, to which another nucleic acid sequence, such as an expression cassette, may be attached so as to bring about replication of the attached sequence. A vector is capable of transferring nucleic acid molecules to host cells. Vectors typically include one or a small number of restriction endonuclease recognition sites where a nucleotide sequence of interest can be inserted in a determinable fashion without loss of essential biological function of the vector, as well as a selectable marker that can be used for identifying and selecting host cells transformed with the vector. A vector therefor can be capable of transferring nucleic acid sequences to target cells.

(25) As used herein, “treatment” or “treating” means management and care of an individual having a condition for which anti-ANGPTL3/8 complex Ab administration is indicated for the purpose of combating or alleviating symptoms and complications of those conditions. Treating includes administering a compound or compositions containing a compound herein to such an individual to prevent the onset of symptoms or complications, alleviating the symptoms or complications, or eliminating the disease, condition, or disorder. Treating includes administering a compound or compositions containing a compound herein to an individual in need thereof to result in increasing LPL activity and lowering of TGs. The individual to be treated is an animal, especially a human being.

(26) As used herein, “patient,” “subject” and “individual,” are used interchangeably herein, and mean an animal, especially a human. In certain instances, the individual is a human and is further characterized with a disease, disorder or condition that would benefit from administration of an anti-ANGPTL3/8 complex Ab.

(27) As used herein, “antibody” or “Ab” and the like means a full-length Ab including two heavy chains and two light chains having inter- and intra-chain disulfide bonds. The amino-terminal portion of each of the four polypeptide chains includes a variable region primarily responsible for antigen recognition. Each HC includes an N-terminal HCVR and an HC constant region (HCCR). Each light chain includes a light chain (LC) variable region (LCVR) and a LC constant region (LCCR). Here, the Ab is an immunoglobulin G (IgG) type Ab, and the IgG isotype may be further divided into subclasses (e.g., IgG1, IgG2, IgG3 and IgG4). The HCVR and LCVR regions can be further subdivided into regions of hyper-variability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR). Each HCVR and LCVR includes three CDRs and four FRs, arranged from N-terminus to C-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. Herein, the three CDRs of the HC are referred to as HCDR1, HCDR2 and HCDR3, and the three CDRs of the LC are referred to as LCDR1, LCDR2 and LCDR3. The CDRs contain most of the residues that form specific interactions with an antigen, such as an ANGPTL3/8 complex. Assigning the residues to the various CDRs may be done by algorithms such as, for example, Chothia, Kabat or North. The North CDR definition is based on affinity propagation clustering with a large number of crystal structures (North et al. (2011) J. Mol. Bio. 406:228-256). Herein, the CDRs are best defined by the sequences listed in the Sequence Listing, which are based upon a combination of multiple definitions including North.

(28) An isolated DNA encoding a HCVR region can be converted to a full-length heavy chain gene by operably linking the HCVR-encoding DNA to another DNA molecule encoding heavy chain constant regions. Sequences of human, as well as other mammalian, heavy chain constant region genes are known in the art. DNA fragments encompassing these regions can be obtained by, for example, standard PCR amplification.

(29) An isolated DNA encoding a LCVR region may be converted to a full-length light chain gene by operably linking the LCVR-encoding DNA to another DNA molecule encoding a light chain constant region. Sequences of human, as well as other mammalian, light chain constant region genes are known in the art. DNA fragments encompassing these regions can be obtained by standard PCR amplification. The light chain constant region can be a kappa or lambda constant region.

(30) The Abs herein may contain an IgG4-PAA Fc portion. The IgG4-PAA Fc portion has a Ser to Pro mutation at position 231 (S231P), a Phe to Ala mutation at position 237 (F237A), and a Leu to Ala mutation at position 238 (L238A) as numbered by absolute position in SEQ ID NO:6. The S231P mutation is a hinge mutation that prevents half-Ab formation (phenomenon of dynamic exchange of half-molecules in IgG4 Abs). The F237A and L238A mutations further reduce effector function of the already low human IgG4 isotype. It is contemplated, however, that the Abs herein may alternative include a different Fc portion.

(31) To reduce the potential induction of an immune response when dosed in humans, certain amino acids may require back-mutations to match Ab germline sequences.

(32) Pharmaceutical compositions including the compounds herein may be administered parenterally to individuals in need of such treatment. Such individual may have ASCVD or be at high risk for ASCVD. These individuals may have acute coronary syndromes, history of myocardial infarction (MI), stable or unstable angina, coronary or other arterial revascularization, stroke, transient ischemic attack (TIA), thoracic or abdominal aortic aneurysm, or peripheral arterial disease presumed to be of atherosclerotic origin. Individuals at high risk for ASCVD may further have type 2 diabetes (T2D), CKD or familial hypercholesterolemia (FH).

(33) Parenteral administration may be performed by subcutaneous, intramuscular or intravenous injection by means of a syringe, optionally a pen-like syringe, or mechanical driven injector. Alternatively, parenteral administration can be performed by means of an infusion pump. In some instances, pharmaceutical compositions suitable for administration to an individual having a therapeutically effective amount of a compound wherein and one or more pharmaceutically acceptable excipients. Such pharmaceutical compositions may be prepared by any of a variety of techniques using conventional excipients for pharmaceutical products that are well known in the art. See, e.g., Remington, “The Science and Practice of Pharmacy” (D. B. Troy ed., 21.sup.st Ed., Lippincott, Williams & Wilkins, 2006).

(34) The compounds herein may be used in simultaneous, separate or sequential combination with one or more additional therapeutic agents useful for modulating LPL activity, treating lipid metabolism-related diseases or disorders, or treating glucose metabolism-related diseases or disorders, including any of the disorders listed above. Non-limiting examples of the additional therapeutic agents that can be combined with the claimed compounds include, but are not limited to, anti-diabetic agents such as insulin or insulin analogs, biguanides, sulfonylureas, thiazolidinediones, dipeptidyl peptidase-4 (“DPP-4”) inhibitors, or sodium-dependent glucose transporter (SGLT2) inhibitors; incretin compounds such as glucagon-like-peptide-1 (GLP-1) or GLP-1 analogs, gastric inhibitory polypeptide (GIP) or GIP analogs, oxyntomodulin (OXM) or OXM analogs; aspirin; antiplatelet agents; H2 receptor blockers; proton pump inhibitors; antihypertensives; lipid modifying therapies such as HMG-CoA reductase inhibitors, PCSK9 inhibitors, cholesterol absorption inhibitors, fibrates, niacin, LXR agonists, RXR agonists, ROR agonists, or reverse cholesterol transport modulators; heart failure therapies such as ACE, angiotensin receptor neprilysin inhibitors, ARB, or B adrenergic antagonists; anti-inflammatory therapies; hypertension therapies, atrial fibrillation therapies; neurodegeneration therapies; oncology therapies; therapies for diabetic cardiomyopathy, diabetic retinopathy, diabetic neuropathy, diabetic nephropathy, weight reduction, wound healing; nephropathy therapies; PAD therapies, or combinations of any of the foregoing agents. The anti-ANGPTL3/8 complex Ab and the one or more additional therapeutic agent(s) can be administered either together through the same delivery route and device such as a single pill, capsule, tablet, or injectable formulation; or separately administered either at the same time in separate delivery devices or routes; or administered sequentially.

(35) Preparation and Purification of ANGPTL3/8 Complexes

(36) One aspect of the disclosure is ANGPTL3/8 complexes that can be used to make an Ab that binds to the complex only and do not bind to ANGPTL3 alone or to ANGPTL8 alone. Although anti-ANGPTL3 Abs and anti-ANGPTL8 Abs are known, there is a challenge in synthesizing sufficient quantities of functional ANGPTL3/8 complexes, especially human ANGPTL3/8 complexes, to make anti-ANGPTL3/8 complex Abs. Additionally or alternatively, such ANGPTL3/8 complexes can be used in assays to assess the properties of Abs directed to ANGPTL3, ANGPTL8 and/or ANGPTL3/8 complexes.

(37) In this manner, the disclosure also describes methods of generating ANGPTL8 by making it as either an N- or a C-terminal serum albumin (e.g., human, mouse or rabbit) fusion protein. Functional ANGPTL3/8 complexes then can be made by co-expressing the ANGPTL8 fusion protein with native ANGPTL3 or an ANGPTL3 fusion protein in a mammalian expression system.

(38) As noted above, nucleic and amino acid sequences for native, human ANGPTL3 and native, human ANGPTL8 are known (see, e.g., SEQ ID NOS:1-2 and 3-4, respectively). ANGPTL3 or ANGPTL 8 as described herein, however, are modified (i.e., recombinant/synthetic) and therefor differ from the native sequences by including additional amino acid sequences to improve generating, secreting and/or complexing ANGTPL3 and ANGTPL8.

(39) For example, ANGPTL3 can be modified to include one or more linkers and tags as are known in the art. Here, human ANGPTL3 (SEQ ID NO:2) is modified to include a linker and FLAG-tag such that the ANGPTL3 fusion protein has an amino acid sequence of SEQ ID NO:17. In some instances, the linker can be from about 1 to about 10 amino acids, such as 3 amino acids, especially 3 Ala residues. The linker and FLAG-tag can be placed at the N- or C-terminus of the ANGPTL3 sequence, especially the C-terminus as in SEQ ID NO:17, where residues 1-460 correspond to ANGPTL3, and residues 461-471 correspond to the 3-Ala linker and FLAG-tag.

(40) Likewise, ANGPTL8 can be modified to include one or more linkers and tags in addition to a sequence for serum albumin, especially human serum albumin. Here, human ANGPTL8 (SEQ ID NO:4) is modified to include a linker, an IgG kappa signal peptide, a polyhistidine (His)-tag, mature human serum albumin, a linker and a PreScission® Cleavage Site such that the ANGPTL8 fusion protein has an amino acid sequence of SEQ ID NO:18. In some instances, the linker can be from about 1 to about 10 amino acids, such as a rigid polyproline repeat, especially an Ala-Pro (AP)-10 linker. The signal peptide, His-tag, mature HSA, linker and PreScission® Cleavage Site can placed at the N- or C-terminus of the ANGPTL8 sequence, especially the N-terminus as in SEQ ID NO:18, where residues 1-20 correspond to the IgG kappa signal peptide, residues 21-27 correspond to the His-tag, residues 28-612 correspond to HSA, residues 613-632 correspond to the AP-10 linker, residues 633-643 correspond to the PreScission® Cleavage Site, and residues 644-820 correspond to ANGPTL8.

(41) Methods of constructing nucleic acid constructs to express the ANGPTL3 fusion protein and/or the ANGPTL8 fusion protein as described herein are well known in the art and can be found in, for example, Balbás & Lorence, “Recombinant Gene Expression: Reviews and Protocols” (2.sup.nd Ed. Humana Press 2004); Davis et al., “Basic Methods in Molecular Biology” (Elsevier Press 1986); Sambrook & Russell, “Molecular Cloning: A Laboratory Manual” (3.sup.rd Ed. Cold Spring Harbor Laboratory Press 2001); Tijssen, “Laboratory Techniques in Biochemistry and Molecular Biology—Hybridization with Nucleic Acid Probes” (Elsevier 1993); and “Current Protocols in Molecular Biology” (Ausubel et al. eds., Greene Publishing and Wiley-Interscience 1995); as well as U.S. Pat. Nos. 6,664,387; 7,060,491; 7,345,216 and 7,494,805. Because ANGPTL8 does not contain any disulfide bonds, mammalian expression systems can be used. Here, HEK293 expression systems or CHO expression systems may be used to generate the ANGPTL3 and/or ANGPTL8 fusion proteins, especially by co-expression.

(42) In addition to expressing the ANGPTL3 fusion protein and/or the ANGPTL8 fusion protein, the methods also can include purifying the resulting fusion proteins based upon the particular tag used for each fusion protein, which are well known in the art. With regard to the ANGPTL3 and ANGTPL8 fusion proteins described herein, purification can result in a number of truncations after removing the tags such that the ANGPTL3 fusion protein has an amino acid sequence of SEQ ID NO:19 (where residues 1-444 correspond to ANGPTL3, and residues 445-455 correspond to the 3-Ala linker and FLAG-tag) and the ANGPTL8 fusion protein has an amino acid sequence of SEQ ID NO:20 (where residues 1-4 correspond to cleavage residues from the PreScission® Cleavage Site, and residues 5-182 correspond to a fragment of ANGPTL8), which readily associate with one another to form functional ANGPTL3/8 complexes.

(43) Preparation and Purification of Antibodies

(44) Anti-ANGPTL3/8 complex Abs may be produced in a mammalian cell expression system using a CHO GSKO cell line. A glutamine synthetase (GS) gene knockout enables tightened selection stringency by eliminating endogenous GS background activity, which can allow survival of low- or non-productive cells under selection conditions. Genes coding for the Ab HC and LC herein may be sub-cloned into individual GS-containing expression plasmids for co-transfection or both chains may be sub-cloned into a single GS-containing expression plasmid. The cDNA sequence encoding the HC or LC is fused in frame with the coding sequence of a signal peptide, which may be the murine kappa leader sequence, to enhance secretion of the desired product into the cell culture medium. The expression is driven by the viral cytomegalovirus (CMV) promoter.

(45) CHO GSKO cells are stably transfected using electroporation and the appropriate amount of recombinant HC and LC expression plasmids, and the transfected cells are maintained in suspension culture, at the adequate cell density. Selection of the transfected cells is accomplished by growth in glutamine-free, 25 μM methionine sulfoximine (MSX)-containing serum-free medium and incubated at 32-37° C. and 5%-7% CO.sub.2. Abs are secreted into the media from the CHO cells. The Abs may be purified by Protein A affinity chromatography followed by anion exchange, or hydrophobic interaction chromatography (or other suitable methods), and may utilize size exclusion chromatography for further purification.

(46) Abs from harvested media are captured onto Mab Select SuRe Protein A resin (GE Healthcare). The resin is then briefly washed with a running buffer, such as a phosphate buffered saline (PBS) pH 7.4 or a running buffer containing Tris, to remove non-specifically bound material. Abs are then eluted from the resin with a low pH solution, such as 20 mM acetic acid/5 mM citric acid. Fractions containing ANGPTL3/8 Abs are pooled and may be held at a low pH to inactivate potential viruses. The pH can be increased as needed by adding a base such as 0.1 M Tris pH 8.0. ANGPTL3/8 Abs may be further purified by hydrophobic interaction chromatography (HIC) using resins such as Phenyl HP (GE Healthcare). Anti-ANGPTL3/8 Abs can be eluted from the HIC column using a sodium sulfate gradient in 20 mM Tris, pH 8.0. The anti-ANGPTL3/8 Abs may be further purified by size exclusion chromatography using a Superdex 200 column (GE Healthcare) with isocratic elution in PBS, pH 7.4.

(47) The compounds described herein are prepared in this manner or in a similar manner that would be readily determined by one of skill in the art.

(48) Mice harbouring human variable light and heavy chain domains are immunized with the ANGPTL3/8 complex described above, and single antigen-specific B cells are isolated by FACS using ANGPTL3/8 (positive) and ANGPTL3 (negative) as markers. Heavy chain and light chain variable region DNA are recovered from single B cells by PCR and cloned into IgG expression vectors. CHO cell supernatants are tested after transfection for binding activity.

EXAMPLES

(49) The following non-limiting examples are offered for purposes of illustration, not limitation.

Example 1: Making ANGPTL3/8 Complexes

(50) ANGPTL3 and ANGPTL8 Expression: nucleotide sequences encoding an amino acid sequence for human ANGPTL3, a linker and a FLAG tag (SEQ ID NO:17) are inserted into a mammalian expression vector containing a CMV promoter. Likewise, nucleotide sequences encoding an amino acid sequence for human ANGTPL8, mouse IgG kappa signal peptide, HIS-tag, mature human serum albumin (HSA)-PreScission® cleavage site (SEQ ID NO:18) are inserted into a mammalian expression vector containing a CMV promoter. Protein expression is through transient co-transfection of both the above-described expression vectors in HEK293F cells cultured in serum-free media. Culture media is harvested 5 days post transfection and is stored at 4° C. for subsequent protein purification.

(51) Protein Purification: protein purification is conducted at 4° C., where 4 L culture media are supplemented with 1 M Tris-HCl (pH 8.0) and 5 M NaCl to a final concentration of 25 mM and 150 mM, respectively. The media are then incubated with 150 ml of Ni-NTA resin (Qiagen) overnight. The resin is packed into a column and is washed with Buffer A (50 mM Tris-HCl, pH 8.0, 0.3 M NaCl). Protein is eluted with 0-300 mM imidazole gradient in Buffer A. Fractions containing HIS-HSA-ANGPTL8/ANGPTL3-Flag are pooled, concentrated and loaded onto a HiLoad® Superdex® 200 Column (GE Healthcare Biosciences), and eluted with Buffer A. Fractions containing HIS-HSA-ANGPTL8/ANGPTL3-Flag again are pooled, concentrated and digested with PreScission® Protease (GE Healthcare Biosciences) to remove HSA from HIS-HSA-ANGPTL8 fusion protein. The PreScission®-digested protein sample is loaded onto a HiLoad® Superdex® 200 Column and is eluted with storage buffer (20 mM HEPES, pH8.0, 150 mM NaCl). Fractions containing ANGPTL3/8 complex are pooled and concentrated, with protein concentration determined using the Bradford method. ANGTPL3/8 complex is aliquoted and stored at −80° C. until further use.

(52) LPL Activity Assay: An EnzCheck® LPL assay is performed according to the manufacture's instructions (ThermoFisher Scientific). Briefly, ANGPTL3 and the ANGPLT3/8 complexes are serially diluted in growth medium and replaced LPL cell medium for 1 hour incubation. EnzCheck® Lipase Substrate (ELS) is then added into LPL-expressing cells and is incubated for 30 minutes. Fluorescence is measured at 482 nm/515 nm (excitation/emission, respectively). The % inhibition of ANGPTL3 and 3/8 on LPL are calculated.

(53) Results:

(54) Table 1 shows the yield of ANGTPL3/8 complex protein at the various stages of purification/concentration.

(55) TABLE-US-00001 TABLE 1 ANGPTL3/8 Complex Protein Yield. Ni-NTA Resin 1.sup.st Superdex ® 200 2.sup.nd Superdex ® 200 Start (L) Yield (mg) Column Yield (mg) Column Yield (mg) 4 105 47 12

(56) Likewise, FIG. 1 shows a 4-20% TG TGX Coomassie-stained gel of the purified and concentrated ANGPTL3/8 complex resulting from the columns, which confirms that complexes form/assemble. Following purification and concentration, ANGTL3 has an amino acid sequence of SEQ ID NO:19 and ANGPTL8 has an amino acid sequence of SEQ ID NO:20.

(57) In the LPL assay, the EC.sub.50 of ANGPTL3 is 21.5 nM while that of the EC.sub.50 of ANGTPL3/8 complex is 0.54 nM, which confirms that the complexes are functional.

Example 2: Assays

(58) Single Point ELISA (SPE) Assay: Ab binding selectivity to either the ANGPTL3/8 complex, free ANGPTL3 or free ANGPTL8 is initially verified using standard ELISA assays in a single point format. Briefly, assay plates are coated with an anti-human Fc Ab at a concentration of 2 μg/ml and subsequently blocked with casein. IgG secreted into supernatants after expression in CHO cells are then captured to the assay plate. Biotinylated antigen is added at a concentration of 25 nM to allow for Ab/antigen binding. Ab/antigen complexes are detected after adding alkaline phosphatase-conjugated neutravidin and alkaline phosphatase substrate, and subsequent measurement of the optical density at 560 nm. Positive binding is determined by a signal greater than 3 fold over the non-binding background signal.

(59) ELISA Assay: Ab binding selectivity to either the ANGPTL3/8 complex, free ANGPTL3 or free ANGPTL8 is verified using standard ELISA assays. Briefly, assay plates are coated with an anti-human Fc Ab at a concentration of 2 μg/ml and subsequently blocked with casein. Ab from CHO supernatants after expression in CHO cells is then captured to the assay plate and results is an Ab concentration of 2 μg/ml. Biotinylated antigen (ANGPTL3, ANGPTL8 or ANGPTL3/8 complex) is added at varying concentrations by serial dilution to allow for Ab/antigen binding. Ab/antigen complexes are detected after the addition of alkaline phosphatase-conjugated neutravidin, and alkaline phosphatase substrate, and subsequent measurement of the optical density at 560 nm.

(60) TABLE-US-00002 TABLE 2 Ab Binding Selectivity to ANGPTL3/8 Complex, ANGPTL8 and ANGPTL3 in a SPE Assay. ANGPTL3/8 ANGPTL8 ANGPTL3 Complex Binding Binding Binding Ab 2.302 (positive) 0.087 (negative) 0.074 (negative) D31S 0.928 0.072 0.058 D33A 0.898 0.118 0.076 D33T 0.661 0.070 0.060 M56T 0.775 0.085 0.060 E99Q 1.538 0.100 0.083 Average 0.09 0.07 0.08 Nonbinding Background Signal 3 × 0.27 0.21 0.24 Background Values are optical density (OD) at 560 nm, and the non-binding background signal across all plates tested on average is reflected in the “Background signal” row. This negative control shows the background signal in the absence of Ab.

(61) In the SPE assay, the Ab having a LC of SEQ ID NO:5 and a HC of SEQ ID NO:6 shows positive binding to the human ANGPTL3/8 complex and negative binding to human ANGPTL8 and human ANGPTL3. Abs with LC variants having a D31S mutation (SEQ ID NO:21), a D33A mutation (SEQ ID NO:22), a D33T mutation (SEQ ID NO:24), a M56T mutation (SEQ ID NO:24) or a E99Q mutation (SEQ ID NO:25) and a HC of SEQ ID NO:6 likewise show binding to the human ANGPTL3/8 complex and negative binding to human ANGPTL8 and human ANGPTL.

(62) TABLE-US-00003 TABLE 3 ELISA Assay of Ab Binding to Various Concentrations of ANGPTL3, ANGPTL8 and ANGPTL3/8 Complex. Antigen hANGPTL8 hANGPTL3 hANGPTL3/8 complex conc. [nM] Ab Control Ab Control Ab Control 100 0.072 0.076 0.081 0.091 2.705 0.063 33.3 0.050 0.060 0.052 0.063 2.411 0.056 11.1 0.045 0.051 0.046 0.052 1.708 0.047 3.70 0.051 0.048 0.046 0.052 1.042 0.046 1.23 0.043 0.048 0.043 0.052 0.510 0.046 0.412 0.046 0.050 0.043 0.067 0.231 0.046 0.137 0.047 0.053 0.048 0.055 0.110 0.044 0.046 0.051 0.054 0.060 0.069 0.078 0.053 Control is buffer and no Ab.

(63) The Ab having a LC of SEQ ID NO:5 and a HC of SEQ ID NO:6 shows positive binding to the human ANGPTL3/8 complex in a concentration-dependent manner and no detectable binding to human ANGPTL8 and human ANGPTL3 up to an antigen concentration of 100 nM in this assay (Table 3).

(64) In addition to the above anti-ANGPTL3/8 complex Ab having a LC of SEQ ID NO:5 and a HC of SEQ ID NO:6, Abs with LC variants having a D31S mutation (SEQ ID NO:21), a D33A mutation (SEQ ID NO:22) or a E99Q mutation (SEQ ID NO:25) and a HC of SEQ ID NO:6 are assayed and likewise show positive binding to the human ANGPTL3/8 complex in a concentration-dependent manner and no detectable binding to human ANGPTL8 and human ANGPTL3 up to an antigen concentration of 100 nM in this assay (Tables 4-6).

(65) TABLE-US-00004 TABLE 4 ELISA Assay of D31S Variant Ab Binding to Various Concentrations of ANGPTL3, ANGPTL8 and ANGPTL3/8 Complex. Antigen hANGPTL8 hANGPTL3 hANGPTL3/8 complex conc. [nM] Ab Control Ab Control Ab Control 100 0.098 0.076 0.084 0.081 2.471 0.092 33.3 0.063 0.065 0.069 0.064 2.226 0.068 11.1 0.062 0.059 0.062 0.062 1.735 0.053 3.70 0.056 0.055 0.060 0.057 1.134 0.049 1.23 0.058 0.049 0.059 0.058 0.575 0.048 0.412 0.062 0.049 0.058 0.057 0.234 0.047 0.137 0.080 0.077 0.057 0.076 0.137 0.068 0.046 0.096 0.085 0.060 0.064 0.149 0.075

(66) TABLE-US-00005 TABLE 5 ELISA Assay of D33A Variant Ab Binding to Various Concentrations of ANGPTL3, ANGPTL8 and ANGPTL3/8 Complex. Antigen hANGPTL8 hANGPTL3 hANGPTL3/8 complex conc. [nM] Ab Control Ab Control Ab Control 100 0.078 0.076 0.082 0.081 2.388 0.092 33.3 0.049 0.065 0.067 0.064 2.179 0.068 11.1 0.048 0.059 0.060 0.062 1.635 0.053 3.70 0.048 0.055 0.056 0.057 1.040 0.049 1.23 0.049 0.049 0.057 0.058 0.491 0.048 0.412 0.047 0.049 0.056 0.057 0.196 0.047 0.137 0.053 0.077 0.062 0.076 0.101 0.068 0.046 0.074 0.085 0.062 0.064 0.111 0.075

(67) TABLE-US-00006 TABLE 6 ELISA Assay of E99Q Variant Ab Binding to Various Concentrations of ANGPTL3, ANGPTL8, and ANGPTL3/8 Complex. Antigen hANGPTL8 hANGPTL3 hANGPTL3/8 complex conc. [nM] Ab Control Ab Control Ab Control 100 0.098 0.076 0.084 0.081 2.471 0.092 33.3 0.063 0.065 0.069 0.064 2.226 0.068 11.1 0.062 0.059 0.062 0.062 1.735 0.053 3.70 0.056 0.055 0.060 0.057 1.134 0.049 1.23 0.058 0.049 0.059 0.058 0.575 0.048 0.412 0.062 0.049 0.058 0.057 0.234 0.047 0.137 0.080 0.077 0.057 0.076 0.137 0.068 0.046 0.096 0.085 0.060 0.064 0.149 0.075

Example 3: In Vitro Receptor Affinity

(68) Binding kinetics may be determined using a Biacore® T200 Instrument (GE Healthcare Bio-Sciences Corp.; Piscataway, N.J.). A CM4 sensor chip surface may be prepared by covalent coupling of Human Fab Binder (GE Healthcare Bio-Sciences Corp.). Kinetic experiments may be carried out at about 25° C. in a running buffer of HBSEP+, 0.01% BSA at pH 7.4. Abs may be captured, and a concentration series of mouse, cyno, or human ANGPTL3/8 complex may be injected over the chip surface at about 50 uL/min for about 240 seconds with a dissociation time of about 800 seconds. To determine kinetic parameters (e.g., k.sub.a, k.sub.d, K.sub.D) data is double-referenced and fit to a 1:1 binding model using Biacore T200 Evaluation Software (GE Healthcare Bio-Sciences Corp.). Table 7, below, shows the binding of an anti-ANGPTL3/8 complex Ab having a LC of SEQ ID NO:5 and a HC of SEQ ID NO:6 to various ANGPTL3/8 complexes from different species at pH 7.4 and temperature 25° C.

(69) TABLE-US-00007 TABLE 7 Binding of Ab to Cross Species ANGPTL3/8 Complexes at pH 7.4 and Temperature 25° C. Species ANGPTL3/8 Complex Binding to Ab k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) s.d. N Mouse 4.75 × 10.sup.5 1.72 × 10.sup.−4 3.66 × 10.sup.−10 6.19 × 10.sup.−11 3 Cyno 4.91 × 10.sup.5 9.91 × 10.sup.−5 2.13 × 10.sup.−10 6.30 × 10.sup.−11 3 Human 4.77 × 10.sup.5 6.31 × 10.sup.−5 1.35 × 10.sup.−10 2.69 × 10.sup.−11 2

(70) In addition to the above anti-ANGPTL3/8 complex Ab having a LC of SEQ ID NO:5 and a HC of SEQ ID NO:6, Abs with LC variants having a D31S mutation (SEQ ID NO:21), a D33A mutation (SEQ ID NO:22) or a E99Q mutation (SEQ ID NO:25) and a HC of SEQ ID NO:6 are assayed for binding to various ANGPTL3/8 complexes from different species at pH 7.4 and temperature 25° C. (Tables 8-10).

(71) TABLE-US-00008 TABLE 8 Binding of D31S Variant Ab to Cross Species ANGPTL3/8 Complexes at pH 7.4 and Temperature 25° C. Species ANGPTL3/8 Complex Binding to D31S Ab k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) s.d. N Mouse 4.96 × 10.sup.5 1.08 × 10.sup.−4 2.18 × 10.sup.−10 1.88 × 10.sup.−11 3 Cyno 4.62 × 10.sup.5 1.68 × 10.sup.−4 3.65 × 10.sup.−10 1.50 × 10.sup.−11 3 Human 4.97 × 10.sup.5 5.75 × 10.sup.−5 1.16 × 10.sup.−10 1.91 × 10.sup.−11 3

(72) TABLE-US-00009 TABLE 9 Binding of D33A Variant Ab to Cross Species ANGPTL3/8 Complexes at pH 7.4 and Temperature 25° C. Species ANGPTL3/8 Complex Binding to D33A Ab k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) s.d. N Mouse 5.15 × 10.sup.5 3.47 × 10.sup.−4 6.80 × 10.sup.−10 7.07 × 10.sup.−11 3 Cyno 4.35 × 10.sup.5 2.65 × 10.sup.−4 6.09 × 10.sup.−10 1.21 × 10.sup.−11 3 Human 4.57 × 10.sup.5 9.19 × 10.sup.−5 2.01 × 10.sup.−10 1.75 × 10.sup.−11 3

(73) TABLE-US-00010 TABLE 10 Binding of E99Q Variant Ab to Cross Species ANGPTL3/8 Complexes at pH 7.4 and Temperature 25° C. Species ANGPTL3/8 Complex Binding to E99Q Ab k.sub.a (1/Ms) k.sub.d (1/s) K.sub.D (M) s.d. N Mouse 5.96 × 10.sup.5 1.51 × 10.sup.−4 2.54 × 10.sup.−10 1.79 × 10.sup.−11 3 Cyno 6.20 × 10.sup.5 7.23 × 10.sup.−5 1.16 × 10.sup.−10 8.58 × 10.sup.−12 3 Human 6.74 × 10.sup.5 3.26 × 10.sup.−5 4.84 × 10.sup.−11 6.50 × 10.sup.−12 3

Example 4: In Vitro Functional Activity LPL Assay

(74) A cell based bioassay is used to assess the ability of the anti-ANGPTL3/8 complex Ab having a LC of SEQ ID NO:5 and a HC of SEQ ID NO:6 to de-repress ANGPTL3/8 purified protein inhibition of LPL activity. The Ab's ANGPTL3/8 inhibitory activity is determined using EnzChek™ Lipase Substrate (ThermoFisher). HEK293 cell lines expressing human, cynomolgus, mouse or rat LPL, and purified human, cynomolgus, mouse or rat ANGPTL3/8 protein. HEK293-LPL generation includes a human embryonic cell line stably expressing human LPL, which is generated (HEK293-huLPL) utilizing standard methods. Briefly, human LPL is cloned into a lentivirus plasmid with a CMV promoter and blasticidin resistance. The plasmid is used to generate a human LPL lentivirus using ViraPower Packaging Mix (Invitrogen). HEK293 cells are incubated with the LPL lentivirus and clones resistant to blasticidin are selected. A clone is chosen after confirming human LPL mRNA expression by qPCR and LPL activity utilizing the EnzChek™ substrate. This process is repeated for cynomolgus, mouse and rat LPL.

(75) Methods are modified from those described in Basu et al. (Basu et al. (2011) J. Lipid Res. 52:826-832): (a) HEK293-LPL cells are added to a half area 96-well Poly-D-Lysine coated plate A (human), B (cynomolgus), C (mouse) or D (rat) at a density of 25000 cells/well and are incubated overnight at 37° C., 5% CO.sub.2. Ab is serially diluted nine times from a starting stock concentration to generate a ten-point CRC, and then added to purified ANGPTL3/8 proteins (at the IC.sub.80 concentration of 0.42 nM for human, 0.38 nM for cynomolgus, 0.13 nM for mouse, or 0.81 nM for rat) in 96 well plates E (human), F (cynomolgus), G (mouse) or H (rat).

(76) The media on the HEK293-LPL cells in plates A, B, C, and D are replaced with the ANGPTL3/8 and Ab mixtures from plate E, F, G and H, respectively, and are incubated 1 hr at 37° C., 5% CO.sub.2. 10 μl of EnzChek™ Lipase Substrate (prepared at a concentration of 5 μM in 0.05% Zwittergent (3-(N,N-Dimethyloctadecylammonio)propanesulfonate) (Sigma) is added to the cells, ANGPTL3/8 and Ab mixture in plates A, B, C and D. A plate reader is used to measure the fluorescence at 482 nm Excitation and 515 nm Emission with a 495 nm cutoff filter. The plates are incubated at 37° C., 5% CO.sub.2 in between time points. Relative fluorescence (directly proportional to LPL activity) is calculated by subtracting the signal at 1 min from the signal at 31 min. The efficacy concentration at which the Ab restored LPL activity 50% (EC.sub.50) is calculated utilizing Excel Fit. The EC.sub.50 concentrations are shown in Table 11.

(77) The percent derepression is calculated as follows:
=(RFU−RFU(MIN))/(RFU(MAX)−RFU(MIN))×100,
where MAX=cells alone (LPL) and MIN=cells (LPL)+ANGPTL3/8 CM (conditioned media).

(78) The Ab generally has a low EC.sub.50 and so is potent in de-repressing LPL. The Ab also has favorable % max de-repression of LPL.

(79) TABLE-US-00011 TABLE 11 Ab EC.sub.50 and % Max Derepression of LPL for Human, Cyno, Mouse and Rat LPL and Human, Cyno, Mouse and Rat ANGPTL3/8 Complex. LPL and ANGPTL3/8 Ab EC.sub.50 % Max Derepression Species (nM) of LPL human LPL and human 0.28 102% ANGPTL3/8 cyno LPL and cyno 1.31  96% ANGPTL3/8 mouse LPL and mouse 1.38 103% ANGPTL3/8 rat LPL and rat ANGPTL3/8 2.77 105%

(80) In addition to the above anti-ANGPTL3/8 complex Ab having a LC of SEQ ID NO:5 and a HC of SEQ ID NO:6, Abs with LC variants having a D31S mutation (SEQ ID NO:21), a D33A mutation (SEQ ID NO:22), a D33T mutation (SEQ ID NO:23) or a E99Q mutation (SEQ ID NO:25) and a HC of SEQ ID NO:6 are assayed to depress ANGPTL3/8 purified protein inhibition of LPL activity (Table 12).

(81) TABLE-US-00012 TABLE 12 Variant Ab EC.sub.50 and % Max Derepression of LPL for Human and Mouse LPL and Human and Mouse ANGPTL3/8 Complex. D31S D33A D33T E99Q Ab EC.sub.50 Ab EC.sub.50 Ab EC.sub.50 Ab EC.sub.50 (nM), (nM), (nM), (nM), LPL and % Max % Max % Max % Max ANGPTL3/8 Derepression Derepression Derepression Derepression Species LPL LPL LPL LPL human LPL 0.86, 106% 1.14, 103% 1.56, 105% 0.49, 106% and human ANGPTL3/8 mouse LPL 1.79, 110% 4.07, 106% 4.55, 114% 1.65, 110% and mouse ANGPTL3/8

Example 5: In Vivo Triglyceride Response

(82) The effect of an anti-ANGPTL3/8 complex Ab having a LC of SEQ ID NO:5 and HC of SEQ ID NO:6 on serum TG is evaluated in mice transgenic for huCETP and huApolipoprotein A1 (a). Blood is collected from the mice, and serum is isolated prior to the start of the experiment. TG is measured in serum samples using a Cobas® clinical chemistry analyzer (Roche). Animals are assigned into 5 groups of 20 to yield groups with similar serum TG averages. Each group of 20 is then further subdivided into 4 groups of 5 with similar serum triglyceride averages. The Ab is administered to mice by a single subcutaneous injection at 1 mg/kg (n=20), 3 mg/kg (n=20), 10 mg/kg (n=20), or 30 mg/kg (n=20) to 4 separate groups of animals. A control antigen binding null isotype matched mAb is administered by a single subcutaneous injection at 30 mg/kg (n=20) to a fifth group of animals.

(83) Blood is collected from the animals 1 hour (n=5), 8 hours (n=5), 1 day (n=5), 2 days (n=5), 3 days (n=5), 7 days (n=5), 14 days (n=5) and 21 days (n=5) after Ab administration. Blood is collected from subgroup A animals at times 1 hour and 3 days. Blood is collected from subgroup B animals at times 8 hours and 7 days. Blood is collected from subgroup C animals at times 1 day and 14 days. Blood is collected from subgroup D animals at times 2 days and 21 days. Serum is prepared from the blood and serum TG levels were measured using a Cobas® clinical chemistry analyzer (Roche). Percent change of TG from the time matched isotype control is calculated for each dose of Ab at each time point. The calculation for percent change is [(Rx Serum triglyceride—time matched isotype control serum triglyceride)/(time matched isotype control serum triglyceride)]×100. Data is shown in Table 13.

(84) TABLE-US-00013 TABLE 13 Percent TG Lowering by Ab Compared to IgG Control of Different Doses of Ab at Different Time Points. Time Post 1 8 1 2 3 7 14 21 Dose hour hour day day day day day day 1 mg/ −22 −33 −76* −66* −61*   41    6.4 −20 kg 3 mg/ −26 −71* −84* −77* −86* −25   19.7 −19 kg 10 mg/ −27 −62* −87* −89* −88* −88* −64.4* −28 kg 30 mg/ −23 −74* −92* −87* −93* −93* −89.1* −75* kg Dunnett's test is used for each data set to compare each treatment group to a time matched control and a p-value of <0.05 was considered statistically significant. Groups statistically significant from their time matched controls are designated by a (*) in the table.

(85) The potency of the Ab having a LC of SEQ ID NO:5 and HC of SEQ ID NO:6 at lowering TGs is favorable starting at Day 1 and the favorable effect is sustained until Day 21.

(86) In addition to the above anti-ANGPTL3/8 complex Ab having a LC of SEQ ID NO:5 and a HC of SEQ ID NO:6, Abs with LC variants having a D31S mutation (SEQ ID NO:21), a D33A mutation (SEQ ID NO:22) or a E99Q mutation (SEQ ID NO:25) and a HC of SEQ ID NO:6 are assayed to evaluate change in TGs relative to an IgG control in mice (Table 14).

(87) TABLE-US-00014 TABLE 14 Percent TG Lowering Compared to IgG Control of Different Doses of Variant Abs at Different Time Points. Time Post Dose 1 day 7 day 15 day 21 day D31S −83* −38* −25  −12 3 mg/kg D31S −90* −91* −37* −21 10 mg/kg D33A −74* −77* −34* −10 3 mg/kg D33A −78* −86* −76*  −60* 10 mg/kg E99Q −82* −49* −5  15 3 mg/kg E99Q −86* −91* −61*  6 10 mg/kg Dunnett's test is used for each data set to compare each treatment group to a time matched control and a p-value of < 0.05 was considered statistically significant. Groups statistically significant from their time matched controls are designated by a (*) in the table.

SEQUENCE LISTING

(88) The following nucleic and amino acid sequences are referred to in the disclosure above and are provided below for reference.

(89) TABLE-US-00015 SEQ ID NO: 1 atatatagagttaagaagtctaggtctgcttccagaagaaaacagttccacgttgcttgaaattgaaaatcaagataaaaatgttcac aattaagctccttctttttattgttcctctagttatttcctccagaattgatcaagacaattcatcatttgattctctatctccagagccaaaa tcaagatttgctatgttagacgatgtaaaaattttagccaatggcctccttcagttgggacatggtcttaaagactttgtccataagac gaagggccaaattaatgacatatttcaaaaactcaacatatttgatcagtctttttatgatctatcgctgcaaaccagtgaaatcaaag aagaagaaaaggaactgagaagaactacatataaactacaagtcaaaaatgaagaggtaaagaatatgtcacttgaactcaactc aaaacttgaaagcctcctagaagaaaaaattctacttcaacaaaaagtgaaatatttagaagagcaactaactaacttaattcaaaat caacctgaaactccagaacacccagaagtaacttcacttaaaacttttgtagaaaaacaagataatagcatcaaagaccttctcca gaccgtggaagaccaatataaacaattaaaccaacagcatagtcaaataaaagaaatagaaaatcagctcagaaggactagtatt caagaacccacagaaatttctctatcttccaagccaagagcaccaagaactactccctttcttcagttgaatgaaataagaaatgta aaacatgatggcattcctgctgaatgtaccaccatttataacagaggtgaacatacaagtggcatgtatgccatcagacccagcaa ctctcaagtttttcatgtctactgtgatgttatatcaggtagtccatggacattaattcaacatcgaatagatggatcacaaaacttcaat gaaacgtgggagaactacaaatatggttttgggaggcttgatggagaattttggttgggcctagagaagatatactccatagtgaa gcaatctaattatgttttacgaattgagttggaagactggaaagacaacaaacattatattgaatattctttttacttgggaaatcacga aaccaactatacgctacatctagttgcgattactggcaatgtccccaatgcaatcccggaaaacaaagatttggtgttttctacttgg gatcacaaagcaaaaggacacttcaactgtccagagggttattcaggaggctggtggtggcatgatgagtgtggagaaaacaac ctaaatggtaaatataacaaaccaagagcaaaatctaagccagagaggagaagaggattatcttggaagtctcaaaatggaagg ttatactctataaaatcaaccaaaatgttgatccatccaacagattcagaaagctttgaatgaactgaggcaaatttaaaaggcaata atttaaacattaacctcattccaagttaatgtggtctaataatctggtattaaatccttaagagaaagcttgagaaatagattttttttatct taaagtcactgtctatttaagattaaacatacaatcacataaccttaaagaataccgtttacatttctcaatcaaaattcttataatactatt tgttttaaattttgtgatgtgggaatcaattttagatggtcacaatctagattataatcaataggtgaacttattaaataacttttctaaata aaaaatttagagacttttattttaaaaggcatcatatgagctaatatcacaactttcccagtttaaaaaactagtactcttgttaaaactct aaacttgactaaatacagaggactggtaattgtacagttcttaaatgttgtagtattaatttcaaaactaaaaatcgtcagcacagagt atgtgtaaaaatctgtaatacaaatttttaaactgatgcttcattttgctacaaaataatttggagtaaatgtttgatatgatttatttatgaa acctaatgaagcagaattaaatactgtattaaaataagttcgctgtctttaaacaaatggagatgactactaagtcacattgactttaa catgaggtatcactataccttatttgttaaaatatatactgtatacattttatatattttaacacttaatactatgaaaacaaataattgtaaa ggaatcttgtcagattacagtaagaatgaacatatttgtggcatcgagttaaagtttatatttcccctaaatatgctgtgattctaataca ttcgtgtaggttttcaagtagaaataaacctcgtaacaagttactgaacgtttaaacagcctgacaagcatgtatatatgtttaaaattc aataaacaaagacccagtccctaaattatagaaatttaaattattcttgcatgtttatcgacatcacaacagatccctaaatccctaaat ccctaaagattagatacaaattttttaccacagtatcacttgtcagaatttatttttaaatatgattttttaaaactgccagtaagaaatttta aattaaacccatttgttaaaggatatagtgcccaagttatatggtgacctacctttgtcaatacttagcattatgtatttcaaattatccaa tatacatgtcatatatatttttatatgtcacatatataaaagatatgtatgatctatgtgaatcctaagtaaatattttgttccagaaaagta caaaataataaaggtaaaaataatctataattttcaggaccacagactaagctgtcgaaattaacgctgatttttttagggccagaat accaaaatggctcctctcttcccccaaaattggacaatttcaaatgcaaaataattcattatttaatatatgagttgcttcctctatt SEQ ID NO: 2 MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGL KDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEV KNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVE KQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTT PFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPW TLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELED WKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGH FNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSI KSTKMLIHPTDSESFE SEQ ID NO: 3 ataccttagaccctcagtcatgccagtgcctgctctgtgcctgctctgggccctggcaatggtgacccggcctgcctcagcggcc cccatgggcggcccagaactggcacagcatgaggagctgaccctgctcttccatgggaccctgcagctgggccaggccctca acggtgtgtacaggaccacggagggacggctgacaaaggccaggaacagcctgggtctctatggccgcacaatagaactcct ggggcaggaggtcagccggggccgggatgcagcccaggaacttcgggcaagcctgttggagactcagatggaggaggatat tctgcagctgcaggcagaggccacagctgaggtgctgggggaggtggcccaggcacagaaggtgctacgggacagcgtgc agcggctagaagtccagctgaggagcgcctggctgggccctgcctaccgagaatttgaggtcttaaaggctcacgctgacaag cagagccacatcctatgggccctcacaggccacgtgcagcggcagaggcgggagatggtggcacagcagcatcggctgcga cagatccaggagagactccacacagcggcgctcccagcctgaatctgcctggatggaactgaggaccaatcatgctgcaagg aacacttccacgccccgtgaggcccctgtgcagggaggagctgcctgttcactgggatcagccagggcgccgggccccactt ctgagcacagagcagagacagacgcaggcggggacaaaggcagaggatgtagccccattggggaggggtggaggaagga catgtaccctttcatgcctacacacccctcattaaagcagagtcgtggcatctcaaaaaaaaaaaaaaaaa SEQ ID NO: 4 MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVY RTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQ AEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSH ILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA SEQ ID NO: 5 DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYM LSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQRIEFPLTFGGGTKVEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 6 QVTLKESGPTLVKPTQTLTLTCTFSGFSLSISGVGVGWIRQPPGKALEWLALIYRN DDKRYSPSLKSRLTITKDTSKNQVVLTLTNMDPVDTATYYCARTYSSGWYGNW FDPWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDK RVESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPE VQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHN HYTQKSLSLSLG SEQ ID NO: 7 Gatattgtgatgacccagacccccctgtctctgcctgtcactccgggggaaccggcctcgatctcatgccggtcgagccagtccc tgctggactccgatgacgggaacacttatttggattggtacctccaaaagcctggacagagcccgcagctcctgatctacatgctg tcctaccgggcctccggagtgccagaccgcttctcgggaagcggctccggtaccgacttcacactgaagatctcccgcgtgga agctgaggacgtgggcatctactactgtatgcaaagaatcgagttccccctcaccttcggcggcgggactaaggtcgagattaa gagaaccgtggccgcaccatccgtgttcatttttcccccgtccgatgaacagctgaagtccggaaccgcctccgtcgtgtgcctg ctcaacaacttctacccgagggaagcgaaagtgcagtggaaagtggacaatgcgctgcagtccggaaactcccaagagtccgt gaccgaacaggactccaaggactcaacctactcgctgagctcaacgctgaccctgagcaaggccgactacgagaagcacaag gtctacgcctgcgaagtgacccatcagggtttgagctcgcccgtgaccaagtccttcaaccggggagagtgc SEQ ID NO: 8 caagtcacattgaaggagagcggtccgaccctggtcaagccgactcagaccctgaccctgacgtgcactttctcgggcttctcat tgtccatttctggagtgggcgtgggatggatcagacagcccccggggaaggccctcgagtggctcgcgctgatctaccgcaac gacgacaaacgctactccccctcactgaaatcccggctgaccatcactaaggatacgtccaagaaccaggtcgtgttgaccctc accaacatggatcccgtggatactgccacctactattgtgcacggacctatagcagcggttggtacggaaactggttcgacccgt ggggccagggaactcttgtgacggtgtcctccgcaagcaccaagggtccttctgtgttccccctggcgccgtgctcgcggagca cctcagagtccaccgccgccctcggctgccttgtgaaggactacttcccggagccagtcaccgtgtcctggaacagcggggcc ctgacttccggcgtgcacaccttccctgcggtgctgcagagctcaggcctctattcgctgtcatccgtcgtgaccgtgccttcctcg tccctgggcactaagacctacacttgcaacgtggaccataagcccagcaacaccaaagtggacaagagagtggaatccaaata cggaccgccatgtccgccctgccccgccccggaagctgccgggggacccagcgtgttcctgttcccacctaagccgaaggac actctgatgatctcaaggactcccgaagtcacttgcgtggtcgtggacgtgtcccaggaggaccccgaagtccagtttaattggta cgtggatggtgtcgaggtccacaacgccaagaccaagcctcgcgaggaacagttcaattccacctaccgggtcgtgtccgtcct gaccgtgctgcatcaggactggctgaacggaaaggagtacaagtgcaaagtgtccaacaagggactcccttcctccatcgaaa agaccatcagcaaggccaagggccagcctcgcgaaccacaagtctacaccctgcccccatcgcaagaggaaatgaccaaga accaagtgtcgctgacatgcctcgtcaagggattctacccgtcggatattgcggtggaatgggagtccaacggacagcccgaga acaactacaagaccaccccgccggtgttggactccgacggctcctttttcctgtactcccggctcactgtggacaagtcgcggtg gcaggaggggaacgtgttctcctgttccgtgatgcacgaagctctgcacaaccactacacccagaagtcgctgagcctctcact ggga SEQ ID NO: 9 DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYM LSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQRIEFPLTFGGGTKVEI K SEQ ID NO: 10 QVTLKESGPTLVKPTQTLTLTCTFSGFSLSISGVGVGWIRQPPGKALEWLALIYRN DDKRYSPSLKSRLTITKDTSKNQVVLTLTNMDPVDTATYYCARTYSSGWYGNW FDPWGQGTLVTVSS SEQ ID NO: 11 RSSQSLLDSDDGNTYLD SEQ ID NO: 12 YMLSYRAS SEQ ID NO: 13 MQRIEFPLT SEQ ID NO: 14 TFSGFSLSISGVGVG SEQ ID NO: 15 LIYRNDDKRYSPSLKS SEQ ID NO: 16 ARTYSSGWYGNWFDP SEQ ID NO: 17 MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGL KDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEV KNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVE KQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTT PFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPW TLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELED WKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGH FNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSI KSTKMLIHPTDSESFEAAADYKDDDDK SEQ ID NO: 18 METDTLLLWVLLLWVPGSTGDHHHHHHDAHKSEVAHRFKDLGEENFKALVLIA FAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATL RETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEET FLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDE GKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKV HTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVEND EMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRL AKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQ NALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVL NQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHAD ICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKET CFAEEGKKLVAASQAALGLAPAPAPAPAPAPAPAPAPAPLEVLFQGPGRAAPMG GPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQE VSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLE VQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQI QERLHTAALPA SEQ ID NO: 19 SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIF QKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLL EEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVED QYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGI PAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNET WENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLG NHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWH DECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE AAADYKDDDDK SEQ ID NO: 20 GPGRAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLY GRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQK VLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREM VAQQHRLRQIQERLHTAALPA SEQ ID NO: 21 DIVMTQTPLSLPVTPGEPASISCRSSQSLLSSDDGNTYLDWYLQKPGQSPQLLIYM LSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQRIEFPLTFGGGTKVEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 22 DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSADGNTYLDWYLQKPGQSPQLLIYM LSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQRIEFPLTFGGGTKVEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 23 DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSTDGNTYLDWYLQKPGQSPQLLIYM LSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQRIEFPLTFGGGTKVEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 24 DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYT LSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQRIEFPLTFGGGTKVEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 25 DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYM LSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGIYYCMQRIQFPLTFGGGTKVEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC