REAGENTS FOR DETECTING OR DIAGNOSING CANCER CELLS HAVING HIGH INVASIVE CAPACITY
20170313770 · 2017-11-02
Assignee
Inventors
Cpc classification
G01N33/57484
PHYSICS
C07K16/28
CHEMISTRY; METALLURGY
G01N33/57492
PHYSICS
C07K2317/34
CHEMISTRY; METALLURGY
G01N33/577
PHYSICS
International classification
Abstract
The present invention provides a reagent for detection or diagnosis of cancer, which comprises a monoclonal antibody against MCT5 or a fragment thereof.
Claims
1. A reagent for detection or diagnosis of a cancer having invasive capacity, which comprises a monoclonal antibody against monocarboxylate transporter 5 (MCT5) or a fragment of the antibody.
2. The reagent according to claim 1, wherein the antibody or fragment thereof binds to the extracellular region of monocarboxylate transporter 5 (MCT5).
3. The reagent according to claim 2, wherein the extracellular region comprises the amino acid sequence shown in SEQ ID NO: 15.
4. The reagent according to claim 1, wherein the cancer is at least one selected from the group consisting of breast cancer, colorectal cancer, lung cancer, ovarian cancer, uterine cancer, uterine cervical cancer, esophageal cancer, thyroid cancer, skin cancer, gastric cancer, pancreatic cancer, brain tumor, tongue cancer, small intestinal cancer, duodenal cancer, bladder cancer, kidney cancer, liver cancer, prostate cancer, cervical cancer, gallbladder cancer, pharyngeal cancer, sarcoma, melanoma, leukemia, lymphoma and multiple myeloma.
5. The reagent according to claim 1, wherein the cancer is at least one selected from the group consisting of breast cancer, colorectal cancer, lung cancer, ovarian cancer, uterine cancer, uterine cervical cancer, esophageal cancer, thyroid cancer and skin cancer.
6. The reagent according to claim 1, wherein the cancer is at least one selected from the group consisting of breast cancer, colorectal cancer and lung cancer.
7. The reagent according to claim 1, wherein the cancer is breast cancer or colorectal cancer.
8. A method for detection of cancer, which comprises the step of contacting a monoclonal antibody against monocarboxylate transporter 5 (MCT5) or a fragment of the antibody with a biological sample taken from a subject to thereby detect MCT5 in the sample.
9. A method for diagnosis of cancer, which comprises the step of contacting a monoclonal antibody against monocarboxylate transporter 5 (MCT5) or a fragment of the antibody with a biological sample taken from a subject to thereby detect MCT5 in the sample.
10. The method according to claim 8 or 9, wherein the cancer is a cancer having invasive capacity.
11. A monoclonal antibody against monocarboxylate transporter 5 (MCT5) or a fragment of the antibody.
12. A kit for detection of cancer, which comprises a monoclonal antibody against monocarboxylate transporter 5 (MCT5) or a fragment of the antibody.
13. The kit according to claim 12, wherein the cancer is a cancer having invasive capacity.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
DESCRIPTION OF EMBODIMENTS
[0068] The present invention will be described in more detail below. The following embodiments are illustrated to describe the present invention, and it is not intended to limit the present invention only to these embodiments. The present invention can be implemented in various modes, without departing from the spirit of the present invention.
1. Summary
[0069] The present invention relates to a reagent for detection or diagnosis of highly invasive cancer cells, which comprises a monoclonal antibody against monocarboxylate transporter 5 (MCT5) or solute carrier family 16 member 4 (SLC16A4) or a fragment of the antibody.
[0070] As a result of extensive and intensive efforts made with a focus on MCT5 which is a transmembrane protein, the inventors of the present invention have found that MCT5 is related to the invasive capacity of cancer cells, and have elucidated that upon detection of MCT5, the invasive capacity of cancer can be evaluated, i.e., the presence of cancer cells which are highly likely to cause metastasis and/or recurrence can be detected in cancer tissues. Moreover, the inventors of the present invention have found that MCT5 expression is enhanced in a part of cancer tissue particularly in breast cancer and colorectal cancer, lung cancer, ovarian cancer, uterine cancer, uterine cervical cancer, esophageal cancer, thyroid cancer and skin cancer.
[0071] Accordingly, the present invention provides a cancer marker comprising MCT5.
[0072] Moreover, the inventors of the present invention have succeeded in preparing a monoclonal antibody against MCT5, which allows cancer detection with extremely high sensitivity and high accuracy when compared to conventionally known antibodies. The antibody of the present invention allows detection of highly invasive cancers with high sensitivity even at an early stage of cancer progression and also allows detection of living cancer cells because of being capable of binding to the extracellular region of MCT5, which in turn allows detection of cancer cells present in blood samples, by way of example. Namely, when using the antibody of the present invention, highly invasive cancers which have been undetectable by conventional methods can be detected in a simple manner with high sensitivity and high accuracy, so that the antibody of the present invention is very useful for detection or diagnosis of highly malignant cancer cells. The present invention has been completed on the basis of such findings.
2. Antibody Against MCT5 (Anti-MCT5 Antibody)
(1) Antigen Preparation
[0073] MCT5 intended in the present invention may be derived from any mammal, and examples of such a mammal include mice, rats, rabbits, goats, dogs, monkeys and humans, with mice, rats and humans being preferred, and with humans being more preferred.
[0074] In the present invention, the amino acid sequences of human, mouse and rat MCT5 are shown in SEQ ID NOs: 2, 4 and 6, respectively. Likewise, the nucleotide sequences of DNAs encoding human, mouse and rat MCT5 are shown in SEQ ID NOs: 1, 3 and 5, respectively. These amino acid sequences and nucleotide sequences have been registered in the GenBank database under the accession numbers (Accession Nos.) given to the respective sequences.
TABLE-US-00003 Amino acid sequence of human MCT5: NP_004687.1 (SEQ ID NO: 2) MLKREGKVQPYTKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQE EFEGTSEQIGWIGSIMSSLRFCAGPLVAIICDILGEKTTSILGAFVVTGG YLISSWATSIPFLCVTMGLLPGLGSAFLYQVAAVVTTKYFKKRLALSTAI ARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAIALNLVPSSMLLRPIHI KSENNSGIKDKGSSLSAHGPEAHATETHCITETEESTIKDSTTQKAGLPS KNLTVSQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISLFRNP FFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETV SQIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTICF AIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLY DYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT* Amino acid sequence of mouse MCT5: NP_666248.1 (SEQ ID NO: 4) MVKKEKTPSPYTKPLDGGWGWMVVLHFFLVNVFVMGMTKTFAIFFVVFQE EFEGTSEQIGWIGSIMSSLRFSAGPLAAIICDVLGEKATSILGTFLVSGG YVISSWATGIPFLCVTMGLLPGLGSAFLYQVAAVVITKYFKKRLGLSTAI ARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAIILNLVPSSMLLRPIHS QSNNNSDIENKGSILSATEPEASYKTETSKCKETQEPFIKDSTMKKSEQP TTTLTVLGNQSEEFSNRPHRNRPLLMSNGKSHKKKFVSWNCKQKLLDISL FRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDVMDASYLVSVAGI TETVSQLISGWIADQNWIKKYQYHKSYLILCGVTNLLAPLATTFPLLMAY TILFAIFAGGYLALILPVLVDLSKNSRVHKFLGYASFFAGIAVLSGPPIA GWIYDYTQTYTGSFYFSGTCYILSSVSLFFVPLAERWKRKQSDLLRTTIK * Amino acid sequence of rat MCT5: NP_666248.1 (SEQ ID NO: 6) MKKREEKPSPYTKPLDGGWGWMVVLHFFLVNVFVMGMTKTFAIFFVVFQE EFEGTSEQIGWIGSIMSSLRFSAGPLAAIICDIFGEKTTSILGTFLVSGG YLISSWATGIPFLCVTMGLLPGLGSAFLYQVAAVVITKYFKKRLGLSTAI ARSGMGLTFLLAPFTKLLIDLYDWTGALILFGAIALNLVPSSMLLRPVHI QSDSNSDIKNKGSILSATGPELSHKTETPNRNKAQESLIKDSAVKKSGQP TTTLTVLENQIEEISTRPHRNRPLLMSNDKTYKKKFVSWNCKEKLLDISL FRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGI TETVSQLISGWIADQNWIKKYQYHKAYLILCGVTNLLAPLATTFPLLMAY TIFFAIFAGGYLALILPVLVDLSKNSRVERFLGYASFFAGMAVLSGPPIA GWIYDYTQTYVGSFYFSGTCYILSSVSLFFVPLAERWKLKQSDLLRTTIK * Nucleotide sequence of DNA encoding human MCT5: NM_004696.2 (SEQ ID NO: 1) ATGCTGAAGAGGGAGGGGAAGGTCCAACCTTACACTAAAACCCTGGATGG AGGATGGGGATGGATGATTGTGATTCATTTTTTCCTGGTGAATGTGTTTG TGATGGGGATGACCAAGACTTTTGCAATTTTCTTTGTGGTCTTTCAAGAA GAGTTTGAAGGCACCTCAGAGCAAATTGGTTGGATTGGATCCATCATGTC ATCTCTTCGTTTTTGTGCAGGTCCCCTGGTTGCTATTATTTGTGACATAC TTGGAGAGAAAACTACCTCCATTCTTGGGGCTTTCGTTGTTACTGGTGGA TATCTGATCAGCAGCTGGGCCACAAGTATTCCTTTTCTTTGTGTGACTAT GGGACTTCTACCCGGTTTGGGTTCTGCTTTCTTATACCAAGTGGCTGCTG TGGTAACTACCAAATACTTCAAAAAACGATTGGCTCTTTCTACAGCTATT GCCCGTTCTGGGATGGGACTGACTTTTCTTTTGGCACCCTTTACAAAATT CCTGATAGATCTGTATGACTGGACAGGAGCCCTTATATTATTTGGAGCTA TCGCATTGAATTTGGTGCCTTCTAGTATGCTCTTAAGACCCATCCATATC AAAAGTGAGAACAATTCTGGTATTAAAGATAAAGGCAGCAGTTTGTCTGC ACATGGTCCAGAGGCACATGCAACAGAAACACACTGCCATGAGACAGAAG AGTCTACCATCAAGGACAGTACTACGCAGAAGGCTGGACTACCTAGCAAA AATTTAACAGTCTCACAAAATCAAAGTGAAGAGTTCTACAATGGGCCTAA CAGGAACAGACTGTTATTAAAGAGTGATGAAGAAAGTGATAAGGTTATTT CGTGGAGCTGCAAACAACTGTTTGACATTTCTCTCTTTAGAAATCCTTTC TTCTACATATTTACTTGGTCTTTTCTCCTCAGTCAGTTAGCATACTTCAT CCCTACCTTTCACCTGGTAGCCAGAGCCAAAACACTGGGGATTGACATCA TGGATGCCTCTTACCTTGTTTCTGTAGCAGGTATCCTTGAGACGGTCAGT CAGATTATTTCTGGATGGGTTGCTGATCAAAACTGGATTAAGAAGTATCA TTACCACAAGTCTTACCTCATCCTCTGCGGCATCACTAACCTGCTTGCTC CTTTAGCCACCACATTTCCACTACTTATGACCTACACCATCTGCTTTGCC ATCTTTGCTGGTGGTTACCTGGCATTGATACTGCCTGTACTGGTTGATCT GTGTAGGAATTCTACAGTAAACAGGTTTTTGGGACTTGCCAGTTTCTTTG CTGGGATGGCTGTCCTTTCTGGACCACCTATAGCAGGCTGGTTATATGAT TATACCCAGACATACAATGGCTCTTTCTACTTCTCTGGCATATGCTATCT CCTCTCTTCAGTTTCCTTTTTTTTTGTACCATTGGCCGAAAGATGGAAAA ACAGTCTGACCTGA Nucleotide sequence of DNA encoding mouse MCT5: NM_146136.1 (SEQ ID NO: 3) ATGGTGAAGAAGGAAAAAACGCCCTCCCCTTACACCAAACCCCTTGATGG AGGATGGGGGTGGATGGTCGTGCTTCATTTTTTCCTGGTAAATGTGTTTG TGATGGGAATGACCAAGACATTTGCAATTTTCTTTGTGGTTTTTCAAGAA GAGTTTGAAGGCACTTCAGAGCAAATTGGTTGGATTGGATCCATTATGTC ATCACTCCGTTTCTCTGCAGGTCCCCTGGCTGCTATCATCTGTGACGTAC TTGGAGAGAAAGCTACCTCCATTCTTGGGACGTTCCTTGTCTCTGGTGGC TATGTCATCAGCAGCTGGGCCACAGGCATTCCCTTTCTTTGTGTGACCAT GGGGCTGCTACCTGGTTTGGGATCTGCTTTCTTGTACCAAGTAGCTGCTG TGGTAATTACCAAATATTTCAAAAAACGATTGGGCCTTTCTACAGCAATT GCCCGTTCTGGAATGGGGCTGACATTTTTGTTGGCACCCTTTACAAAATT CCTCATAGATCTTTATGACTGGACAGGCGCTCTTATTTTATTTGGAGCAA TTATATTGAACTTGGTGCCTTCCAGCATGCTCTTAAGACCCATCCACAGC CAATCAAACAACAATTCTGACATTGAAAACAAAGGTAGCATTTTGTCTGC AACTGAACCAGAGGCATCATACAAGACAGAGACATCGAAGTGCAAGGAGA CACAGGAGCCTTTCATCAAAGACAGTACTATGAAGAAATCTGAACAACCT ACCACAACCTTAACTGTCTTAGGAAATCAAAGCGAAGAGTTCAGCAATAG GCCTCACAGGAACAGGCCGTTACTTATGAGCAATGGCAAAAGTCACAAGA AAAAGTTTGTTTCATGGAACTGCAAACAAAAACTTTTAGATATCTCGCTC TTTAGAAACCCTTTCTTCTACATTTTTACCTGGTCTTTTCTCCTGAGCCA ATTAGCATATTTCATTCCCACTTTCCACCTAGTAGCCAGAGCAAAAACAC TTGGGATTGACGTAATGGATGCCTCCTACCTTGTGTCTGTAGCTGGTATC ACTGAGACAGTCAGTCAGCTCATTTCTGGATGGATTGCTGATCAAAATTG GATCAAGAAGTATCAATACCACAAGTCTTACCTCATTCTGTGTGGTGTGA CTAACCTGCTTGCTCCTTTAGCCACCACATTCCCACTCCTTATGGCCTAT ACCATCCTTTTTGCCATTTTTGCTGGTGGCTACCTGGCACTAATACTGCC AGTATTGGTTGACCTATCTAAGAATTCTAGAGTACACAAGTTTTTGGGAT ATGCCAGTTTCTTTGCCGGGATAGCTGTACTTTCTGGACCACCAATAGCA GGCTGGATATATGATTACACACAGACTTACACAGGCTCTTTCTATTTCTC TGGCACCTGCTATATCCTCTCTTCAGTTTCCCTTTTTTTTGTACCACTGG CTGAAAGATGGAAACGCAAACAGTCTGACCTTCTGAGGACTACAATCAAG TAA Nucleotide sequence of DNA encoding rat MCT5: NM_001013913.1 (SEQ ID NO: 5) ATGAAGAAGAGGGAAGAAAAGCCCTCCCCTTACACCAAACCCCTGGATGG AGGATGGGGATGGATGGTTGTGCTTCATTTTTTCCTGGTGAATGTGTTTG TGATGGGAATGACCAAGACATTTGCAATTTTCTTTGTGGTTTTTCAAGAA GAGTTTGAAGGCACTTCAGAGCAAATTGGTTGGATTGGATCTATTATGTC ATCACTCCGTTTTTCTGCAGGTCCCCTGGCTGCTATTATTTGTGACATAT TTGGAGAAAAAACTACCTCCATTCTTGGGACTTTCCTTGTTTCTGGTGGC TATCTCATCAGCAGCTGGGCCACAGGCATTCCCTTTCTTTGTGTGACCAT GGGACTGCTACCTGGTTTGGGGTCTGCTTTCTTGTACCAAGTAGCTGCTG TGGTAATTACCAAATATTTCAAAAAACGATTGGGTCTTTCTACAGCAATT GCCCGTTCAGGGATGGGACTGACATTTTTGTTGGCACCCTTTACAAAACT CCTGATAGATCTTTATGACTGGACAGGTGCTCTTATATTATTTGGAGCTA TTGCATTGAATCTGGTGCCTTCCAGCATGCTCCTAAGACCTGTCCACATC CAATCAGACAGCAATTCTGATATTAAAAACAAAGGTAGCATTTTGTCTGC AACTGGACCAGAGTTATCACACAAGACAGAAACACCAAACCGCAATAAGG CACAAGAGTCTCTCATCAAAGACAGTGCTGTGAAGAAATCTGGACAACCT ACTACAACTTTAACTGTCTTAGAAAATCAAATTGAAGAGATTAGCACTAG GCCTCATAGGAACAGGCCGTTACTTATGAGCAATGACAAAACTTACAAGA AAAAGTTTGTTTCATGGAACTGCAAAGAAAAACTTCTAGATATTTCTCTC TTTAGAAATCCTTTCTTCTACATATTTACCTGGTCTTTTCTCCTGAGTCA ACTAGCATATTTCATTCCTACCTTTCATCTGGTAGCCAGAGCAAAAACAC TTGGAATCGACATAATGGATGCCTCCTACCTTGTGTCTGTAGCTGGTATC ACTGAGACAGTCAGTCAGCTCATTTCTGGATGGATTGCAGATCAGAATTG GATCAAGAAGTATCAATACCACAAGGCTTACCTCATCCTGTGTGGTGTTA CTAACCTGCTTGCTCCTTTAGCCACCACATTCCCACTCCTTATGGCCTAT ACCATCTTTTTTGCCATTTTTGCTGGTGGCTACCTGGCACTAATACTGCC AGTATTGGTTGACCTATCTAAGAATTCTAGAGTACACAGGTTTTTGGGAT ATGCCAGTTTCTITGCTGGGATGGCTGTTCTTTCTGGACCACCAATAGCA GGCTGGATATACGATTATACACAGACATACGTGGGCTCTTTCTATTTCTC TGGCACCTGCTATATCCTCTCTTCAGTTTCCCTTTTTTTTGTACCACTGG CTGAAAGATGGAAACTCAAGCAGTCTGACCTTCTAAGGACTACAATCAAG TAA
[0075] As an antigen, it is possible to use a polypeptide or peptide (also collectively referred to as a peptide) comprising at least a part (whole or a part) of the amino acid sequence of MCT5, preferably a peptide comprising at least a part (whole or a part) of the amino acid sequence of the extracellular region of MCT5.
[0076] The predicted extracellular region of MCT5 has been registered as O15374 (MOT5_HUMAN) in the Uniprot database. On the database, for example in the case of human MCT5, a region consisting of amino acids at positions 196 to 299 (SEQ ID NO: 7) in the amino acid sequence shown in SEQ ID NO: 2 is predicted to be an intracellular region (
[0077] The peptide to be used as an antigen is not limited in any way as long as it is at least a part of MCT5. Preferred is at least a part of the extracellular region of MCT5, e.g., at least a part of a region consisting of amino acids at positions 196 to 299 (SEQ ID NO: 7) in the amino acid sequence of MCT5 shown in SEQ ID NO: 2. Above all, more preferred is at least a part of a region consisting of amino acids at positions 227 to 258 (SEQ ID NO: 14), and particularly preferred is at least a part of a region consisting of amino acids at positions 251 to 258 (SEQ ID NO: 13). In the present invention, a region consisting of amino acids at positions 196 to 299 in the amino acid sequence of MCT5 shown in SEQ ID NO: 2 is also referred to as “ICD4.”
[0078] Moreover, MCT5 has mutants which are derived from the same mRNA but differ in their translation initiation site. For example, human MCT5 has mutants such as a peptide (SEQ ID NO: 44) lacking amino acids at positions 74 to 121, a peptide (SEQ ID NO: 45) lacking N-terminal 62 amino acids and having different amino acids at positions 63 to 73 from those of the wild type (SEQ ID NO: 2), a peptide (SEQ ID NO: 46) lacking N-terminal 110 amino acids and having different amino acids at positions 111 to 120 from those of the wild type (SEQ ID NO: 2), a peptide (SEQ ID NO: 47) lacking N-terminal 110 amino acids and having different amino acids at position 446 to the C-terminal end from those of the wild type (SEQ ID NO: 2), a peptide lacking amino acids at positions 179 to 346 and having leucine as an amino acid at position 177 in place of alanine in the wild type.
[0079] MCT5 intended in the present invention also includes these mutants.
TABLE-US-00004 SEQ ID NO: 44 MLKREGKVQPYTKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQE EFEGTSEQIGWIGSIMSSLRFCAGLGSAFLYQVAAVVTTKYFKKRLALST AIARSGMGLTFLLAPFTKFLIDLYDWTGALILFGAIALNLVPSSMLLRPI HIKSENNSGIKDKGSSLSAHGPEAHATETHCHETEESTIKDSTTQKAGLP SKNLTVSQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISLFRN PFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILET VSQIISGWVADQNWIKKYHYHKSYLILCGITNLLAPLATTFPLLMTYTIC FAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWL YDYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT* SEQ ID NO: 45 GSIMSSLRFCA SEQ ID NO: 46 MGMDDCDSFF SEQ ID NO: 47 EIIPSFQAGYMIIPRHTMALSTSLAYAISSLQFPFFLYHWPKDGKTV
[0080] MCT5 may be naturally occurring MCT5 purified from mouse, rat, human or other animal tissues or cells, or alternatively, may be produced through genetic engineering procedures. For example, a biological sample known to contain MCT5 may be fractionated into a soluble fraction and an insoluble fraction by using any type of surfactant such as Triton-X, Sarkosyl, etc. The insoluble fraction may further be dissolved in, e.g., urea or guanidine hydrochloride and then bound to any type of column, such as a heparin column, or any type of crosslinked resin to thereby obtain MCT5.
[0081] Alternatively, the peptide to be used as an antigen may be prepared by chemical synthesis or by synthesis through genetic engineering procedures using E. coli or the like. Techniques well known to those skilled in the art may be used for this purpose.
[0082] For chemical synthesis, the peptide may be synthesized by well-known peptide synthesis techniques. Moreover, the synthesis may be accomplished by applying either solid phase synthesis or liquid phase synthesis. A commercially available peptide synthesizer (e.g., PSSM-8, Shimadzu Corporation, Japan) may also be used for this purpose.
[0083] For peptide synthesis through genetic engineering procedures, DNA encoding the peptide is first designed and synthesized. The design and synthesis may be accomplished, for example, by PCR techniques using a vector or the like containing the full-length MCT5 gene as a template and using primers which have been designed to allow synthesis of a desired DNA region. Then, the above DNA may be ligated to an appropriate vector to obtain a recombinant vector for protein expression, and this recombinant vector may be introduced into a host, such that a desired gene can be expressed therein, thereby obtaining a transformant (Sambrook J. et al., Molecular Cloning, A Laboratory Manual (4th edition) (Cold Spring Harbor Laboratory Press (2012)).
[0084] As a vector, a phage or plasmid which is autonomously replicable in host microorganisms is used. Further, it is also possible to use an animal virus or insect virus vector. To prepare a recombinant vector, purified DNA may be cleaved with an appropriate restriction enzyme and ligated to a vector by being inserted into, e.g., an appropriate restriction enzyme site in the vector DNA. There is no particular limitation on the host for use in transformation as long as it is capable of expressing a desired gene. Examples include bacteria (e.g., E. coli, Bacillus subtilis), yeast, animal cells (e.g., COS cells, CHO cells), insect cells or insects. It is also possible to use a mammal (e.g., goat) as a host. Procedures for introduction of a recombinant vector into a host are known.
[0085] Moreover, the above transformant may be cultured, and a peptide for use as an antigen may be collected from the cultured product. The term “cultured product” is intended to mean either (a) a culture supernatant or (b) cultured cells or cultured microorganisms or a homogenate thereof.
[0086] After culture, when the desired peptide is produced within microorganisms or cells, the microorganisms or cells may be homogenized to thereby extract the peptide. Alternatively, when the desired peptide is produced outside microorganisms or cells, the cultured solution may be used directly or treated by centrifugation or other techniques to remove the microorganisms or cells. Then, the desired peptide may be isolated and purified by biochemical techniques commonly used for isolation and purification of peptides, as exemplified by ammonium sulfate precipitation, gel filtration, ion exchange chromatography, affinity chromatography and so on, which may be used either alone or in combination as appropriate.
[0087] In the present invention, the peptide to be used as an antigen may also be obtained by in vitro translation using a cell-free synthesis system. In this case, it is possible to use two methods, i.e., a method in which RNA is used as a template and a method in which DNA is used as a template (transcription/translation). As a cell-free synthesis system, a commercially available system may be used, as exemplified by an Expressway™ system (Invitrogen), etc.
[0088] The peptide obtained as described above may also be linked to an appropriate carrier protein such as bovine serum albumin (BSA), keyhole limpet hemocyanin (KLH), human thyroglobulin, avian gamma globulin, etc.
[0089] Moreover, the antigen intended in the present invention encompasses not only (a) a polypeptide comprising the amino acid sequence shown in SEQ ID NO: 2 or 7, but also (b) a polypeptide comprising an amino acid sequence with deletion, substitution or addition of one or several amino acids in the amino acid sequence shown in SEQ ID NO: 12 or 14, and (c) a polypeptide comprising an amino acid sequence sharing a homology of 70% or more with the amino acid sequence shown in SEQ ID NO: 13.
[0090] In the context of the present invention, the “polypeptide comprising the amino acid sequence shown in SEQ ID NO: 2 or 7” includes a polypeptide consisting of the amino acid sequence shown in SEQ ID NO: 12, 13 or 14.
[0091] Moreover, the “amino acid sequence with deletion, substitution or addition of one or several amino acids in the amino acid sequence shown in SEQ ID NO: 2 or 7” includes, for example:
[0092] (i) an amino acid sequence with deletion of 1 to 10 amino acids (e.g., 1 to 5 amino acids, preferably 1 to 3 amino acids, more preferably 1 or 2 amino acids, even more preferably a single amino acid) in the amino acid sequence shown in SEQ ID NO: 2 or 7;
[0093] (ii) an amino acid sequence with substitution of other amino acids for 1 to 5 amino acids (e.g., 1 to 4 amino acids, preferably 1 to 3 amino acids, more preferably 1 or 2 amino acids, even more preferably a single amino acid) in the amino acid sequence shown in SEQ ID NO: 12 or 14;
[0094] (iii) an amino acid sequence with addition of 1 or 2 amino acids (e.g., 1 or 2 amino acids, preferably a single amino acid) to the amino acid sequence shown in SEQ ID NO: 13; and
[0095] (iv) an amino acid sequence mutated by any combination of (i) to (iii) shown above.
[0096] In addition, MCT5 intended in the present invention encompasses not only a polypeptide comprising the amino acid sequence shown in SEQ ID NO: 2 or 7, but also a polypeptide comprising an amino acid sequence sharing a homology (identity) of 70% or more with the amino acid sequence shown in SEQ ID NO: 2 or 7. Such a polypeptide also includes those comprising amino acid sequences sharing a homology of about 70% or more, 75% or more, about 80% or more, 85% or more, 90% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more with the amino acid sequence shown in SEQ ID NO: 2 or 7 (i.e., amino acid sequences substantially equivalent to the amino acid sequence shown in SEQ ID NO: 2 or 7). For homology determination, it is possible to use homology search tools such as FASTA, BLAST, PSI-BLAST and so on in a homology search site on the Internet (e.g., DNA Data Bank of Japan (DDBJ)). Alternatively, it is also possible to conduct a BLAST search in the National Center for Biotechnology Information (NCBI).
[0097] To prepare the above mutation-carrying proteins, mutations may be introduced into a gene (DNA) encoding the protein by using a kit for mutation introduction based on site-directed mutagenesis (e.g., Kunkel method or Gapped duplex method), as exemplified by a QuikChange™ Site-Directed Mutagenesis Kit (Stratagene), GeneTailor™ Site-Directed Mutagenesis Systems (Invitrogen), TaKaRa Site-Directed Mutagenesis Systems (e.g., Mutan-K, Mutan-Super Express Km; Takara Bio Inc., Japan). Alternatively, it is also possible to use techniques for site-directed mutagenesis as described in “Molecular Cloning, A Laboratory Manual (4th edition)” (Cold Spring Harbor Laboratory Press (2012)), etc.
[0098] In the present invention, the gene to be introduced into cells or the like may be a gene encoding MCT5 or a partial fragment thereof or a mutated peptide thereof. As such a gene, it is possible to use a gene comprising the nucleotide sequence shown in SEQ ID NO: 1, 3 or 5, by way of example.
[0099] Alternatively, the gene to be introduced into cells or the like may also be a gene comprising a nucleotide sequence or a partial sequence thereof, which is hybridizable under stringent conditions with a sequence complementary to the nucleotide sequence shown in SEQ ID NO: 1, 3 or 5.
[0100] In the context of the present invention, the term “stringent conditions” may be any of low stringent conditions, moderately stringent conditions and high stringent conditions. “Low stringent conditions” refer to, for example, conditions of 5×SSC, 5×Denhardt's solution, 0.5% SDS, 50% formamide and 32° C. Likewise, “moderately stringent conditions” refer to, for example, conditions of 5×SSC, 5×Denhardt's solution, 0.5% SDS, 50% formamide and 42° C. “High stringent conditions” refer to, for example, conditions of 5×SSC, 5×Denhardt's solution, 0.5% SDS, 50% formamide and 50° C. Under these conditions, it can be expected that DNA having a higher homology is more efficiently obtained at a higher temperature. However, the stringency of hybridization would be affected by a plurality of factors, including temperature, probe concentration, probe length, ionic strength, reaction time, salt concentration and so on. Those skilled in the art would be able to achieve the same stringency by selecting these factors as appropriate.
[0101] Moreover, the gene encoding MCT5 for use in the present invention also encompasses a gene comprising a nucleotide sequence sharing a homology of 60% or more with the nucleotide sequence shown in SEQ ID NO: 1, 3 or 5. Such a gene may be exemplified by a gene sharing a homology of 60% or more, 70% or more, 80% or more, 85% or more, 90% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more with the nucleotide sequence shown in SEQ ID NO: 1, 3 or 5, as calculated by homology search software such as FASTA or BLAST using default parameters.
[0102] The above gene encoding MCT5 or mutants thereof can be obtained, for example, on the basis of the nucleotide sequences found in the NCBI GenBank database by using known genetic engineering procedures as described in “Molecular Cloning, A Laboratory Manual (4th edition)” (Cold Spring Harbor Laboratory Press (2012)).
(2) Preparation of Polyclonal Antibodies
[0103] The thus prepared MCT5 or partial peptide thereof is administered directly or together with a carrier or diluent to immunize non-human mammals (e.g., rabbits, dogs, guinea pigs, mice, rats, goats). The amount of the antigen to be administered per animal is 1 μg to 10 mg in the case of using an adjuvant. Examples of an adjuvant include Freund's complete adjuvant (FCA), Freund's incomplete adjuvant (FIA), aluminum hydroxide adjuvant and so on. Immunization is accomplished primarily by injection via the intravenous, subcutaneous or intraperitoneal route, etc. Moreover, the interval between immunizations is not limited in any way, and immunization may be repeated twice to 20 times, preferably 5 to 15 times, at intervals of several days to several weeks, preferably at intervals of 1 or 2 weeks.
[0104] Those skilled in the art would be able to determine the interval between immunizations in consideration of the resulting antibody titers. Preferably, at the time of repeating subcutaneous immunization 3 to 4 times, blood is sampled and measured for antibody titers. Antibody titers in serum may be measured by ELISA (enzyme-linked immunosorbent assay), EIA (enzyme immunoassay), radioimmunoassay (RIA), etc. After antibody titers have been confirmed to rise sufficiently, blood may be collected completely and treated in a commonly used manner to separate and purify antibodies. For separation and purification, known techniques such as salting out with ammonium sulfate, ion exchange chromatography, gel filtration chromatography, affinity chromatography and so on may be selected as appropriate or used in combination. More specifically, serum containing desired antibodies may be passed through a column on which proteins other than MCT5 have been immobilized, and fractions passing through the column may be collected to thereby obtain polyclonal antibodies with improved specificity to MCT5.
(3) Preparation of Monoclonal Antibodies
(i) Collection of Antibody-Producing Cells
[0105] As in the case of polyclonal antibody preparation, MCT5 or a partial peptide thereof (e.g., ICD4 (SEQ ID NO: 7) or ICD4_251-258 (SEQ ID NO: 13)) is administered directly or together with a carrier or diluent to immunize non-human mammals. The amount of the antigen to be administered per animal, the type of adjuvant to be used, the method of immunization and the interval between immunizations are the same as those used for preparation of polyclonal antibodies. After 1 to 30 days, preferably 2 to 5 days, from the final immunization date, animals showing antibody titers may be selected to collect antibody-producing cells. Antibody-producing cells may be exemplified by spleen cells, lymph node cells, peripheral blood cells and so on, with spleen cells or lymph node cells being preferred.
(ii) Cell Fusion
[0106] To obtain hybridomas, cell fusion is conducted between antibody-producing cells and myeloma cells. Operations for cell fusion may be accomplished in a known manner, for example, according to the method of Kohler et al. As myeloma cells to be fused with antibody-producing cells, it is possible to use generally available established cell lines of mouse or other animal origin. Cell lines preferred for use are those having drug selectivity and having the property of not surviving in HAT selective medium (i.e., a medium containing hypoxanthine, aminopterin and thymidine) in an unfused state, but surviving only when fused with antibody-producing cells. Examples of myeloma cells include mouse myeloma cell lines (e.g., P3X63-Ag8, P3X63-Ag8U.1, SP2/O-Ag14, PAI, P3U1, NSI/1-Ag4-1, NSO/1) and rat myeloma cell lines (e.g., YB2/0), etc.
[0107] Cell fusion between the above myeloma cells and antibody-producing cells may be accomplished as follows: in a serum-free medium for animal cell culture (e.g., DMEM or RPMI-1640 medium), 1×10.sup.8 to 5×10.sup.8 antibody-producing cells may be mixed with 2×10.sup.7 to 10×10.sup.7 myeloma cells (the ratio of antibody-producing cells to myeloma cells is 10:1 to 1:1) to cause fusion reaction in the presence of a cell fusion promoter. As a cell fusion promoter, it is possible to use polyethylene glycol having an average molecular weight of 1000 to 6000 daltons or Sendai virus, etc. Alternatively, a commercially available cell fusion apparatus using electrical stimulation (e.g., electroporation) may also be used to cause cell fusion between antibody-producing cells and myeloma cells.
(iii) Screening and Cloning of Hybridomas
[0108] After cell fusion, the cells are screened to select desired hybridomas. For screening, a cell suspension may be diluted as appropriate with, e.g., RPMI-1640 medium containing 10% to 20% fetal bovine serum and then seeded by limiting dilution in microtiter plates at a density of about 0.3 cells/well by calculation, and a selective medium (e.g., HAT medium) may be added to each well, followed by culture while replacing the selective medium as appropriate. As a result, cells growing at around 10 days after the initiation of culture in the selective medium may be obtained as hybridomas.
[0109] Subsequently, the growing hybridomas are further screened. Screening of these hybridomas is not limited in any way and may be conducted in accordance with commonly used procedures. For example, aliquots of the culture supernatants contained in the wells where hybridomas have been cultured may be sampled and screened by enzyme immunoassay, radioimmunoassay, etc. More specifically, an antigen is adsorbed to 96-well plates, and the plates are then blocked with calf serum, skimmed milk, etc. The culture supernatants of hybridoma cells are reacted with the immobilized antigen at 37° C. for 1 hour and then reacted with peroxidase labeled anti-mouse IgG at 37° C. for 1 hour, followed by color development using orthophenylenediamine as a substrate. After the reaction is stopped with an acid, the plates are measured for absorbance at a wavelength of 490 nm for screening purposes.
[0110] Monoclonal antibody-producing hybridomas found to be positive when measured in the above manner are cloned by limiting dilution or other techniques to thereby finally establish hybridomas which are cells producing monoclonal antibodies specifically binding to MCT5.
[0111] Cell lines (hybridomas) producing the monoclonal antibodies of the present invention may be exemplified by “Mouse-Mouse hybridoma IMI4C4a” (hereinafter referred to as “IMI4C4a”) and “Mouse-Mouse hybridoma IMI4C12a” (hereinafter referred to as “IMI4C12a”). Upon culture of these hybridomas, homogeneous monoclonal antibodies can be prepared.
(iv) Collection of Monoclonal Antibodies
[0112] For collection of monoclonal antibodies from the establish hybridomas, commonly used procedures, e.g., cell culture-based procedures or ascites formation procedures may be used for this purpose. In cell culture-based procedures, hybridomas are cultured in an animal cell culture medium (e.g., 10% fetal bovine serum-containing RPMI-1640 medium, MEM medium or serum-free medium) under standard culture conditions (e.g., 37° C., 5% CO.sub.2 concentration) for 7 to 14 days, and antibodies are obtained from their culture supernatants. In the case of ascites formation procedures, hybridomas are intraperitoneally administered at about 5×10.sup.6 to 2×10.sup.7 cells to animals of the same species as the mammal from which myeloma cells are derived, e.g., mice (BALB/c), whereby the hybridomas are allowed to grow in abundance. Then, their ascites are collected after 1 to 2 weeks. In cases where antibodies are required to be purified in the above antibody collection procedures, known techniques such as salting out with ammonium sulfate, ion exchange chromatography, gel filtration, affinity chromatography and so on may be selected as appropriate or used in combination for purification purposes.
[0113] A preferred example of the anti-MCT5 antibody of the present invention is an antibody in which the amino acid sequences of complementarity determining regions (CDRs) 1 to 3 in the heavy chain variable region (VH) comprise or consist of the amino acid sequences shown in SEQ ID NOs: 18, 19 and 20, respectively, and/or the amino acid sequences of complementarity determining regions (CDRs) 1 to 3 in the light chain variable region (VL) comprise or consist of the amino acid sequences shown in SEQ ID NOs: 26, 27 and 28, respectively. In another embodiment, a preferred example of the anti-MCT5 antibody of the present invention is an antibody in which the amino acid sequence of the heavy chain variable region (VH) comprises or consists of the amino acid sequence shown in SEQ ID NO: 17 (which is encoded by the nucleotide sequence shown in SEQ ID NO: 16), and/or the amino acid sequence of the light chain variable region (VL) comprises or consists of the amino acid sequence shown in SEQ ID NO: 25 (which is encoded by the nucleotide sequence shown in SEQ ID NO: 24).
TABLE-US-00005 H chain V region sequence DNA sequence (SEQ ID NO: 16) ATGAAATGCAGCTGGGTCATCTTCTTCCTGATGGCAGTGGTTACAGGGGT CAATTCAGAGGTTCAGCTGCAGCAGTCTGGGGCTGAGCTTGTGAGGCCAG GGGCCTTAGTCAAGTTGTCCTGCAAAGCTTCTGGCTTCAACATTAAAGAC TACTATATGTTCTGGGTGAAGCAGAGGCCTGAACAGGGCCTGGAGTGGAT TGGATGGATTGATCCTGAGAATGGTAATACTATATTTGACCCGAAGTTCC AGGGCAAGGCCAGTATAACAGCAGACACATCCTCCAACACAGCCTACCTG CAGCTCAGCAGCCTGACATCTGAGGACACTGCCGTCTATTACTGTGCTAG AATGATTACGACCTATTACTATGCTATGGACTTCTGGGGTCAAGGAACCT CAGTCACCGTCTCCTCAGCC Amino acid sequence (SEQ ID NO: 17) MKCSWVIFFLMAVVTGVNSEVQLQQSGAELVRPGALVKLSCKASGFNIKD YYMFWVKQRPEQGLEWIGWIDPENGNTIFDPKFQGKASITADTSSNTAYL QLSSLTSEDTAVYYCARMITTYYYAMDFWGQGTSVTVSSA H chain CDR regions VH-CDR1: (SEQ ID NO: 18) FNIKDYYMF (46-54) VH-CDR2: (SEQ ID NO: 19) WIDPENGNTIFDPKFQGK (69-86) VH-CDR3: (SEQ ID NO: 20) MITTYYYAMDFW (118-129) H chain CDR regions VH-CDR1: (SEQ ID NO: 18) FNIKDYYMF (46-54) VH-CDR2: (SEQ ID NO: 19) WIDPENGNTIFDPKFQGK (69-86) VH-CDR3: (SEQ ID NO: 20) MITTYYYAMDFW (118-129) L chain V region sequence DNA sequence (SEQ ID NO: 24) ATGGCCTGGACTCCTCTCTTCTTCTTCTTTGTTCTTCATTGCTCAGGTTC TTTCTCCCAACTTGTGCTCACTCAGTCATCTTCAGCCTCTTTCTCCCTGG GAGCCTCAGCAAAACTCACGTGCACCTTGAGTAGTCAGCACAGTACGTAC ACCATTGAATGGTATCAGCAACAGCCACTCAAGCCTCCTAAGTATGTGAT GGAGCTTAAGAAAGATGGAAGCCACAGCACAGGTGATGGGATTCCTGATC GCTTCTCTGGATCCAGCTCTGGTGCTGATCGCTACCTTAGCGTTTCCAGC ATCCAGCCTGAAGATGAAGCAATATACATCTGTGGTGTGGGTTATACAAT TAAGGAACAATTTGTGTATGTTTTCGGCGGTGGAACCAAG Amino acid sequence (SEQ ID NO: 25) MAWTPLFFFFVLHCSGSFSQLVLTQSSSASFSLGASAKLTCTLSSQHSTY TIEWYQQQPLKPPKYVMELKKDGSHSTGDGIPDRFSGSSSGADRYLSVSS IQPEDEAIYICGVGYTIKEQFVYVFGGGTK L chain CDR regions VL-CDR1: (SEQ ID NO: 26) SQHSTYT (45-51) VL-CDR2: (SEQ ID NO: 27) ELKKDGSHST (68-77) VL-CDR3: (SEQ ID NO: 28) GYTIKEQ (114-120)
(v) Epitope for Anti-MCT5 Antibody
[0114] The epitope (antigenic determinant) for the anti-MCT5 antibody of the present invention is not limited in any way as long as it is at least a part of the antigen MCT5, but it is preferably at least a part of the extracellular region of MCT5, for example, at least a part of a region consisting of amino acids at positions 196 to 299 (SEQ ID NO: 7) in the amino acid sequence of MCT5 shown in SEQ ID NO: 2. Above all, preferred is at least a part of a region consisting of amino acids at positions 227 to 258 (SEQ ID NO: 14), and particularly preferred is at least a part of a region consisting of amino acids at positions 251 to 258 (SEQ ID NO: 13). The anti-MCT5 antibody recognizing such a region (binding to such a region) is, for example, very useful for use in detection and diagnosis of cancer as described later because of ensuring high detection sensitivity for MCT5 in biological samples.
[0115] Moreover, as described above, MCT5 has four deletion mutants. More specifically, human MCT5 has deletion mutants such as a peptide (SEQ ID NO: 44) lacking amino acids at positions 74 to 121, a peptide (SEQ ID NO: 45) lacking N-terminal 62 amino acids and having different amino acids at positions 63 to 73 from those of the wild type (SEQ ID NO: 2), a peptide (SEQ ID NO: 46) lacking N-terminal 110 amino acids and having different amino acids at positions 111 to 120 from those of the wild type (SEQ ID NO: 2), a peptide (SEQ ID NO: 47) lacking N-terminal 110 amino acids and having different amino acids at position 446 to the C-terminal end from those of the wild type (SEQ ID NO: 2), a peptide lacking amino acids at positions 179 to 346 and having leucine as an amino acid at position 177 in place of alanine in the wild type, etc.
[0116] Among these peptides, except for the peptide lacking amino acids at positions 179 to 346 and having leucine as an amino acid at position 177 in place of alanine in the wild type, the remaining three peptides are identical with wild-type MCT5 in a region consisting of amino acids at positions 196 to 299 in the amino acid sequence of MCT5 shown in SEQ ID NO: 2. Thus, the antibody of the present invention allows detection of these deletion mutants.
[0117] Moreover, the epitope (antigenic determinant) for the anti-MCT5 antibody of the present invention also includes at least a part of the corresponding region in MCT5 of other animal origin.
[0118] The antibody against MCT5 of the present invention includes an antibody binding to a site (e.g., epitope) to which the antibody binds, as exemplified by an antibody binding to a site to which an antibody produced by the hybridoma of the present invention binds.
(4) Preparation of Genetically Recombinant Antibodies
[0119] A preferred embodiment of the antibody of the present invention may be a genetically recombinant antibody. Examples of a genetically recombinant antibody include, but are not limited to, a chimeric antibody, a humanized antibody and a reconstituted human antibody, etc.
[0120] A chimeric antibody (i.e., a humanized chimeric antibody) is an antibody in which antibody variable regions of mouse origin are linked (conjugated) to constant regions of human origin (see, e.g., Proc. Natl. Acad. Sci. U.S.A. 81, 6851-6855 (1984)). For preparation of a chimeric antibody, gene recombination technology may be used for its construction such that the thus linked antibody is obtained.
[0121] In this regard, the antibody variable regions of mouse origin are preferably composed of a heavy chain variable region which comprises or consists of, for example, the amino acid sequence shown in SEQ ID NO: 17 and a light chain variable region which comprises or consists of, for example, the amino acid sequence shown in SEQ ID NO: 25.
[0122] For preparation of a humanized antibody, it is possible to use a process referred to as so-called CDR grafting (CDR transplantation). CDR grafting is a technique to prepare reconstituted variable regions whose framework regions (FRs) are of human origin and whose CDRs are of mouse origin by transplanting complementarity determining regions (CDRs) from mouse antibody variable regions to human variable regions. Next, these humanized reconstituted human variable regions are linked to human constant regions. Procedures for preparation of such a humanized antibody are well known in the art (see, e.g., Nature, 321, 522-525 (1986); J. Mol. Biol., 196, 901-917 (1987); Queen C et al., Proc. Natl. Acad. Sci. USA, 86: 10029-10033 (1989); Japanese Patent No. 2828340). In this regard, the amino acid sequences of CDRs of mouse origin which can be used for the humanized anti-MCT5 antibody of the present invention are preferably, but not limited to, the amino acid sequences shown in SEQ ID NOs: 18, 19 and 20 for heavy chain variable region CDRs 1 to 3, respectively, and the amino acid sequences shown in SEQ ID NOs: 26, 27 and 28 for light chain variable region CDRs 1 to 3, respectively, by way of example.
[0123] A reconstituted human antibody (complete human antibody) is generally an antibody in which hyper variable regions serving as antigen-binding sites in its variable regions (V regions), the other regions in its V regions and its constant regions have the same structures as those of human antibody. Techniques for reconstituted human antibody preparation are also known, and in the case of gene sequences common to humans, an approach has been established for their preparation by genetic engineering procedures. Such a reconstituted human antibody may be obtained, for example, by using human antibody-producing mice which have human chromosome fragments comprising genes for human antibody heavy chain (H chain) and light chain (L chain) (see, e.g., Tomizuka, K. et al., Nature Genetics, (1977) 16, 133-143; Kuroiwa, Y. et al., Nuc. Acids Res., (1998) 26, 3447-3448; Yoshida, H. et al., Animal Cell Technology: Basic and Applied Aspects, (1999) 10, 69-73 (Kitagawa, Y., Matuda, T. and Iijima, S. eds.), Kluwer Academic Publishers; Tomizuka, K. et al., Proc. Natl. Acad. Sci. USA, (2000) 97, 722-727) or by obtaining a phage display-derived human antibody selected from human antibody libraries (see, e.g., Wormstone, I. M. et al, Investigative Ophthalmology & Visual Science., (2002) 43 (7), 2301-8; Carmen, S. et al., Briefings in Functional Genomics and Proteomics, (2002) 1 (2), 189-203; Siriwardena, D. et al., Opthalmology, (2002) 109 (3), 427-431).
[0124] Alternatively, in the present invention, a hybridoma or DNA or RNA extracted from this hybridoma may be used as a starting material to prepare a chimeric antibody, a humanized antibody or a reconstituted human antibody in accordance with the well-known approaches mentioned above.
[0125] Further, a protein fused with the antibody of the present invention may be prepared from the antibody variable regions and any other protein by known gene recombination techniques. Alternatively, such a fusion protein may be prepared by crosslinking the monoclonal antibody with any other protein using a crosslinker.
(5) Preparation of Antibody Fragments
[0126] A fragment of the antibody against MCT5 for use in the present invention specifically binds to MCT5.
[0127] A fragment of the antibody is intended to mean a partial region of the antibody of the present invention, and examples include Fab, Fab′, F(ab′).sub.2, Fv, diabody (dibodies), dsFv, scFv (single chain Fv) and so on. The above antibody fragments may be obtained by cleaving the antibody of the present invention with various proteases depending on the intended purpose.
[0128] For example, Fab may be obtained by treating an antibody molecule with papain, while F(ab′).sub.2 may be obtained by treating an antibody molecule with pepsin. Likewise, Fab′ may be obtained by cleaving the disulfide bonds in the hinge region of the above F(ab′).sub.2.
[0129] In the case of scFv, cDNAs encoding antibody heavy chain variable region (H chain V region) and light chain variable region (L chain V region) may be obtained to construct DNA encoding scFv. This DNA may be inserted into an expression vector, and the resulting expression vector may be introduced into a host organism to cause expression, whereby scFv may be prepared.
[0130] In the case of diabody, cDNAs encoding antibody H chain V region and L chain V region may be obtained to construct DNA encoding scFv such that the amino acid sequence of a peptide linker has a length of 8 residues or less. This DNA may be inserted into an expression vector, and the resulting expression vector may be introduced into a host organism to cause expression, whereby diabody may be prepared.
[0131] In the case of dsFv, cDNAs encoding antibody H chain V region and L chain V region may be obtained to construct DNA encoding dsFv. This DNA may be inserted into an expression vector, and the resulting expression vector may be introduced into a host organism to cause expression, whereby dsFv may be prepared.
[0132] In the present invention, the nucleotide sequence of DNA encoding the heavy chain variable region may be exemplified by those comprising or consisting of the nucleotide sequence shown in SEQ ID NO: 16, while the nucleotide sequence of DNA encoding the light chain variable region may be exemplified by those comprising or consisting of the nucleotide sequence shown in SEQ ID NO: 24.
[0133] Moreover, specific examples of the antibody fragment of the present invention include, but are not limited to, antibody fragments comprising the amino acid sequences shown in SEQ ID NOs: 18, 19 and 20 for the amino acid sequences of VH CDRs 1 to 3, respectively, and/or comprising the amino acid sequences shown in SEQ ID NOs: 26, 27 and 28 for the amino acid sequences of VL CDRs 1 to 3, respectively. Further examples include antibody fragments comprising the amino acid sequence shown in SEQ ID NO: 17 for VH, and/or comprising the amino acid sequence shown in SEQ ID NO: 25 for VL.
[0134] A CDR-containing antibody fragment (peptide) is configured to comprise at least one or more regions of VH or VL CDRs (CDRs 1 to 3). In the case of an antibody fragment containing a plurality of CDRs, these CDRs may be linked directly or via an appropriate peptide linker. For preparation of a CDR-containing antibody fragment, DNA encoding antibody VH and VL CDRs may be constructed, and this DNA may be inserted into an expression vector for prokaryotic organisms or an expression vector for eukaryotic organisms, and the resulting expression vector may be introduced into a prokaryotic organism or a eukaryotic organism to cause expression. Alternatively, a CDR-containing peptide may also be prepared by chemical synthesis such as Fmoc method (fluorenylmethyloxycarbonyl method) and tBoc method (t-butyloxycarbonyl method).
[0135] The nucleotide sequences encoding VH CDRs 1 to 3 are preferably the nucleotide sequences shown in SEQ ID NOs: 21, 22 and 23, respectively, by way of example, while the nucleotide sequences encoding VL CDRs 1 to 3 are preferably the nucleotide sequences shown in SEQ ID NOs: 29, 30 and 31, respectively, by way of example.
TABLE-US-00006 VH-CDR1 nucleotide sequence (SEQ ID NO: 21) TTCAACATTAAAGACTACTATATGTTC VH-CDR2 nucleotide sequence (SEQ ID NO: 22) TGGATTGATCCTGAGAATGGTAATACTATATTTGACCCGAAGTTCCAGGG CAAG VH-CDR3 nucleotide sequence (SEQ ID NO: 23) ATGATTACGACCTATTACTATGCTATGGACTTCTGG VL-CDR1 nucleotide sequence (SEQ ID NO: 29) AGTCAGCACAGTACGTACACC VL-CDR2 nucleotide sequence (SEQ ID NO: 30) GAGCTTAAGAAAGATGGAAGCCACAGCACA VL-CDR3 nucleotide sequence (SEQ ID NO: 31) GGTTATACAATTAAGGAACAA
(6) Binding Affinity
[0136] The binding affinity can be determined from the binding constant (KA) and the dissociation constant (KID). The affinity equilibrium constant (K) is expressed as the KA/KD ratio. The binding affinity may be detected in the following manner.
[0137] The antibody of the present invention has a dissociation constant (KD) of at least 1×10.sup.−10 M and has an affinity which is, for example, 2- to 5-fold, 5- to 10-fold, 10- to 100-fold, 100- to 1000-fold or 1000- to 10,000-fold higher than this dissociation constant. More specifically, the dissociation constant (KD) of the antibody of the present invention in relation to MCT5 binding affinity is 1×10.sup.−10 M, 5×10.sup.−11 M, 1×10.sup.−11 M, 5×10.sup.−12 M, 1×10.sup.−12 M, 5×10.sup.−13 M, 1×10.sup.−13 M, 5×10.sup.−14 M, 1×10.sup.−14 M, 5×10.sup.−15 M or 1×10.sup.−15 M, and is preferably 1×10.sup.−10 M to 1×10.sup.−13 M. Alternatively, the antibody of the present invention may have a value lower than these KD values and a higher affinity.
[0138] In this regard, if the dissociation constant (KD) of an antibody to be measured for its affinity is within about 1- to 100-fold of the KD of the antibody of the present invention, this antibody is regarded as being substantially the same as the antibody of the present invention and therefore falls within the present invention.
[0139] The binding constant (KA) and the dissociation constant (KD) may be measured by surface plasmon resonance (SPR), and any known instrument and method which allow real-time detection and monitoring of the binding rate may be used for this purpose (e.g., Biacore® T200 (GE Healthcare), ProteON XPR36 (Bio-Rad)).
3. Reagent for Detection or Diagnosis of Cancer (Agent for Detection or Diagnosis of Cancer)
[0140] The reagent for detection or diagnosis of cancer according to the present invention comprises the antibody or fragment thereof described above in the section “2. Antibody against MCT5 (anti-MCT5 antibody).” Since the antibody of the present invention is capable of specifically binding to MCT5 expressed in cancer, the reagent of the present invention comprising this antibody can be used for detection or diagnosis of cancer.
[0141] Examples of cancer to be detected or diagnosed in the present invention include breast cancer, colorectal cancer, lung cancer, ovarian cancer, uterine cancer, uterine cervical cancer, esophageal cancer, thyroid cancer, skin cancer, gastric cancer, pancreatic cancer, brain tumor, cervical cancer, tongue cancer, small intestinal cancer, duodenal cancer, bladder cancer, kidney cancer, liver cancer, prostate cancer, gallbladder cancer, pharyngeal cancer, sarcoma, melanoma, leukemia, lymphoma, multiple myeloma and so on, each having invasive capacity. Preferred are cancers in which MCT5 is significantly highly expressed when compared to normal cells or tissues. Examples of such cancers include breast cancer, colorectal cancer, lung cancer, ovarian cancer, uterine cancer, uterine cervical cancer, esophageal cancer, thyroid cancer, skin cancer and so on, with breast cancer, colorectal cancer and lung cancer being preferred. The expression “having invasive capacity” is intended to mean the property of cancer cells to actively grow in tumor tissues and also spread to surrounding tissues or organs. To spread to surrounding tissues or organs, cancer cells are required to migrate while degrading the extracellular matrix (basement membrane) present in the space between tissues or organs, and cancer cells having such a property can be regarded as cancer having invasive capacity. This property may be evaluated, for example, as the ability to pass through Matrigel which mimics the extracellular matrix, and may be readily analyzed by measurement using a Matrigel invasion chamber, etc.
[0142] The reagent of the present invention may further comprise a pharmaceutically acceptable carrier, in addition to the antibody of the present invention. The term “pharmaceutically acceptable carrier” refers to any type of carrier (e.g., liposomes, lipid vesicles, micelles), diluent, excipient, wetting agent, buffering agent, suspending agent, lubricant, adjuvant, emulsifier, disintegrant, absorbent, preservative, surfactant, coloring agent, flavoring agent or the like, which is suitable for the reagent of the present invention.
[0143] In another embodiment, the present invention provides the use of a monoclonal antibody against MCT5 or a fragment thereof for the manufacture of a reagent for detection or diagnosis of cancer. Moreover, the present invention also provides a monoclonal antibody against MCT5 or a fragment thereof for use in the detection or diagnosis of cancer. Further, the present invention provides a monoclonal antibody against MCT5 or a fragment thereof for use as a reagent for detection or diagnosis of cancer. Such a monoclonal antibody against MCT5 or a fragment thereof is as described above in the section “2. Antibody against MCT5 (anti-MCT5 antibody).”
4. Method for Detection or Diagnosis of Cancer
[0144] The method for detection or diagnosis of cancer according to the present invention comprises the step of contacting the antibody or fragment thereof described above in the section “2. Antibody against MCT5 (anti-MCT5 antibody)” with a biological sample taken from a subject (hereinafter also simply referred to as a “biological sample”) to thereby detect MCT5 in the sample. In this case, it is preferred that the detection results of MCT5 are connected with the possibility of cancer.
[0145] In the context of the present invention, the term “subject” is intended to include, for example, humans, rabbits, guinea pigs, rats, mice, hamsters, cats, dogs, goats, pigs, sheep, cows, horses, monkeys and other mammals, with humans being preferred.
[0146] Likewise, the biological sample is not limited in any way and refers to, for example, mammalian tissue or cells, a homogenate or extract thereof, body fluid or excrement per se or a sample containing any of them. Moreover, the biological sample also includes samples obtained from mammalian tissue or cells, a homogenate or extract thereof, body fluid and excrement through any type of treatment, e.g., dilution, separation, nucleic acid or protein extraction, protein denaturation, etc. A biological sample preferred for screening of colorectal cancer or gastric cancer is body fluid or excrement, particularly feces. For screening of bladder cancer or kidney cancer, it is possible to use tissue or urine. Likewise, for screening of breast cancer or uterine cancer, it is possible to use mother's milk, sanitary goods or the like. Any biological samples may be applied by being pretreated appropriately.
[0147] When feces is used as a sample, the sample is preferably prepared by the method described in JP 2005-46065 A. This method is designed to efficiently collect cancer cells from feces. More specifically, feces and a buffer are introduced into a stomacher bag to prepare a suspension of feces. This suspension is filtered through a multi-filter apparatus to capture cells on the final filter whose bore size is set to 10 μm or less, from which the cells are then collected using BeEP4 antibody-bound magnetic beads (Dynabeads Epithelial Enrich, Dynal Biotech). In addition to this, efficient cell collection techniques (e.g., Percoll centrifugation) commonly used by those skilled in the art may be used for this purpose.
[0148] In various cancers including colorectal cancer and breast cancer, any tumor marker has not yet been established which allows early detection using body fluid. Commonly used markers may show false negative results even in advanced stages of cancer. In contrast, when using the antibody of the present invention, a trace amount of cells, which express MCT5 serving as a marker, contained in body fluid or excrement can be detected and/or measured before cancer has progressed.
[0149] If the “subject” is a human, the subject includes cancer patients (e.g., early cancer patients, advanced cancer patients) and normal subjects. For example, in the case of colorectal cancer, gastric cancer or the like, early cancer refers to a state where cancer cells remain in the mucosa or submucosa, while advanced cancer refers to a state where cancer cells have reached the muscularis propria or deeper layers. Based on these criteria, patients may be categorized and provided for the detection of the present invention. Moreover, as a blood sample, preferred is peripheral blood and more preferred is peripheral blood-derived serum. Further, tissues include cancer tissues and normal tissues which may develop cancer.
[0150] In the context of the present invention, the term “contact” is intended to mean that the antibody of the present invention and a biological sample taken from a subject are allowed to exist in the same reaction system, as exemplified by mixing the antibody of the present invention and the biological sample in a reaction well, adding the antibody of the present invention to the biological sample, adding either the antibody of the present invention or the biological sample to a carrier on which the other is immobilized, etc.
[0151] In the present invention, for MCT5 detection or for measurement or evaluation of MCT5 expression levels, it is possible to use, for example, enzyme immunoassay (EIA), fluorescence immunoassay (FIA), radioimmunoassay (RIA), chemiluminescence immunoassay (CIA), turbidimetric immunoassay, immunonephelometry, latex agglutination, latex turbidimetry, hemagglutination reaction, particle agglutination reaction, Western blotting, immunostaining, immunoprecipitation, immunochromatography and so on.
[0152] Any device may be used for such detection and other purposes, and examples include a micro-well plate, an array, a chip, a flow cytometer, a surface plasmon resonance apparatus, an immunochromatographic strip and so on. In the case of using such a device, signals (e.g., color development, fluorescence intensity, luminescence intensity) can be detected, measured and/or evaluated, and the results of detection, measurement or evaluation can be connected with the possibility of cancer, etc.
[0153] In the present invention, based on the results of MCT5 detection or on the results of measurement or evaluation of MCT5 expression levels, a subject can be diagnosed for the presence or absence of the possibility of suffering from cancer.
[0154] In cases where the detection or diagnostic method of the present invention is accomplished by enzyme immunoassay or fluorescence immunoassay, an appropriately pretreated sample as described above (e.g., cells including cancer cells collected from feces or sections prepared from tissue taken from a patient) may be immobilized on a solid phase (e.g., micro-well plates or slide glasses) and provided for immunological reaction. Alternatively, a cell suspension may be reacted with the antibody in a tube. Moreover, it is also possible to use procedures in which the monoclonal antibody of the present invention is immobilized on beads or micro-well plates and then reacted with cells.
[0155] In this case, the monoclonal antibody of the present invention may be labeled with an enzyme or a fluorescent substance to thereby directly detect the reaction as fluorescence signals, or alternatively, a labeled secondary antibody which binds to the monoclonal antibody of the present invention may be used to indirectly detect signals. As a labelling substance, any substance commonly used by those skilled in the art may be used, as exemplified by peroxidase (POD), alkaline phosphatase, β-galactosidase, a biotin-avidin complex, etc. Likewise, the detection method used for this purpose may be any of competitive assay, sandwich assay or direct adsorption assay, etc. Moreover, the strength of the reaction or the ratio of cells bound to the antibody among all cells in the reacted sample may be measured and compared with the predetermined reference value or index to thereby determine or diagnose the possibility of suffering from cancer.
[0156] In the present invention, when MCT5 detection or measurement or evaluation of MCT5 expression levels is accomplished by using immunostaining, for example, the degree of staining in immunohistological staining (i.e., the detection results of MCT5) may be ranked as strongly positive (Strong), positive (Moderate), weakly positive (Weak), negative (Negative), etc., and the degree of staining is connected with the possibility of cancer to thereby detect cancer or diagnose a subject for the presence or absence of the possibility of cancer.
[0157] Moreover, under the assumption that the extracellular region of MCT5 is released into blood, the expression level of MCT5 in a blood sample may be measured to thereby detect cancer or diagnose a subject for the presence or absence of the possibility of cancer. In this case, for detection of cancer by connecting the results measured for the expression level of MCT5 with the possibility of cancer, it is desired to define a critical value (cut-off value) for the expression level of MCT5 in a biological sample.
[0158] The cut-off value for the expression level of MCT5 may be determined as follows, by way of example. First, biological samples derived from cancer patients are measured for their expression levels of MCT5. The number of patients intended here is two or more, for example, 5 or more, 10 or more, 50 or more, or 100 or more. Preferably, biological samples derived from two or more normal subjects have also been measured for their expression levels of MCT5, and the number of normal subjects intended here is two or more, for example, 5 or more, 10 or more, 50 or more, or 100 or more. Then, from all the cases including both the group of biological samples derived from cancer patients and the group of biological samples derived from normal subjects, the cut-off value for the expression level of MCT5 is determined by statistical processing. For statistical processing, 4-parameter logistic fitting may be used to prepare a standard curve. On the basis of the signal value in a MCT5-free sample, the double of this numerical value may be defined to be the cut-off value. Cases provided for statistical analysis may also be classified by the type of cancer (e.g., colorectal cancer, breast cancer, uterine cancer, gastric cancer, thyroid cancer, pancreatic cancer, leukemia), the stage of cancer, the presence or absence of recurrence, the presence or absence of metastasis, before or after surgery, etc. Furthermore, statistical processing may also be accomplished by combining, as appropriate, the measured values of MCT5 expression levels in normal subjects and the measured values of MCT5 expression levels in cancer patients when classified by the type of cancer, the stage of cancer, the presence or absence of recurrence, the presence or absence of metastasis, before or after surgery, etc.
[0159] In the present invention, the critical value (cut-off value) for the expression levels of MCT5 (extracellular region) in blood samples is, for example, about 10 ng/ml, 11 ng/ml, 12 ng/ml, 13 ng/ml, 14 ng/ml, 15 ng/ml, 16 ng/ml, 17 ng/ml, 18 ng/ml, 19 ng/ml, 20 ng/ml, 21 ng/ml, 22 ng/ml, 23 ng/ml, 24 ng/ml, 25 ng/ml, 26 ng/ml, 27 ng/ml, 28 ng/ml, 29 ng/ml, 30 ng/ml, 35 ng/ml, 40 ng/ml, 45 ng/ml, 50 ng/ml, 55 ng/ml, 60 ng/ml or 65 ng/ml when expressed as a concentration in serum, with about 20 ng/ml being preferred.
[0160] When a sample is measured for its expression level of MCT5 under the above conditions, if the measured expression level of MCT5 is equal to or higher than the above cut-off value, it is possible to make a determination that cancer was detected or to make a diagnosis that the subject has the possibility of suffering from cancer. In the present invention, an upper limit may be provided for the value of serum concentration required for the above determination or diagnosis. For example, if the measured value is equal to or higher than the above cut-off value and is equal to or lower than the given upper limit value (e.g., 200 ng/ml or less, 190 ng/ml or less, 180 ng/ml or less, 170 ng/ml or less, 160 ng/ml or less, 150 ng/ml or less, 145 ng/ml or less, 140 ng/ml or less, 135 ng/ml or less, 130 ng/ml or less), it is possible to detect cancer or diagnose a subject for the presence or absence of the possibility of cancer.
[0161] In the present invention, the probability of the detection results obtained when cancer was detected is 60% or more, 70% or more, 80% or more, 90% or more, or 95% or more, and preferably 99% or more.
[0162] Further, in addition to the embodiment where the expression level of MCT5 measured in a sample from a single subject (patient) is compared with the above cut-off value to detect or diagnose the relation to cancer, biological samples derived from a plurality of patients may be used and measured for their expression levels of MCT5 in another embodiment of the present invention. Thus, in the same manner as used to determine the above cut-off value, in a population (primary population) including a given number of normal subjects and patients, their expression levels of MCT5 may be measured and processed by statistical analysis, whereby these subjects belonging to the population may be divided into a group where cancer was detected and a group where cancer was not detected. Further, the thus obtained measured values are used as master data, and a comparison may be made between these master data and the expression levels of MCT5 in samples derived from individual subjects to be detected or diagnosed in another population (secondary population).
[0163] Alternatively, the data of the respective patients may be incorporated into the values of the above population and subjected again to data processing of MCT5 expression levels to increase the number of cases of target patients (population). The increased number of cases can improve the accuracy of the critical value for the expression level of MCT5 to thereby improve the accuracy of detection or diagnosis in a single subject or a plurality of subjects.
[0164] In the present invention, a comparison may also be made between (i) the expression level of MCT5 in a biological sample from a subject and (ii) the expression level of MCT5 in a biological sample from a normal subject.
[0165] Moreover, if the expression level of MCT5 in (i) above is higher than the expression level of MCT5 in (ii) above, e.g., is about 10% or more, about 20% or more, about 30% or more, about 40% or more, about 50% or more, about 60% or more, about 70% or more, about 80% or more, about 90% or more, or about 100% or more higher than the expression level of MCT5 in a biological sample from a normal subject, it is possible to make a determination that cancer was detected or to make a diagnosis that the subject has the possibility of suffering from cancer.
[0166] The above detection results may be used, for example, as main data or supplemental data in screening of cancer or in definitive diagnosis of therapeutic effects.
[0167] Since MCT5 expression is observed in patients with various types of cancer, it cannot be identified in some cases what type of cancer a subject has even when the expression level of MCT5 is detected during medical examination, etc. For this reason, such a subject is evaluated as being “suspected to have cancer” in group health screening or the like, and this evaluation result may be used later as supplemental data to identify the type of cancer and/or determine the degree of cancer progression (for detailed examination). Moreover, when MCT5 was detected by using a sample derived from a patient who was suspected to have some certain type of cancer, such a result may be used as main data on cancer type (e.g., definitive diagnosis). It should be noted that identification of cancer type may be accomplished by using other tumor markers, diagnostic imaging, pathological diagnosis, etc.
[0168] Namely, the present invention also provides a method for aiding detection or diagnosis of cancer, which comprises the step of contacting a monoclonal antibody against MCT5 or a fragment thereof with a biological sample taken from a subject to thereby detect MCT5 in the sample.
5. Kit for Detection or Diagnosis of Cancer
[0169] The anti-MCT5 antibody of the present invention may be provided in the form of a kit for detection or diagnosis of cancer. The kit of the present invention comprises the antibody and may further comprise a labelling substance, or alternatively, may comprise an immobilized reagent in which the antibody or a labeled product thereof is immobilized. The labeled product of the antibody is intended to mean the antibody labeled with an enzyme, a radioisotope, a fluorescent compound, a chemiluminescent compound or the like. In addition to the above constituent elements, the kit of the present invention may further comprise other reagents required to accomplish the detection of the present invention, as exemplified by an enzyme and a substrate (e.g., a chromogenic substrate), a substrate diluent, an enzyme reaction stop solution, or an analyte diluent and so on when the labeled product is an enzymatically labeled product. Moreover, the kit of the present invention may also comprise various buffers, sterilized water, various cell culture vessels, various reaction vessels (e.g., Eppendorf tubes), a blocking agent (e.g., bovine serum albumin (BSA), skimmed milk, goat serum or other serum components), a detergent, a surfactant, various plates, an antiseptic (e.g., sodium azide), an instruction manual for experimental operations (manufacturer's instructions) and so on. These reagents are provided, e.g., in an immobilized state, in an aqueous solution state or in a lyophilized state, and may be reconstituted into an appropriate state before use.
[0170] The kit of the present invention can be used effectively to accomplish the above detection method of the present invention and is extremely useful. The use of the kit of the present invention allows highly accurate screening of cancer patients during medical examination or the like, early diagnosis of cancer, determination of the degree of cancer progression, monitoring of therapeutic effects during treatment, and acquisition of information useful to predict metastasis and/or recurrence, so that the mortality due to cancer can be reduced.
[0171] Details on the anti-MCT5 antibody, the type of cancer, the detection method and so on are the same as described above.
EXAMPLES
Example 1
(1) Identification of MCT5
[0172] New membrane proteins specific for cancer cells were identified, and new membrane protein markers were identified in an attempt to prepare antibodies for diagnostic and therapeutic purposes. From among metastatic MCF7-14 cells (BMC Cancer 2010, 10, p. 414) prepared from non-metastatic MCF7 cells, two clones (CL15 and CL6) were selected and analyzed for their expression profile with a DNA microarray, whereby membrane proteins whose gene expression was enhanced two-fold or more in CL15 and CL6 cells as compared to MCF7 cells were narrowed down to 19 candidates. These candidates were further narrowed down with a focus on genes whose expression was enhanced 5-fold or more in both CL15 and CL6 cells and which had been found to be localized in the cell membrane, thereby obtaining three candidates. Among them, MCT5 was selected for analysis.
[0173]
(2) Cells
[0174] MCF7-14 CL6 and CL15 were established from Accession No. FERM BP-10944. MCF7 and MCF7-14 were cultured and subcultured in RPMI 1640 medium (Sigma) containing 10% (v/v) serum (Hyclone) at 37° C. under 5% CO.sub.2 for 48 to 72 hours, such that the confluency did not exceed 80, while other cells were cultured and subcultured in DMEM medium (Sigma) at 37° C. under 5% CO.sub.2 for 48 to 72 hours, such that the confluency did not exceed 80%.
(3) Cloning of MCT5 Gene
[0175] MCF7-14 CL6 was cultured and the total RNA was extracted with a Qiagen RNeasy Mini kit. From the extracted total RNA (2 μg), cDNA was synthesized by reverse transcription (RT) reaction at 50° C. for 1 hour with SuperScript III reverse transcriptase (Invitrogen), followed by heating at 85° C. for 5 minutes to stop the reaction. The resulting cDNA was used as a template for PCR reaction with the following primers.
TABLE-US-00007 Primer sequences (SEQ ID NO: 32) S16A4-F1: 5′-AAAGGTACCATGCTGAAGAGGGAGGGGAAGG-3′ (SEQ ID NO: 33) S16A4-R1: 5′-AAATCTAGAGGTCAGACTGTTTTTCCATCTTTCG-3′
[0176] The PCR reaction was conducted by preincubation at 95° C. for 10 minutes and subsequent 35 cycles of denaturation at 95° C. for 15 seconds and annealing/elongation at 56° C. for 1 minute to thereby amplify the desired gene fragment.
[0177] The resulting amplified fragment was integrated into pEF6-myc/HisA vector (Invitrogen) with restriction enzymes (KpnI and XbaI) located on the primers. The amplified fragment was confirmed by DNA sequencing, and the same gene sequence as found in the database was confirmed to be integrated therein. Hereinafter, this prepared vector is referred to as pEF6-MCT5-myc/HisA.
(4) Confirmation of MCT5 Expression (Real-Time PCR)
[0178] For confirmation of MCT5 gene expression, the amount of mRNA transcription was determined by real-time PCR. In the same manner as shown in (2) above, total RNA was extracted and PCR reaction was conducted with the following primers and THUNDERBIRD SYBR qPCR Mix (TOYOBO) to detect the amount of amplified fragment in a real-time manner by the SYBR Green method. As an internal standard, the human GAPDH gene was also amplified and used for correction. The PCR reaction was conducted by preincubation at 95° C. for 10 seconds and subsequent 40 cycles of denaturation at 95° C. for 5 seconds and annealing/elongation at 60° C. for 40 seconds.
TABLE-US-00008 hSLC16a4 Real-time F1: (SEQ ID NO: 34) 5′-CTGTAGCAGGTATCCTTGAGACG-3′ hSLC16a4 Real-time R1: (SEQ ID NO: 35) 5′-GGATGAGGTAAGACTTGTGGTAATG-3′ hGapdh real-time F: (SEQ ID NO: 36) 5′-TGCACCACCAACTGCTTAGC-3′ hGapdh real-time R: (SEQ ID NO: 37) 5′-GGCATGGACTGTGGTCATGA-3′
[0179] The expression level of the MCT5 gene was compared between MCF7 and MCF7-14 CL6, indicating that the expression was clearly enhanced (
(5) Transient Expression of MCT5
[0180] The plasmid prepared in (1) above was introduced into MCF7 cells using FUGENE6 (Roche Applied Science). Operations were conducted in accordance with the information attached to the kit. After gene transfer, aliquots were sampled at 24, 48, 72 and 96 hours and analyzed for expression levels according to the procedures shown in (3) above. The results obtained are shown in
(6) Matrigel Invasive Capacity Test
[0181] The cells prepared in (5) above, MCF7 cells, and pcDNA3.1-carrying MCF7 cells (Mock) were each suspended in a serum-free medium and then introduced (1×10.sup.5 cells each) into a transwell (the upper side of a filter: upper compartment) in a Matrigel invasion chamber (BD), followed by culture at 37° C. for 3 days. Cells migrating through the membrane (pore size: 8 μm) in the transwell (the lower side of the filter: lower compartment) were stained with a 0.1% crystal violet solution and rinsed with MilliQ to remove the excess dye, and cell counts were then observed. The results obtained are shown in
Example 2
(1) Preparation of Cell Lines Stably Expressing MCT5
[0182] The pEF6-MCT5-mycHisA vector prepared in Example 1 (1) was cleaved with a restriction enzyme (PmeI) to thereby cut off a region downstream of the stop codon for MCT5. On the other hand, pMXs-IG vector (purchased under license from Professor Toshio Kitamura, the University of Tokyo) was cleaved with restriction enzymes (XhoI/SalI) to excise a gene sequence encoding IRES-GFP. This gene fragment was blunt-ended with Klenow fragment (Takara) and ligated to the restriction enzyme-treated pEF6-MCT5-mycHisA vector. Hereinafter, this vector is referred to as pEF6-MCT5-IG.
[0183] The above two vectors (i.e., pEF6-MCT5-IG and pEF6-IG) were provided for gene transfer into MCF7 cells in the same manner as shown in Example 1 (5) and cultured in the same medium as shown in Example 1 (2) supplemented with blasticidin S at 25 μg/mL to establish several lines of cells showing drug resistance. From among them, cells in which EGFP fluorescence was observed under a fluorescence microscope were selected to thereby establish two cell lines MCF7-MCT5-2 and MCF7-MCT5-7 as cells carrying the pEF6-SLC16A4-myc-IG vector and three cell lines MCF7-Mock1, MCF7-Mock2 and MCF7-Mock3 as cells carrying the pEF6-IG vector.
(2) Confirmation of MCT5 Expression (Real-Time PCR)
[0184] MCT5 expression was analyzed in the same manner as shown in Example 1 (4) above. The results obtained are shown in
(3) Matrigel Invasive Capacity Test
[0185] MCF7-MCT5-2 and MCF7-MCT5-7 were analyzed for changes in their invasive capacity in comparison with MCF7. The results obtained are shown in
Example 3
(1) Preparation of Anti-MCT5 Antibodies
(1) Cell Culture
[0186] Mouse myeloma cell line P3X63-Ag8 (ATCC Accession No. CRL-1580), human colorectal cancer cell line HCT-116 (ATCC Accession No. CCL-247) and human fetal kidney 293T cells were each cultured and subcultured in RPMI 1640 medium (Sigma) containing 10% (v/v) serum (Hyclone) at 37° C. under 5% CO.sub.2 for 48 to 72 hours, such that the confluency did not exceed 80%.
(2) Cloning of MCT5 Intracellular Domain 4 (ICD4) Gene
[0187] The plasmid prepared in Example 1 (3) was used as a template for PCR reaction with the following primers and with KOD PLUS (TOYOBO) to thereby amplify DNA comprising a nucleotide sequence (SEQ ID NO: 40) encoding amino acids at positions 196 to 299 of MCT5.
TABLE-US-00009 Primer sequences hSLC16A4 ICD4 F1: (SEQ ID NO: 38) 5′-GCGCGGATCCGAGACCCATCCATATCAAAAGTG-3′ hSLC16A4 ICD4 R1: (SEQ ID NO: 39) 5′-GCGCGCGTCGACAGGATTTCTAAAGAGAGAAATGTC-3′ ICD4 DNA sequence (SEQ ID NO: 40) AGACCCATCCATATCAAAAGTGAGAACAATTCTGGTATTAAAGATAAAGG CAGCAGTTTGTCTGCACATGGTCCAGAGGCACATGCAACAGAAACACACT GCCATGAGACAGAAGAGTCTACCATCAAGGACAGTACTACGCAGAAGGCT GGACTACCTAGCAAAAATTTAACAGTCTCACAAAATCAAAGTGAAGAGTT CTACAATGGGCCTAACAGGAACAGACTGTTATTAAAGAGTGATGAAGAAA GTGATAAGGTTATTTCGTGGAGCTGCAAACAACTGTTTGACATTTCTCTC TTTAGAAATCCT ICD4 amino acid sequence (SEQ ID NO: 7) RPIHIKSENNSGIKDKGSSLSAHGPEAHATETHCHETEESTIKDSTTQKA GLPSKNLTVSQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISL FRNP
[0188] The PCR reaction was conducted by preincubation at 95° C. for 10 minutes and subsequent 40 cycles of denaturation at 95° C. for 15 seconds and annealing/elongation at 58° C. for 1 minute to thereby amplify the desired gene fragment.
[0189] The resulting amplified fragment was cleaved with restriction enzymes (BamHI and SalI) at the restriction enzyme sites located on the primers and then integrated into pET32b vector (Invitrogen) to thereby obtain DNA comprising a nucleotide sequence encoding a partial protein of MCT5 having Trx-, S- and His-tags on the N-terminal side and a His-tag on the C-terminal side.
[0190] E. coli Rosseta gami (DE3) pLysS (Novagen) was transformed with this vector and cultured in LB medium (1% (w/v) tryptone (Sigma), 0.5% (w/v) yeast extract (Sigma), 0.5% (w/v) NaCl (Sigma)) supplemented with 1% (w/v) glucose. After the medium turbidity reached 0.6 at a wavelength of 600 nm, 1 mM IPTG (WAKO) was added and culture was continued for 16 hours. The microbial cells were collected by centrifugation and then homogenized by ultrasonication to obtain a fraction containing the extracellular region of SLC6A6 (the intracellular region of MCT5?) as an insoluble protein.
[0191] About 10 mg of the sample was dissolved in Buffer A (1 M guanidine hydrochloride (Sigma), 10 mM DTT (Sigma), 10 mM EDTA (Sigma)) and reacted at 37° C. for 1 hour. The reaction mixture was added gently to 1 L of Buffer B (50 mM Tris, 150 mM NaCl, 5% glycerol, 0.4 mM oxidized glutathione (Sigma), pH 8.5) and stirred at 4° C. for 18 hours. The dissolved sample was applied to a Ni-sepharose column (GE) and eluted with Buffer C (50 mM potassium phosphate buffer, 150 mM NaCl, 200 mM imidazole, pH 8.0), followed by dialysis against imidazole-free Buffer C to obtain a partial protein of the intracellular region of MCT5 (ICD4) in purified form.
(3) Immunization
[0192] ICD4 prepared above was mixed with an equal amount of Freund's complete adjuvant and intraperitoneally administered to BALB/c mice in a volume of 100 μl (about 40 μg/mouse). After about 3 weeks, ICD4 was also mixed with an equal amount of Freund's incomplete adjuvant and intraperitoneally administered to the mice. This operation was repeated 7 to 12 times, followed by confirmation of an increase in antibody titers. The mice showing increased titers were intravenously administered with ICD4 (about 40 μg) as the final immunization and, after 3 days, their spleens were excised.
(4) Cell Fusion
[0193] Mouse spleen lymphocytes were electrically fused with mouse myeloma cell line P3X63-Ag8. For cell fusion, 1×10.sup.8 spleen cells were mixed with 0.25×10.sup.8 cells of the myeloma cell line and suspended again in EP Buffer (0.3 M mannitol, 0.1 mM CaCl.sub.2, 0.1 mM MgCl.sub.2) at a cell density of 0.25×10.sup.8 cells/mL, followed by cell fusion with an electro cell fusion generator LF201 (Nepa Gene Co., Ltd., Japan). Cell fusion conditions were set in accordance with the manufacturer's recommended protocols.
[0194] The fused cells were suspended in HAT medium (Invitrogen) at 1.6×10.sup.5 cells/mL and dispensed into 96-well plates in a volume of 200 μL per well. During culture, 100 μL of HT medium was added to each well. After culture for 11 to 16 days, the plates were observed under a microscope, indicating that 2 to 12 colonies were formed per well.
(5) ELISA
[0195] Culture supernatants were collected from wells in which hybridomas were growing, and provided for screening to select hybridomas producing monoclonal antibodies reactive to ICD4. ICD4 was diluted with PBS(−) and dispensed into 96-well ELISA plates (Nunc) in an amount of 50 ng per well, and immobilized on the plate surface by being allowed to stand overnight at 4° C. Then, after the plates were washed three times with 350 μL of PBS(−) containing 0.05% Tween 20 (hereinafter abbreviated as PBS-T), PBS-T containing 1% skimmed milk was dispensed in a volume of 300 μL per well, followed by blocking for 1 hour at room temperature. After washing with PBS-T, the culture supernatants of hybridomas were dispensed into the ICD4-immobilized ELISA plates and reacted for 1 hour at room temperature. After washing with PBS-T, a 10000-fold dilution of peroxidase (hereinafter abbreviated as POD)-labeled anti-mouse immunoglobulin antibody (BETHYL) was dispensed in a volume of 100 μL per well and reacted for 1 hour at room temperature. After washing in the same manner, a OPD(POD?) substrate prepared at 0.5 mg/mL POD was added to cause color development at room temperature for 20 minutes. After the reaction was stopped with 1.5 N sulfuric acid, the plates were measured for absorbance at 490 nm with a plate reader (Molecular Devices).
(6) Obtaining of Monoclonal Antibodies
[0196] From among antibodies produced from the hybridoma cells formed in (5) above, antibodies reactive to ICD4 were selected in the same manner as shown in (5) above. Moreover, to remove antibodies reactive to the Trx-, S- and His-tags added during preparation of ICD4, pET32b vector alone was introduced into E. coli and the same procedure as shown in (2) above was repeated to express and purify a protein for use as a negative control. Hereinafter, this protein for use as a negative control is referred to as Tag.
[0197] As a result of selection of hybridoma cells producing monoclonal antibodies which were reactive to ICD4 and not reactive to Tag, 14 clones were obtained. From among them, two clones showing particularly high titers were selected and provided for use in the subsequent experiment. Hereinafter, these clones are referred to as “IMI4C4a” and “IMI4C12a,” respectively. Hereinafter, antibodies produced from hybridoma cells may also be expressed as their clone numbers. As to the antibodies produced from the hybridoma cells “IMI4C4a” and “IMI4C12a,”
[0198] After being cloned singly by limiting dilution, these hybridoma cells were each cultured in ten 10 cm dishes to reach 90% confluency and cultured for 10 days in a 1:1 mixed medium of HT medium (Invitrogen) and EX CELL Sp2/0 (Nichirei Bioscience Inc., Japan). The culture supernatants were collected and purified with a Protein G column. The Protein G column (GE Healthcare) was used in a volume of 3.5 mL relative to 100 mL culture supernatant. The cultured solutions were each passed at a flow rate of 1 to 3 ml/min through the Protein G column which had been equilibrated with PBS, followed by washing with 6 mL of washing buffer (25 mM Tris-HCl (pH 7.4), 140 mM NaCl, 10 mM KCl). Then, antibody proteins were eluted with 6 mL of elution buffer (0.1 M glycine (pH 2.5)) and neutralized with 3 M Tris-HCl (pH 7.4) to be within pH 7.0 to 7.4. The antibodies were concentrated with Amicon Ultra 30 (Millipore) and the buffer was replaced with PBS.
[0199] In addition, the antibodies produced from the hybridoma cells IMI4C4a and IMI4C12a were analyzed for their isotype. For analysis, an Iso Strip mouse monoclonal antibody isotyping kit (Roche) was used. As a result, the IMI4C4a antibody was found to be subclass IgG1λ, while the IMI4C12a antibody was found to be subclass IgG1κ.
Example 4 Reactivity Between Anti-MCT5 Monoclonal Antibodies and MCT
(1) ELISA
[0200] ELISA analysis was performed on the antibody produced from “IMI4C4a” among the two hybridoma cells obtained in Example 3 (6). The same procedure as shown in Example 3 (5) was used and the antibody was diluted to concentrations of 0.125, 0.25, 0.5, 1.0 and 2.0 μg/mL for analysis. The results obtained are shown in
(2) Immunocytological Staining
[0201] IMI4C4a was analyzed for its reactivity to the breast cancer cells (MCF7-Mock1 and MCF7-MCT5-2) shown in Example 2 (1). MCF7-Mock1 and MCF7-MCT5-2 were cultured to reach 80% confluency and then seeded onto cover slips coated with Cellmatrix Type I-A (Nitta Gelatin Inc., Japan). After culture for 2 days, the cells were fixed with 10% neutral buffered formalin (WAKO). After being treated with 0.3% (v/v) aqueous hydrogen peroxide for 20 minutes, the cover slips were washed three times with TBS-T (25 mM Tris, 150 mM NaCl, 0.05% (v/v) Tween 20) and treated with TBS-T containing 5% (w/v) skimmed milk, followed by addition of the antibody purified in Example 3 (6) above at a concentration of 10 μg/mL and reaction at 4° C. for 16 hours. After washing three times with TBS-T, anti-mouse IgG polyclonal antibody-Alexa Fluor 488 label or anti-mouse IgM polyclonal antibody-Alexa Fluor 488 label was reacted as a secondary antibody at room temperature for 30 minutes. After washing three times with TBS-T, the cover slips were sealed with Mounting Medium (Vector Shield).
[0202] In the case of using IMI4C4a, strong signals were observed only in MCF7-MCT5-2, thus suggesting that the cell membrane and cytoplasm were stained. Namely, IMI4C4a was confirmed to bind to MCT5 present on the cell surface and in the cytoplasm. MCT5 is a membrane protein with 12 transmembrane domains and is considered to be present on the cell membrane. In view of this fact, signals observed in the cytoplasm are considered to detect MCT5 molecules in the course of transport during which MCT5 translated in ribosomes is transported via the Golgi apparatus and transport vesicles onto the cell membrane.
(3) Western Blotting
[0203] The antibody produced from the hybridoma cells “IMIC4a” was analyzed by Western blotting. The MCF7-Mock1 and MCF7-MCT5-2 cells prepared in Example 2 (1) were cultured in 10 cm dishes to reach 90% confluency and washed twice with PBS(−). After addition of 2×RIPA Buffer (0.1 M Tris, 0.3 M NaCl, 1% (v/v) Triton X-100, 2% (w/v) sodium deoxycholate, 0.2% (w/v) sodium dodecyl sulfate) in a volume of 200 μL, the cells were allowed to stand on ice for 1 minute and then detached with a scraper to collect a cell suspension. The cells were homogenized for 30 seconds in an ultrasonic homogenizer (Branson) to obtain an extract. Extracts were prepared for the respective cell lines and measured for their protein concentration by the Bradford assay, and then adjusted to the same protein amount and provided for SDS-PAGE.
[0204] After electrophoresis, proteins were transferred onto a PVDF membrane (PIERCE) with a Trans-Blot SD cell (BioRad Laboratories) in accordance with the manufacturer's recommended protocols. The membrane was blocked at room temperature for 30 minutes with skimmed milk dissolved at a concentration of 5% (w/v) in TBS-T, and then washed three times with TBS-T. The antibody produced from the hybridoma cells IMI4C4a was diluted to 1 μg/mL with TBS-T and reacted with the membrane for 1 hour at room temperature. Likewise, as a negative control, an antibody-free medium was reacted in the same manner. After washing three times with TBS-T, anti-mouse IgG polyclonal antibody-HRP label (BETHYL) was diluted 10,000-fold with TBS-T for use as a secondary antibody. The membrane was reacted with this dilution at room temperature for 30 minutes and then washed three times with TBS-T. The membrane was soaked in Immobilon (Millipore) and then wrapped, followed by signal detection with LAS-3000 (Fuji Photo Film Co., Ltd., Japan). The experimental results obtained are shown in
Example 5 Analysis of Clinical Tissue Samples
(1) Immunohistological Staining Using Breast Cancer Tissues
[0205] The rate of MCT5 expression in breast cancer was analyzed by analysis of the reactivity between IMI4C4a and breast cancer tissue. In this example, human cancer tissue array slides (FDA808b; US Biomax) were used for analysis.
[0206] The tissue array slides were deparaffinized by being soaked three times in xylene for 5 minutes. The slides were then soaked twice in 100% ethanol for 5 minutes and further soaked sequentially in 90% ethanol and 80% ethanol for 5 minutes each, and then soaked under running water for 2 minutes to hydrate the samples. The slides were soaked in 10 mM citrate buffer (pH 6.0) and microwaved at 600 W for 5 minutes. This operation was repeated three times in total to activate the antigen. The slides were treated for 10 minutes with 3% aqueous hydrogen peroxide diluted in methanol to thereby deactivate endogenous peroxidase activity. For the subsequent detection, a Histofine (M) kit (Nichirei Corporation, Japan) was used and blocking, secondary antibody reaction, washing and detection reaction were conducted in accordance with the protocols attached to the kit. For primary antibody reaction, IMI4C4a was diluted to 5 μg/mL with TBS-T and reacted at room temperature for 1 hour. For color development, Impact DAB (Vector Laboratories) was used and reacted at room temperature for 5 minutes. The reacted slides were washed under running water and then counter stained with hematoxylin (Merck) and then sealed. The results of tissue staining are shown in
[0207] Upon immunohistological staining with the IMI4C4a antibody, Case 1 and Case 3 of breast cancer tissue were found to be stained. Moreover, a region stained with the IMI4C4a antibody was a part of cancer tissue. For example, in Case 1 of breast cancer tissue, among the three cancer sites observed, only one site (indicated with the arrow) was stained. Likewise, in Case 3, there were very strongly stained regions (indicated with the arrow at the lower left) and non-stained regions in the same cancer site. Case 2 showed no staining. In contrast, in the case of normal mammary tissue, Cases 1 to 3 showed no staining.
[0208] According to the clinical information attached to the tissues, Case 1 (Position Number D4) is breast cancer at Stage 0 with early invasion, while Case 3 (Position Number D6) is breast cancer with invasion having reached the breast duct. Thus, in the case of using the IMI4C4a antibody, it was shown that there were tissues showing enhanced expression at very early invasion sites of breast cancer at Stage 0.
[0209] Further, using human breast cancer tissue array slides (BC081120; US Biomax), immunohistological staining was performed on 100 cases of human breast cancer tissue and 10 cases of normal tissue. The results summarized at different stages of cancer progression are shown in
[0210] The degree of staining in immunohistological staining was ranked as strongly positive (3+), positive (2+), weakly positive (1+) or negative (0), and the results of immunohistological staining with IMI4C4a were provided for statistical analysis. The results obtained are shown in
[0211] Tissue stained with the IMI4C4a antibody is a part of cancer tissue. In light of the experimental results obtained in Example 1 (6) and Example 2 (3), the enhanced expression of MCT5 is predicted to be involved in invasion of cancer cells; and hence a region stained with the IMI4C4a antibody in breast cancer tissue is highly probable to be a region in the cancer tissue where cells having high invasive capacity are particularly present. The presence of highly invasive cells in cancer tissue has also been expected from previous studies.
[0212] Cancer will develop when some malfunction occurs in the proliferation program of normal cells, and it is pointed out that the root cause of difficulties in cancer treatment lies in that cancer causes morphological changes during the course of development or progression (Nature 2013, 501, p. 328-337). A tumor mass at the time of tumor discovery has already become an aggregate of cells with different properties, and such non-uniformity in cancer tissue is called heterogeneity. Namely, it is known that highly invasive cancer regions and less invasive cancer regions are both present in the same cancer tissue.
[0213] MCT5 increases the invasive capacity when overexpressed in MCF7 cells which are cultured human breast cancer cells. Namely, a region stained with the IMI4C4a antibody in breast cancer tissue is considered to be a breast cancer tissue having high invasive capacity; and hence cancer tissue having high invasive capacity can be expected to be distinguished when using the antibody of the present invention.
(2) Triple Negative Breast Cancer Tissues
[0214] Then, tissue samples derived from the same patients as in the cases used in (1) above were used and analyzed for the expression of estrogen receptors, progesterone receptors and Her2, which are commonly used as breast cancer markers. For detection of estrogen receptors and progesterone receptors, an ER/PgR (MONO) universal kit (Nichirei Corporation, Japan) was used. Likewise, for detection of Her2, Herceptest II (DAKO) was used. Experiments were conducted in accordance with the experimental protocols attached to the respective kits.
[0215] In breast cancer, cancer tissue classified as being estrogen receptor-negative, progesterone receptor-negative and Her2-negative does not require these receptors for cancer cell proliferation, and therefore cannot be treated by hormone therapy or by receptor-mediated anticancer therapy, so that there arises a problem in that there is no therapeutic choice but chemotherapy. Moreover, breast cancer of this type is often seen in young patients and is also pointed out to be highly malignant breast cancer.
[0216] Triple negative breast cancer cases were analyzed with the IMI4C4a antibody, indicating that a part of tissue was stained in 24 cases (57%) of 42 cases.
[0217] Namely, it is indicated that the IMI4C4a antibody can also be used in highly malignant breast cancer cases which have been undetectable by conventional methods.
(3) Immunohistological Staining Using Colorectal Tissues
[0218] The rate of MCT5 expression in cancer was analyzed by analysis of the reactivity between IMI4C4a and colorectal cancer tissue or lung cancer tissue. For analysis, human tissue array slides (FDA808b; USBiomax) were used.
[0219] Immunostaining was conducted in the same manner as shown in Example 5 (1) above. The results of staining in colorectal cancer and normal colorectal mucosal tissue are shown in
[0220] In the case of colorectal tissue, there were some colorectal cancer cases where a part of cancer was clearly stained (
[0221] Cancer adjacent tissue in a cancer patient is used as a control in comparison with a cancer site. However, such cancer adjacent tissue already has genetic mutations and is known to show a different expression profile from that of normal tissue. For example, there is a report showing the results obtained when normal colorectal tissue, colorectal cancer adjacent tissue and colorectal cancer tissue were analyzed for their mRNA expression profile with a high-throughput sequencer (PLoS ONE 2012, 7, e41001). This report points out the presence of a factor (tumor suppressor gene TGFBR2) which varies in both colorectal cancer tissue and cancer adjacent tissue in comparison with normal colorectal tissue. Moreover, as in the case of breast cancer, colorectal cancer is also pointed out to contain a plurality of cells showing different gene expression patterns in the same cancer tissue (heterogeneity).
(4) Immunohistological Staining Using Lung Tissues
[0222] In the case of lung tissue, there were some lung cancer cases where a part of cancer was clearly stained (
(5) Other Cancer Tissues
[0223]
[0224] The above results indicated that MCT5 had the ability to stain a part of cancer, at least in breast cancer, colorectal cancer, lung cancer, ovarian cancer, uterine cancer, uterine cervical cancer, esophageal cancer, thyroid cancer and skin cancer. In light of the finding that MCT5 enhanced invasion in cultured breast cancer cells, MCT5 was shown to be a marker available for use in the diagnosis of highly malignant cancer tissue. Moreover, the antibody of the present invention was demonstrated to be useful for detection and diagnosis of at least breast cancer, colorectal cancer, lung cancer, ovarian cancer, uterine cancer, uterine cervical cancer, esophageal cancer, thyroid cancer and skin cancer.
Example 6 Flow Cytometer Analysis with Anti-MCT5 Antibody
(1) Flow Cytometer Analysis Using Cultured Human Colorectal Cancer Cells
[0225] HCT116 cells, which are human colorectal cancer cells, were cultured to reach 90% confluency. After washing twice with PBS, the cells were detached non-enzymatically from the plates with Cell Dissociation Buffer (Invitrogen) and collected into 1.5 mL tubes. The IMI4C4a antibody was diluted with PBS-T to give a final concentration of 10 μg/mL and added in a volume of 50 μL per tube, and then reacted on ice for 60 minutes. As a control for comparison purposes, anti-Trx-tag antibody (clone No.: Mu2C34, subclass: IgG2a, Order-made Medical Research Inc., Japan) was used and reacted in the same manner. After washing twice with PBS+1% FBS, Alexa Fluor 488-labeled goat anti-mouse IgG (Invitrogen) was added as a 1/200 dilution in PBS+1% FBS, and then reacted on ice for 30 minutes. After washing twice with PBS+2% PBS(FBS?), the cells were analyzed by FACS LSR (BD). The results obtained are shown in
[0226] In the Uniprot database, a region consisting of amino acids at positions 196 to 299 (SEQ ID NO: 7) in the amino acid sequence shown in SEQ ID NO: 2 of human MCT5 registered as O15374 (MOT5_HUMAN) is predicted to be an intracellular region (
(2) Comparison with Existing Antibodies
[0227] Three types of existing antibodies against MCT5 (ab180699, HPA046986 and sc-14932) were compared with the IMI4C4a antibody in a flow cytometer. The same experimental procedures as shown in Example 6 (1) above were repeated. In this case, as a secondary antibody for ab180699 and HPA04986, which are rabbit polyclonal antibodies, Alexa Fluor 488-labeled goat anti-rabbit IgG (Invitrogen) was used as a 1/200 dilution in PBS+1% FBS, while as a secondary antibody for the sc-14932 antibody, which is goat polyclonal antibody, Alexa Fluor 488-labeled donkey anti-goat IgG (Invitrogen) was used as a 1/200 dilution in PBS+1% FBS. The results obtained are shown in
[0228] The IMI4C4a antibody was found to clearly bind to HCT116 cells, whereas ab180699 and HPA046986 showed only slight reaction with HCT116 cells. Moreover, the sc-14932 antibody showed no reaction with HCT116 cells. These results indicated that the IMI4C4a antibody was required to detect living cancer cells and any other antibodies showed little reaction with living cancer cells.
(3) Immunocytological Staining
[0229] Two types of existing antibodies against MCT5 (ab180699 and HPA046986) were used for immunocytological staining of formalin-fixed HCT116 cells. The same procedure as shown in Example 4 (2) was repeated for formalin fixation of the cells, while the same procedure as shown in Example 5 (1) was repeated for reaction with the antibodies and detection. It should be noted that a Histofine (R) kit (Nichirei Corporation, Japan) was used for ab180699 and HPA046986, and blocking, secondary antibody reaction, washing and detection reaction were conducted in accordance with the protocols attached to the kit. The results obtained are shown in
[0230] In the formalin-fixed cells, their cell membrane and cytoplasm were stained equally with all the antibodies used, when compared to the negative control. This indicated that existing antibodies were also available for use in the detection of formalin-fixed samples.
Example 7 Epitope Analysis of IMI4C4a Antibody
(1) Preparation of ICD4 Partial Proteins
[0231] To narrow down candidate regions to which the IMI4C4a antibody binds, ICD4 recombinant partial proteins were prepared.
[0232] The plasmid prepared in Example 1 (3) was used as a template for PCR reaction with the following primers and with KOD PLUS (TOYOBO) to thereby amplify DNA comprising a nucleotide sequence (SEQ ID NO: 41) encoding amino acids at positions 196 to 258 of MCT5. The same procedure was also repeated to amplify DNA comprising a nucleotide sequence (SEQ ID NO: 42) encoding amino acids at positions 227 to 299 of MCT5.
TABLE-US-00010 Primer sequences hSLC16A4 ICD4-F1: (SEQ ID NO: 38) 5′-GCGCGGATCCGAGACCCATCCATATCAAAAGTG-3′ hSLC16A4 ICD4_196-258-R1: (SEQ ID NO: 43) 5′-AAAGTCGACTTGATTTTGTGAGACTGTTAAATTTTTGC-3′ ICD4_196-258 DNA sequence (SEQ ID NO: 41) AGACCCATCCATATCAAAAGTGAGAACAATTCTGGTATTAAAGATAAAGG CAGCAGTTTGTCTGCACATGGTCCAGAGGCACATGCAACAGAAACACACT GCCATGAGACAGAAGAGTCTACCATCAAGGACAGTACTACGCAGAAGGCT GGACTACCTAGCAAAAATTTAACAGTCTCACAAAATCAA ICD4_196-258 amino acid sequence (SEQ ID NO: 8) RPIHIKSENNSGIKDKGSSLSAHGPEAHATETHCHETEESTIKDSTTQKA GLPSKNLTVSQNQ Primer sequences hSLC16A4 ICD4_227-299F1: (SEQ ID NO: 48) 5′-AAAGGATCCACACACTGCCATGAGACAGAAG-3′ hSLC16A4 ICD4-R1: (SEQ ID NO: 39) 5′-GCGCGCGTCGACAGGATTTCTAAAGAGAGAAATGTC-3′ ICD4_227-299 DNA sequence (SEQ ID NO: 42) ACACACTGCCATGAGACAGAAGAGTCTACCATCAAGGACAGTACTACGCA GAAGGCTGGACTACCTAGCAAAAATTTAACAGTCTCACAAAATCAAAGTG AAGAGTTCTACAATGGGCCTAACAGGAACAGACTGTTATTAAAGAGTGAT GAAGAAAGTGATAAGGTTATTTCGTGGAGCTGCAAACAACTGTTTGACAT TTCTCTCTTTAGAAATCCT ICD4_227-299 amino acid sequence (SEQ ID NO: 9) THCHETEESTIKDSTTQKAGLPSKNLTVSQNQSEEFYNGPNRNRLLLKSD EESDKVISWSCKQLFDISLFRNP
[0233] The resulting amplified fragments were each cleaved with restriction enzymes (BamHI and SalI) at the restriction enzyme sites located on the primers and then integrated into pET32b vector for ICD4_196-258 and into pET32a vector (Invitrogen) for ICD4_227-299 to thereby obtain DNAs each comprising a nucleotide sequence encoding a partial protein of MCT5 having Trx-, S- and His-tags on the N-terminal side and a His-tag on the C-terminal side. These vectors were used to express and purify MCT5 partial proteins in the same manner as shown in Example 3 (2), thereby obtaining the desired partial proteins.
(2) Competitive Inhibition Test by ELISA
[0234] A competitive inhibition test was performed using the following four types of proteins: the partial protein (ICD4) obtained in Example 3 (2), the two partial proteins (ICD4_196-258 and ICD4_227-299) obtained in (1) above, and a protein having Trx-, S- and His-tags (Tag) serving as a negative control.
[0235] First, the IMI4C4a antibody at 50 ng/mL (333 pM) was reacted at room temperature for 1 hour with these four types of proteins which had been prepared at 3.33 nM (10-fold), 16.7 nM (50-fold) and 33.3 nM (100-fold). Then, a plate in which 50 ng of ICD4 had been added and immobilized per well was provided, and solutions of the above recombinant proteins mixed with the IMI4C4a antibody were added to this plate. After reaction at room temperature for 1 hour, the reaction between antibody and antigen was analyzed in the same manner as shown in Example 3 (5). The results obtained are shown in
(3) Competitive Inhibition Test in a Flow Cytometer
[0236] Then, analysis was conducted to test whether the binding of the IMI4C4a antibody to cells was also inhibited by the recombinant proteins.
[0237] The IMI4C4a antibody at 1.5 μg/mL (20 μM) was mixed respectively with ICD4, ICD4_196-258 and ICD4_227-299 which had been prepared at 100, 500 or 1000 μM, followed by reaction at room temperature for 1 hour. These reaction solutions were reacted on ice for 30 minutes with HCT116 cells (4×10.sup.5 cells). The subsequent washing, secondary antibody reaction and detection were conducted in the same manner as shown in Example 6 (1). The experimental results obtained are shown in
[0238] When compared to the sample stained with the antibody alone (Positive control), signals clearly disappeared upon addition of ICD4 (SEQ ID NO: 7), ICD4_196-258 (SEQ ID NO: 8) and ICD4_227-299 (SEQ ID NO: 9), indicating that the binding of the IMI4C4a antibody to the cells was inhibited by the partial proteins of MCT5.
(4) Determination of Epitope
[0239] In view of the results obtained in (3) above, the IMI4C4a antibody was predicted to bind to a region within ICD4_227-258 (SEQ ID NO: 14). Then, the following three peptides, i.e., ICD4_227-242 (SEQ ID NO: 10), ICD4_235-250 (SEQ ID NO: 11) and ICD4_242-258 (SEQ ID NO: 12) were chemically synthesized and subjected to the same competitive inhibition test by ELISA as shown in (2) above.
[0240] Relative to the antibody at 50 ng/ml (333 pM), ICD4_227-242, ICD4_235-250 and ICD4_242-258 were each prepared at 1.67 nM (5-fold), 3.33 nM (10-fold), 16.7 nM (50-fold), 33.3 nM (100-fold), 167 nM (500-fold), 333 nM (1,000-fold), 1.66 μM (5,000-fold) and 3.33 mM (10,000-fold), followed by analysis in the same manner as shown in (2) above. The experimental results obtained are shown in
[0241] ICD4_227-242 and ICD4_235-250 were not able to inhibit the binding of IMI4C4a to ICD4 even when added at a 10,000-fold molar ratio relative to the antibody concentration, whereas ICD4_242-258 started to show an inhibitory effect at a 50-fold molar ratio and showed significant inhibition when added at a 500-fold or higher molar ratio. ICD4_235-250 (SEQ ID NO: 11) showing no inhibitory effect and ICD4_242-258 (SEQ ID NO: 12) showing an inhibitory effect overlap with each other in amino acids at positions 235 to 250 of MCT5, and hence the IMI4C4a antibody was found to recognize an amino acid sequence located at positions 251 to 258 (SEQ ID NO: 13) of MCT5.
[0242] A region comprising an epitope recognized by the IMI4C4a antibody, i.e., ICD4_251-258 (SEQ ID NO: 13) is an amino acid sequence which is not contained in the antigen (ICD4_195-250 (SEQ ID NO: 15)) used to obtain the existing antibody HPA046986.
TABLE-US-00011 ICD4_196-258 (SEQ ID NO: 8) RPIHIKSENNSGIKDKGSSLSAHGPEAHATETHCHETEESTIKDSTTQKA GLPSKNLTVSQNQ ICD4_227-299 (SEQ ID NO: 9) THCHETEESTIKDSTTQKAGLPSKNLTVSQNQSEEFYNGPNRNRLLLKSD EESDKVISWSCKQLFDISLFRNP ICD4_227-242 (SEQ ID NO: 10) THCHETEESTIKDSTT ICD4_235-250 (SEQ ID NO: 11) STIKDSTTQKAGLPSK ICD4_242-258 (SEQ ID NO: 12) TQKAGLPSKNLTVSQNQ ICD4_251-258 (SEQ ID NO: 13) NLTVSQNQ ICD4_227-258 (SEQ ID NO: 14) THCHETEESTIKDSTTQKAGLPSKNLTVSQNQ ICD4_195-250 (SEQ ID NO: 15) LRPIHIKSENNSGIKDKGSSLSAHGPEAHATETHCHETEESTIKDSTTQK AGLPSK
INDUSTRIAL APPLICABILITY
[0243] The present invention enables the highly sensitive detection of cancer cells having high invasive capacity which have not been able to be detected by conventional antibodies.
Sequence Listing Free Text
[0244] SEQ ID NO: 16: synthetic DNA
SEQ ID NOs: 17 to 20: synthetic peptides
SEQ ID NOs: 21 to 24: synthetic DNAs
SEQ ID NOs: 25 to 28: synthetic peptides
SEQ ID NOs: 29 to 39: synthetic DNAs
SEQ ID NO: 43: synthetic DNA
SEQ ID NO: 48: synthetic DNA