Immunoreactive antigens of Mycoplasma haemofelis and diagnostic immunoassay
09804159 · 2017-10-31
Assignee
Inventors
Cpc classification
C40B40/10
CHEMISTRY; METALLURGY
C07K14/30
CHEMISTRY; METALLURGY
International classification
C40B40/10
CHEMISTRY; METALLURGY
C07K14/30
CHEMISTRY; METALLURGY
Abstract
Compositions for use in diagnostic screens for Mycoplasma haemofelis are provided. In one embodiment an immunogenic peptide selected from SEQ ID NO: 1 to SEQ ID NO: 60, or a fragment thereof, is immobilized on a solid support and is used to detect the presence of Mycoplasma haemofelis antibodies in a patient bodily fluid. In accordance with one embodiment a method for detecting a Mycoplasma haemofelis infection in a feline species, is provided.
Claims
1. A peptide complex comprising one or more different recombinant fusion peptides and a solid support, wherein the one or more recombinant fusion peptides each comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60 and a terminal amino acid sequence covalently linked at the carboxy or amino terminus of the one or more recombinant fusion peptides; wherein the one or more recombinant fusion peptides does not encode a native amino acid sequence of Mycoplasma haemofelis; and wherein the one or more recombinant fusion peptides are immobilized on the solid support.
2. The peptide complex of claim 1, wherein the one or more different recombinant fusion peptides each comprises 1-18 different recombinant fusion peptides.
3. The peptide complex of claim 1, wherein the one or more different recombinant fusion peptides each comprises 1-9 different recombinant fusion peptides, wherein the one or more recombinant fusion peptides each comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 52 and SEQ ID NO: 57 and a terminal amino acid sequence covalently linked at the carboxy or amino terminus of the one or more recombinant fusion peptides.
4. The peptide complex of claim 1, wherein the one or more different recombinant fusion peptides each further comprises one or more different peptides each comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, and SEQ ID NO: 125 and a terminal amino acid sequence covalently linked at the carboxy or amino terminus of the one or more recombinant fusion peptides; wherein all of the recombinant fusion peptides do not encode a native amino acid sequence of Mycoplasma haemofelis; and wherein all of the recombinant fusion peptides are immobilized on the solid support.
5. The peptide complex of claim 1, wherein the one or more different recombinant fusion peptides each further comprises one peptide comprising an amino acid sequence of SEQ ID NO: 124 and a terminal amino acid sequence covalently linked at the carboxy or amino terminus of the one or more recombinant fusion peptides; wherein all of the recombinant fusion peptides do not encode a native amino acid sequence of Mycoplasma haemofelis; and wherein all of the recombinant fusion peptides are immobilized on the solid support.
6. A composition comprising two or more different isolated recombinant fusion peptides, wherein each of said isolated peptides comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60 and a terminal amino acid sequence covalently linked at the carboxy or amino terminus of the two or more isolated recombinant fusion peptides; and wherein the two or more isolated recombinant fusion peptides do not encode a native amino acid sequence of Mycoplasma haemofelis.
7. The composition of claim 6, wherein the two or more different isolated recombinant fusion peptides each further comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 52 and SEQ ID NO: 57 and a terminal amino acid sequence covalently linked at the carboxy or amino terminus of the two or more isolated recombinant fusion peptides.
8. The composition of claim 6, wherein the two or more different isolated recombinant fusion peptides each further comprises one or more different peptides each comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, and SEQ ID NO: 125 and a terminal amino acid sequence covalently linked at the carboxy or amino terminus of the one or more peptides; and wherein all of the isolated recombinant fusion peptides do not encode a native amino acid sequence of Mycoplasma haemofelis.
9. The composition of claim 6, wherein the two or more different isolated recombinant fusion peptides each further comprises one peptide comprising an amino acid sequence of SEQ ID NO: 124 and a terminal amino acid sequence covalently linked at the carboxy or amino terminus of the two or more recombinant fusion peptides; and wherein the two or more isolated recombinant fusion peptides do not encode a native amino acid sequence of Mycoplasma haemofelis.
10. The composition of claim 8 further comprising an adjuvant.
11. A method of detecting a Mycoplasma haemofelis infection in a warm blooded vertebrate, said method comprising analyzing a bodily fluid from said warm blooded vertebrate for the presence of antibodies that specifically bind to the peptide complex of claim 1 or the composition of claim 6.
12. The method of claim 11 wherein the antibodies are detected via an immunoassay selected from the group consisting of enzyme linked immunosorbent assays (ELISAs), radioimmunoassays (RIAs), and Western blots.
13. A method of detecting a Mycoplasma haemofelis infection in a warm blooded vertebrate, said method comprising analyzing a bodily fluid from said warm blooded vertebrate for the presence of antibodies that specifically bind to the peptide complex of claim 1, wherein said method is performed using an array of peptides immobilized on a solid support.
14. A method of detecting a Mycoplasma haemofelis infection in a warm blooded vertebrate, said method comprising analyzing a bodily fluid from said warm blooded vertebrate for the presence of antibodies that specifically bind to the peptide complex of claim 4, wherein said method is performed using an array of peptides immobilized on a solid support.
15. A method of detecting a Mycoplasma haemofelis infection in a warm blooded vertebrate species, said method comprising analyzing a bodily fluid from said warm blooded vertebrate for the presence of antibodies that specifically bind to the peptide complex of claim 3, wherein the Mycoplasma haemofelis infection is in a warm blooded vertebrate species, said method further comprising obtaining a bodily fluid from said warm blooded vertebrate species; contacting the bodily fluid with the peptide complex of claim 3; and detecting antibody peptide complexes formed between an antibody from said bodily fluid that has specifically bound to one or more recombinant fusion peptides, wherein detection of said complexes identifies a warm blooded vertebrate infected with Mycoplasma haemofelis.
16. A method of detecting a Mycoplasma haemofelis infection in a warm blooded vertebrate species, said method comprising analyzing a bodily fluid from said warm blooded vertebrate for the presence of antibodies that specifically bind to the peptide complex of claim 4, wherein the Mycoplasma haemofelis infection is in a warm blooded vertebrate species, said method further comprising obtaining a bodily fluid from said warm blooded vertebrate species; contacting the bodily fluid with the peptide complex of claim 4; and detecting antibody peptide complexes formed between an antibody from said bodily fluid that has specifically bound to one or more recombinant fusion peptides, wherein detection of said complexes identifies a warm blooded vertebrate infected with Mycoplasma haemofelis.
17. A method of detecting a Mycoplasma haemofelis infection in a warm blooded vertebrate, said method comprising analyzing a bodily fluid from said warm blooded vertebrate for the presence of antibodies that specifically bind to the peptide complex of claim 5, wherein the Mycoplasma haemofelis infection is in a warm blooded vertebrate species, said method further comprising obtaining a bodily fluid from said warm blooded vertebrate species; contacting the bodily fluid with the peptide complex of claim 5; and detecting antibody peptide complexes formed between an antibody from said bodily fluid that has specifically bound to one or more recombinant fusion peptides, wherein detection of said complexes identifies a warm blooded vertebrate infected with Mycoplasma haemofelis.
18. The composition of claim 6, wherein the two or more different isolated recombinant fusion peptides each comprises a label.
19. A method of detecting a Mycoplasma haemofelis infection in a feline, said method comprising analyzing a bodily fluid from said feline for the presence of antibodies that specifically bind to the peptide complex of claim 3, wherein the Mycoplasma haemofelis infection is in a feline species, said method further comprising obtaining a bodily fluid from said feline species; contacting the bodily fluid with the peptide complex of claim 3; and detecting antibody peptide complexes formed between an antibody from said bodily fluid that has specifically bound to one or more recombinant fusion peptides, wherein detection of said complexes identifies a feline infected with Mycoplasma haemofelis.
20. A method of detecting a Mycoplasma haemofelis infection in a feline, said method comprising analyzing a bodily fluid from said feline for the presence of antibodies that specifically bind to the peptide complex of claim 4, wherein the Mycoplasma haemofelis infection is in a feline species, said method further comprising obtaining a bodily fluid from said feline species; contacting the bodily fluid with the peptide complex of claim 4; and detecting antibody peptide complexes formed between an antibody from said bodily fluid that has specifically bound to one or more recombinant fusion peptides, wherein detection of said complexes identifies a feline infected with Mycoplasma haemofelis.
21. A method of detecting a Mycoplasma haemofelis infection in a feline, said method comprising analyzing a bodily fluid from said feline for the presence of antibodies that specifically bind to the peptide complex of claim 5, wherein the Mycoplasma haemofelis infection is in a feline species, said method further comprising obtaining a bodily fluid from said feline species; contacting the bodily fluid with the peptide complex of claim 5; and detecting antibody peptide complexes formed between an antibody from said bodily fluid that has specifically bound to one or more recombinant fusion peptides, wherein detection of said complexes identifies a feline infected with Mycoplasma haemofelis.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
DETAILED DESCRIPTION
(2) Definitions
(3) In describing and claiming the invention, the following terminology will be used in accordance with the definitions set forth below.
(4) The term “about” as used herein means greater or lesser than the value or range of values stated by 10 percent, but is not intended to designate any value or range of values to only this broader definition. Each value or range of values preceded by the term “about” is also intended to encompass the embodiment of the stated absolute value or range of values.
(5) As used herein, the term “pharmaceutically acceptable carrier” includes any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions such as an oil/water or water/oil emulsion, and various types of wetting agents. The term also encompasses any of the agents approved by a regulatory agency of the US Federal government or listed in the US Pharmacopeia for use in animals, including humans.
(6) As used herein the term “patient” without further designation is intended to encompass any warm blooded vertebrate domesticated animal (including for example, but not limited to livestock, horses, cats, dogs and other pets) and humans.
(7) The term “peptide” encompasses a sequence of 3 or more amino acids wherein the amino acids are naturally occurring or synthetic (non-naturally occurring) amino acids. Peptide mimetics include peptides having one or more of the following modifications:
(8) 1. peptides wherein one or more of the peptidyl —C(O)NR— linkages (bonds) have been replaced by a non-peptidyl linkage such as a —CH.sub.2-carbamate linkage
(9) (—CH.sub.2OC(O)NR—), a phosphonate linkage, a —CH.sub.2-sulfonamide (—CH.sub.2—S(O).sub.2NR—) linkage, a urea (—NHC(O)NH—) linkage, a—CH.sub.2-secondary amine linkage, or with an alkylated peptidyl linkage (—C(O)NR—) wherein R is C.sub.1-C.sub.4 alkyl;
(10) 2. peptides wherein the N-terminus is derivatized to a —NRR.sub.1 group, to a
(11) —NRC(O)R group, to a —NRC(O)OR group, to a —NRS(O).sub.2R group, to a —NHC(O)NHR group where R and R.sub.1 are hydrogen or C.sub.1-C.sub.4 alkyl with the proviso that R and R.sub.1 are not both hydrogen;
(12) 3. peptides wherein the C terminus is derivatized to —C(O)R.sub.2 where R.sub.2 is selected from the group consisting of C.sub.1-C.sub.4 alkoxy, and —NR.sub.3R.sub.4 where R.sub.3 and R.sub.4 are independently selected from the group consisting of hydrogen and C.sub.1-C.sub.4 alkyl.
(13) As used herein the term “solid support” relates to a solvent insoluble substrate that is capable of forming linkages (preferably covalent bonds) with soluble molecules. Typically the support is composed of synthetic materials, such as, without limitation, an acrylamide derivative, glass, plastic, agarose, cellulose, nylon, silica, or magnetized particles. The support can be in particulate form or a monolythic strip or sheet. The surface of such supports may be solid or porous and of any convenient shape.
(14) An “array” refers a device consisting of a substrate, typically a solid support having a surface adapted to receive and immobilize a plurality of different protein, peptide, and/or nucleic acid species (i.e., capture or detection reagents) that can used to determine the presence and/or amount of other molecules (i.e., analytes) in biological samples such as blood. Examples of arrays include functionalized solid surfaces (biochips) with peptides linked thereto as well as peptides linked to a solid matrix through electrostatic and/or affinity interactions (e.g., Western Blot).
(15) As used herein, the term “purified” and like terms relate to the isolation of a molecule or compound in a form that is substantially free of contaminants normally associated with the molecule or compound in a native or natural environment. As used herein, the term “purified” does not require absolute purity; rather, it is intended as a relative definition. The term “purified polypeptide” is used herein to describe a polypeptide which has been separated from other compounds including, but not limited to nucleic acid molecules, lipids and carbohydrates. A “highly purified” compound as used herein refers to a compound that is greater than 95% pure.
(16) The term “isolated” requires that the referenced material be removed from its original environment (e.g., the natural environment if it is naturally occurring). For example, a naturally-occurring polynucleotide present in a living animal is not isolated, but the same polynucleotide, separated from some or all of the coexisting materials in the natural system, is isolated.
(17) As used herein, the term “antibody” refers to a polyclonal or monoclonal antibody or a binding fragment thereof such as Fab, F(ab′).sub.2 and Fv fragments.
(18) The term “identity” as used herein relates to the similarity between two or more sequences. Identity is measured by dividing the number of identical residues by the total number of residues and multiplying the product by 100 to achieve a percentage. Thus, two copies of exactly the same sequence have 100% identity, whereas two sequences that have nucleic acid/amino acid deletions, additions, or substitutions relative to one another have a lower degree of identity. Those skilled in the art will recognize that several computer programs, such as those that employ algorithms such as BLAST (Basic Local Alignment Search Tool, Altschul et al. (1993) J. Mol. Biol. 215:403-410) are available for determining sequence identity.
(19) As used herein, the term “primer” refers to an oligonucleotide, whether occurring naturally as in a purified restriction digest product, or produced synthetically, which is capable of acting as a point of initiation of synthesis when placed under conditions in which synthesis of a primer extension product which is complementary to a nucleic acid strand is induced, (i.e., in the presence of nucleotides and an inducing agent such as DNA polymerase and at a suitable temperature and pH). The primer is preferably single stranded for maximum efficiency in amplification, but may alternatively be double stranded. If double stranded, the primer is first treated to separate its strands before being used to prepare extension products.
(20) The term “thermostable polymerase” refers to a polymerase enzyme that is heat stable, i.e., the enzyme catalyzes the formation of primer extension products complementary to a template and does not irreversibly denature when subjected to the elevated temperatures for the time necessary to effect denaturation of double-stranded template nucleic acids. Generally, the synthesis is initiated at the 3′ end of each primer and proceeds in the 5′ to 3′ direction along the template strand. Thermostable polymerases have been isolated from Thermus flavus, T. ruber, T. thermophilus, T. aquaticus, T. lacteus, T. rubens, Bacillus stearothermophilus, and Methanothermus fervidus. Nonetheless, polymerases that are not thermostable also can be employed in PCR assays provided the enzyme is replenished.
(21) As used herein, the term “hybridization” is used in reference to the pairing of complementary nucleic acids. Hybridization and the strength of hybridization (i.e., the strength of the association between the nucleic acids) is impacted by such factors as the degree of complementarity between the nucleic acids, stringency of the conditions involved, the length of the formed hybrid, and the G:C ratio within the nucleic acids. High stringency conditions (low salt, high temperature) are well known in the art. Conditions may be rendered less stringent by increasing salt concentration and decreasing temperature. For example, a medium stringency condition could be provided by about 0.1 to 0.25 M NaCl at temperatures of about 37° C. to about 55° C., while a low stringency condition could be provided by about 0.15 M to about 0.9 M salt, at temperatures ranging from about 20° C. to about 55° C. An extensive guide to the hybridization of nucleic acids is found in Tijssen (1993) Laboratory Techniques in Biochemistry and Molecular Biology—Hybridization with Nucleic Acid Probes, Part I, Chapter 2 (Elsevier, N.Y.); and Ausubel et al., eds. (1995) Current Protocols in Molecular Biology, Chapter 2 (Greene Publishing and Wiley-Interscience, New York). See Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Plainview, N.Y.).
(22) Embodiments
(23) Prior to applicant's invention, the preparation of Mycoplasma haemofelis antigen was contingent upon infection of a cat since this parasite cannot be grown in culture. The process of isolating the organisms from whole blood is cumbersome and involves lengthy detachment and selective centrifugations and filtration procedures, however this was previously the only method for obtaining potential immunoreactive antigens of M. haemofelis. The isolation of immunoreactive antigens of M. haemofelis is desirable to provide an antigen source for development of 1) serologic assays and 2) vaccine production. As disclosed herein applicants have prepared a M. haemofelis expression library to enhance the production and characterization of Mycoplasma haemofelis proteins to allow identification of suitable antigenic peptides.
(24) Applicants have successfully identified immunodominant antigens of M. haemofelis, including for example those listed in Table 1 of Example 1. Such immunogenic antigens can be used in vaccine formulations as well as in assays designed to identify animals infected with M. haemofelis that previously would not be detected. For example, the polypeptide antigens disclosed herein can provide the basis of a diagnostic assay for detecting antibodies present in infected animals, thus identifying animals exposed to Mycoplasma haemofelis antigen. Such a method allows for a sensitive, rapid, in-house, laboratory diagnosis of M. haemofelis infection of warm blooded vertebrates, including feline species such as domesticated cats. In one embodiment, the assay is conducted using a biological sample (e.g., serum, plasma, or whole blood) from a warm blooded vertebrate. In a further embodiment methods are provided for detecting the presence and/or degree of M. haemofelis in biological or environmental samples through the use of the isolated immunogenic M. haemofelis peptides disclosed herein to detect the presence of anti-M. haemofelis antibodies in the sample.
(25) In accordance with one embodiment an isolated or purified M. haemofelis peptide is provided comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60. In another embodiment the peptide comprises a sequence selected from the group consisting of P3-orf1165 (SEQ ID NO: 1), P6D-orf00908 (SEQ ID NO: 3), P7-orf0262 (SEQ ID NO: 8), P7-orf0263 (SEQ ID NO: 9), P10B-orf01747 (SEQ ID NO: 15), P10B-orf1749 (SEQ ID NO: 17, P10C-orf01238 (SEQ ID NO: 19, P10C-orf01239 (SEQ ID NO: 20), P10E-orf00279 (SEQ ID NO: 21), P15-orf00945 (SEQ ID NO: 27, P15-orf00946 (SEQ ID NO: 28), P15-orf00947 (SEQ ID NO: 29), P18-orf00128 (SEQ ID NO: 37), P21A-orf00675 (SEQ ID NO: 39), P21B-orf01544 (SEQ ID NO: 40), P24-orf01679 (SEQ ID NO: 45), P28-orf01521 (SEQ ID NO: 52) and P29-orf0177 SEQ ID NO: 57). Each of these peptides have been identified as being immunogenic and thus useful as a diagnostic test antigens or as the antigenic component of a vaccine formulation. In one embodiment an isolated or purified M. haemofelis peptide is provided comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 20 and SEQ ID NO: 21. In one embodiment an isolated or purified M. haemofelis peptide is provided comprising a fragment of P6D-orf00908 (position 1-65; SEQ ID NO: 122), P10C-orf01238 (position 85-255; SEQ ID NO: 123), P10C-orf01239 (position 538-687; SEQ ID NO: 124), and P10E-orf00279 (position 1-159; SEQ ID NO: 125). In one embodiment the peptide comprises the sequence of SEQ ID NO: 20 or SEQ ID NO: 124.
(26) Also encompassed by the present invention are antigenic fragments of an amino acid sequence selected from SEQ ID NO: 1 through SEQ ID NO: 60. In one embodiment the peptide fragment comprises a contiguous amino acid sequence of at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids that is identical in sequence to a contiguous amino acid sequence contained within a sequence selected from SEQ ID NO: 1 through SEQ ID NO: 60. In one embodiment the fragment comprises at least an 8 contiguous amino acid sequence identical to a sequence contained within SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 52 or SEQ ID NO: 57. In one embodiment an antigenic peptide is provided that comprises at least an eight amino acid sequence that is identical to a contiguous eight amino acid sequence contained in a sequences selected from SEQ ID NO: 1 through SEQ ID NO: 60. In one embodiment the fragment comprises at least an 8 contiguous amino acid sequence identical to a sequence contained within SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 20 or SEQ ID NO: 21.
(27) In one embodiment a peptide is provided that comprises a contiguous span of at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 22, 23, 24, 25, 26, 27, 28, 29, 30 amino acids that shares at least 80% sequence identity (e.g., 80%, 85%, 90%, 95% or 99%) with a contiguous sequence of the same length contained within a sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60. In one embodiment a peptide is provided that comprises a contiguous span of at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 22, 23, 24, 25, 26, 27, 28, 29, 30 amino acids that shares at least 95% sequence identity with a contiguous sequence of the same length contained within a sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60. In one embodiment a peptide is provided that comprises a contiguous span of at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 22, 23, 24, 25, 26, 27, 28, 29, 30 amino acids that shares at least 95% sequence identity with a contiguous sequence of the same length contained within a sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, and SEQ ID NO: 125.
(28) In one embodiment a peptide is provided that comprises a contiguous span of at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 22, 23, 24, 25, 26, 27, 28, 29, 30 amino acids that differs from a sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60 by 1, 2 or 3 amino acids. In one embodiment a peptide is provided that comprises a contiguous span of at least 8 amino acids that differs from a contiguous 8 amino acid sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60 by 1 amino acid. In one embodiment the 1, 2 or 3 different amino acids represent conservative amino acid substitutions.
(29) Immunogenic fragments of the peptides of SEQ ID NOs: 1-60 can also be described in terms of the N-terminal and C-terminal positions of the original protein. For example, the N terminus and C terminus of an 8 amino acid fragment of a sequence selected from SEQ ID NO: 1 through 60 can be assigned numbers relative to the position of the amino acids in the corresponding parent protein. More specifically, an 8 amino acid sequence fragment of SEQ ID NO: 1 that has the first three amino acids deleted and comprises the next eight amino acids can be designated fragment N4-C11 of SEQ ID NO: 1. Accordingly, fragments of any of SEQ ID NO: 1 through SEQ ID NO: 60 having a fragment length starting from 8 contiguous amino acids up to 1 amino acid less than the full length polypeptide are included in the present invention. Thus, an 8 consecutive amino acid fragment could correspond to amino acid fragments selected from the group consisting of 1-8, 2-9, 3-10, 4-11, 5-12, 6-13, 7-14, 8-15, 9-16, 10-17, 11-18, 12-18, 13-20, . . . to (X minus 7 to X), wherein X is an integer representing the total number of amino acids of the parent peptide from which the fragment is derived.
(30) The present disclosure also encompasses conjugates of the antigenic M. haemofelis peptides disclosed herein, wherein the M. haemofelis peptides are linked, optionally via covalent bonding and optionally via a linker, to a conjugate moiety. Exemplary conjugate moieties that can be linked to any of the M. haemofelis peptides peptides described herein include but are not limited to a heterologous peptide or polypeptide (including for example, a plasma protein), a targeting agent, an adjuvant, an immunoglobulin or portion thereof (e.g. variable region, CDR, or Fc region), a diagnostic label such as a radioisotope, fluorophore or enzymatic label, a polymer including water soluble polymers, or other therapeutic or diagnostic agents. Linkage can be accomplished by covalent chemical bonds, physical forces such electrostatic, hydrogen, ionic, van der Waals, or hydrophobic or hydrophilic interactions. The peptide can be linked to conjugate moieties via direct covalent linkage by reacting targeted amino acid residues of the peptide with an organic derivatizing agent that is capable of reacting with selected side chains or the N- or C-terminal residues of these targeted amino acids.
(31) In accordance with one embodiment an antigenic M. haemofelis fusion peptide is provided wherein a peptide sequence selected from SEQ ID NO: 1 through SEQ ID NO: 60 is further modified to comprise a non-native amino acid sequence linked to the carboxy or amino terminus of the peptide selected from SEQ ID NO: 1 through SEQ ID NO: 60. In one embodiment the anitgenic M. haemofelis fusion peptide comprises a peptide selected from the group consisting of SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, and SEQ ID NO: 125. In one embodiment the sequence added to the amino or carboxy terminus is a sequence not native to M. haemofelis.
(32) In accordance with one embodiment the antigenic M. haemofelis peptides disclosed herein are combined with a pharmaceutically acceptable carrier and are administered to a warm blooded vertebrate to induce an immune response, optionally including the production of antibodies against the immunogenic peptides. In one embodiment the composition further comprises an adjuvant. In accordance with one embodiment a composition is provided comprising an antigenic M. haemofelis peptide or conjugate thereof as disclosed herein.
(33) In one embodiment one or more of the M. haemofelis immunogenic peptides disclosed herein are linked to a solid support. The linkage may comprise a covalent, ionic, or hydrogen bond or other interaction that binds the peptide to the solid support either directly or through an intermediate linking moiety. In one embodiment the peptides are covalently bound to the solid support, either directly or via a linker. The solid support may be comprised of any suitable material (e.g., magnetic or non-magnetic metal, silicon, glass, cellulose, plastics, polyethylene, polypropylene, polyester, nitrocellulose, nylon, and polysulfone plastic) that will allow for the binding of a peptide of SEQ ID NO: 1-60 to the support material either by a direct or indirect linkage. The solid support may be configured into a number of shapes including, for example, a test tube, microtiter well, sheet, bead (e.g., magnetic beads, non-magnetic beads, agarose beads) microparticle, chip, and other configurations known to those of ordinary skill in the art. In one embodiment the solid support represents an array of electrophoretically separated proteins linked to a sheet of nitrocellulose or synthetic material (i.e., a Western blot). In another embodiment the solid support is a bead comprising one or more sequences selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60 linked to its surface. In a further embodiment the solid support is a strip or chip comprising an array of one or more of the peptides of SEQ ID NO: 1 through SEQ ID NO: 60 linked to its surface. In one embodiment an isolated peptide complex is provided comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60, or a contiguous 8 amino acid fragment of an amino acid sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60, and a solid support, wherein said peptide is immobilized on said solid support. In one embodiment the immobilized peptide comprises the sequence of P3-orf1165 (SEQ ID NO: 1), P6D-orf00908 (SEQ ID NO: 3), P7-orf0262 (SEQ ID NO: 8), P7-orf0263 (SEQ ID NO: 9), P10B-orf01747 (SEQ ID NO: 15), P10B-orf1749 (SEQ ID NO: 17), P10C-orf01238 (SEQ ID NO: 19), P10C-orf01239 (SEQ ID NO: 20), P10E-orf00279 (SEQ ID NO: 21), P15-orf00945 (SEQ ID NO: 27), P15-orf00946 (SEQ ID NO: 28), P15-orf00947 (SEQ ID NO: 29), P18-orf00128 (SEQ ID NO: 37), P21A-orf00675 (SEQ ID NO: 39), P21B-orf01544 (SEQ ID NO: 40), P24-orf01679 (SEQ ID NO: 45), P28-orf01521 (SEQ ID NO: 52) and P29-orf0177 (SEQ ID NO: 57), or a contiguous 8 amino acid sequence fragment thereof. In another embodiment the immobilized peptide comprises the sequence of SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, or a contiguous 8 amino acid sequence fragment of said sequences. In one embodiment the immobilized peptide comprises a peptide selected from the group consisting of SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, and SEQ ID NO: 125). In one embodiment the immobilized peptide comprises the sequence of SEQ ID NO: 20 or SEQ ID NO: 124. In one embodiment the arrays of the present disclosure comprise at least two peptides comprising a sequence selected from the group consisting of SEQ ID NO: 1 through 60, or an continuous 8 amino acid fragment thereof, linked to its surface.
(34) In accordance with one embodiment a method of detecting anti-M. haemofelis antibodies in a sample is provided wherein the method comprises the step of contacting the sample with a peptide comprising a sequence selected from the group consisting of SEQ ID NO: 1 through 60, or an continuous 8 amino acid fragment thereof under conditions that allow for the formation of an antibody-antigen complex. These methods can further comprise the step of detecting the formation of said antibody-antigen complex. In one embodiment a method of detecting a Mycoplasma haemofelis infection, and/or determining the degree of infection, in a warm blooded vertebrate is provided. In one embodiment the warm blooded vertebrate is a feline species, including for example, domesticated cats. The method comprises analyzing a bodily fluid from said vertebrate for the presence of antibodies that specifically bind to an amino acid sequence selected from SEQ ID NO: 1 through SEQ ID NO: 60, or a contiguous 8 amino acid fragment of SEQ ID NO: 1 through SEQ ID NO: 60. In one embodiment the method comprises analyzing a bodily fluid from said vertebrate for the presence of antibodies that specifically bind to an amino acid sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, and SEQ ID NO: 125). In one embodiment the bodily fluid represents a biological sample recovered from the patient to be investigated for an M. haemofelis infection and may include any bodily fluid where anti-M. haemofelis antibodies would be expected to be present. In one embodiment the bodily fluid is blood or a blood derivative such as plasma or serum. The binding of the anti-M. haemofelis antibodies with the immunogenic peptides disclosed herein can be detected using any procedure known to those skilled in the art including for example the use of an immunoassay. In one embodiment the immunoassay is selected from the group consisting of enzyme linked immunosorbent assays (ELISAs), radioimmunoassays (RIAs), lateral flow assays, immunochromatographic strip assays, automated flow assays, Western blots, immunoprecipitation assays, reversible flow chromatographic binding assays, agglutination assays, and biosensors. In one embodiment the assay used is either an enzyme linked immunosorbent assay or Western blot analysis.
(35) In one embodiment the detection of the anti-M. haemofelis antibodies is conducted using a panel or an array of peptides comprising one or more amino acid sequences selected from SEQ ID NO: 1 through SEQ ID NO: 60, or a contiguous 8 amino acid fragment of an amino acid sequence selected from SEQ ID NO: 1 through SEQ ID NO: 60. In one embodiment the panel or array of peptides comprising one or more amino acid sequences selected from SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, or a contiguous 8 amino acid sequence fragment of said sequences. In one embodiment the array of peptides comprises one or more amino acid sequences selected from the group consisting of SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, and SEQ ID NO: 125. In one embodiment the solid support comprises an array of the same peptide, including any peptide selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60, including for example the peptide of P10C-orf01239 (SEQ ID NO: 20), or a fragment thereof such as SEQ ID NO: 124. Alternatively, the array of peptides may comprises at least two different peptides comprising an amino acid sequence selected from SEQ ID NO: 1 through SEQ ID NO: 60, or a contiguous 8 amino acid sequence fragment of said sequences, or selected from SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21 or a contiguous 8 amino acid fragment of said sequences. In one embodiment the immobilized peptides on the array comprise sequences independently selected from the group consisting of P3-orf1165 (SEQ ID NO: 1), P6D-orf00908 (SEQ ID NO: 3), P7-orf0262 (SEQ ID NO: 8), P7-orf0263 (SEQ ID NO: 9), P10B-orf01747 (SEQ ID NO: 15), P10B-orf1749 (SEQ ID NO: 17, P10C-orf01238 (SEQ ID NO: 19, P10C-orf01239 (SEQ ID NO: 20), P10E-orf00279 (SEQ ID NO: 21), P15-orf00945 (SEQ ID NO: 27, P15-orf00946 (SEQ ID NO: 28), P15-orf00947 (SEQ ID NO: 29), P18-orf00128 (SEQ ID NO: 37), P21A-orf00675 (SEQ ID NO: 39), P21B-orf01544 (SEQ ID NO: 40), P24-orf01679 (SEQ ID NO: 45), P28-orf01521 (SEQ ID NO: 52) and P29-orf0177 SEQ ID NO: 57), or a contiguous 8 amino acid sequence fragment of those sequences. In another embodiment the immobilized peptides comprise sequences selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, or a contiguous 8 amino acid sequence fragment of those sequences. In one embodiment the immobilized peptides comprise one or more amino acid sequences selected from the group consisting of SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, and SEQ ID NO: 125. In one embodiment, one of the peptides present on the array is the peptide of SEQ ID NO: 20.
(36) In one embodiment a method of detecting a Mycoplasma haemofelis infection in a feline species is provided wherein the method comprises obtaining a bodily fluid from a feline species, and analyzing the bodily fluid for the presence of antibodies that specifically bind to a peptide comprising an amino acid sequence selected from SEQ ID NO: 1 through SEQ ID NO 60, or a contiguous 8 amino acid fragment of an amino acid sequence selected from SEQ ID NO: 1 through SEQ ID NO 60.
(37) In accordance with one embodiment a method of detecting a Mycoplasma haemofelis infection in a feline species is provided. The method comprises obtaining a bodily fluid from a feline species, contacting the bodily fluid with a peptide selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 52 and SEQ ID NO: 57, and detecting antibody peptide complexes formed between an antibody from said bodily fluid that has specifically bound to said peptide, wherein detection of said complexes identifies a feline infected with Mycoplasma haemofelis. In one embodiment the Mycoplasma haemofelis antigenic peptides are immobilized in a matrix or bound to a solid support and the antigenic peptides are contacted with the bodily fluid under conditions that allow specific binding of any antibodies present in the bodily fluid to the peptides. The bodily fluid is incubated with the immobilized/bound peptides for a time sufficient to allow specific binding and then the immobilized/bound peptides are washed to remove any non-specific bound material. After the washing step the immobilized/bound peptides are analyzed using standard techniques to detect any antibodies that have bound to the immobilized/bound peptides. The detection of such antibody/peptide complexes indicates the subject the bodily fluid was recovered from is infected with Mycoplasma haemofelis.
(38) In one embodiment the solid support comprises two or more different peptides and in one embodiment the peptides bound to the solid support are selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 20 and SEQ ID NO: 21.
(39) Detection of the antibody-peptide complexes in accordance with the present disclosure can be conducted using one of four types of assays: direct binding assays, sandwich assays, competition assays, and displacement assays. In a direct binding assay, either the antibody or the peptide is labeled, and there is a means of measuring the number of complexes formed. In a sandwich assay, the formation of a complex of at least three components (e.g., antibody-antigen-antibody) is measured. In a competition assay, labeled antigen and unlabelled antigen compete for binding to the antibody, and either the bound or the free component is measured. In a displacement assay, labeled antibody is pre-bound to the antigen, and a change in signal is measured as the unlabelled antibody displaces the bound, labeled antibody from the antigen.
(40) Non-limiting examples of immunoassays that can be used for the detection of anti-M. haemofelis antibodies include, enzyme linked immunosorbent assays (ELISAs), radioimmunoassays (RIAs), lateral flow assays, immunochromatographic strip assays, automated flow assays, Western blots, immunoprecipitation assays, reversible flow chromatographic binding assays, agglutination assays, and biosensors. In one embodiment the assay used is an ELISA sandwich assay or a Western blot. Additional aspects of the present disclosure encompass the use of an array of polypeptides when conducting the aforementioned methods of detection (the array can comprise polypeptides of the same or different sequence as well as negative and positive control amino acid sequences).
(41) Immunoassays can involve “sandwich” approaches in which the analyte to be detected (e.g., a serum antibody reactive with a peptide of SEQ ID NO: 1 through SEQ ID NO 60) is bound by two other entities, for example, by a capture reagent (e.g., a peptide of SEQ ID NO: 1 through SEQ ID NO 60) immobilized on a solid support and specific for the anti-M. haemofelis antibodies present in a sample, and a labeled detection reagent that binds to serum antibodies from the species to which the subject belongs (e.g., a labeled mouse antibody that reacts with feline IgG). In one embodiment the bound anti-M. haemofelis antibodies are detected using goat anti-cat antibodies wherein the goat anti-cat antibodies are linked to a detectable label including for example, horseradish peroxidase (HRP). In this way the “sandwich” can be used to measure the amount of anti-M. haemofelis antibodies bound between the capture and detection reagents. Sandwich assays are especially valuable to detect analytes present at low concentrations or in complex solutions (e.g., blood, serum, etc.) containing high concentrations of other molecules. As is known, in these sorts of assays a “capture” reagent (e.g., a peptide of SEQ ID NO: 1 through SEQ ID NO 60) is immobilized on a solid support such as a glass slide, plastic strip, or microparticle. A liquefied biological sample (e.g., serum) known or suspected to contain the target antibody is then added and allowed to complex with the immobilized capture reagent. Unbound products are removed and the detection reagent is then added and allowed to bind to antibody species that have been “captured” on the substrate by the capture reagent, thus completing the “sandwich”. These interactions are then used to quantitate the amount of anti-M. haemofelis antibodies present in the biological sample.
(42) In other embodiments, the subject invention provides for diagnostic assays based upon Western blot formats or other standard immunoassays known to the skilled artisan. For example, antibody-based assays such as radioimmunoassays (RIAs); lateral flow assays, reversible flow chromatographic binding assay (see, for example, U.S. Pat. No. 5,726,010, which is hereby incorporated by reference in its entirety), immunochromatographic strip assays, automated flow assays, and assays utilizing peptide- or antibody-containing biosensors may be employed for the detection of antibodies that bind to the peptides of SEQ ID NO: 1 through SEQ ID NO: 60 or fragments thereof, provided by the subject invention. The assays and methods for conducting the assays are well-known in the art and the methods may test biological samples (e.g., serum, plasma, or blood) qualitatively (presence or absence of polypeptide) or quantitatively (comparison of a sample against a standard curve prepared using a polypeptide of the subject invention) for the presence of antibodies that bind to polypeptides of the subject invention.
(43) Lateral flow assays can be conducted according to the teachings of U.S. Pat. No. 5,712,170 and the references cited therein. U.S. Pat. No. 5,712,170 and the references cited therein are hereby incorporated by reference in their entireties. Displacement assays and flow immunosensors useful for carrying out displacement assays are described in: (1) Kusterbeck et al., “Antibody-Based Biosensor for Continuous Monitoring”, in Biosensor Technology, R. P. Buck et al., eds., Marcel Dekker, N.Y. pp. 345-350 (1990); Kusterbeck et al., “A Continuous Flow Immunoassay for Rapid and Sensitive Detection of Small Molecules”, Journal of Immunological Methods, vol. 135, pp. 191-197 (1990); Ligler et al., “Drug Detection Using the Flow Immunosensor”, in Biosensor Design and Application, J. Findley et al., eds., American Chemical Society Press, pp. 73-80 (1992); and Ogert et al., “Detection of Cocaine Using the Flow Immunosensor”, Analytical Letters, vol. 25, pp. 1999-2019 (1992), all of which are incorporated herein by reference in their entireties. Displacement assays and flow immunosensors are also described in U.S. Pat. No. 5,183,740, which is also incorporated herein by reference in its entirety. The displacement immunoassay, unlike most of the competitive immunoassays used to detect small molecules, can generate a positive signal with increasing antigen concentration.
(44) In accordance with the present invention a diagnostic assay for determining presence and/or degree of a M. haemofelis infection in a patient depends, in part, on ascertaining the presence of an antibody associated with M. haemofelis. According one aspect of the present disclosure is directed to kits for screening bodily fluids recovered from patients for the presence of anti-M. haemofelis antibodies. The bodily fluids include any liquid sample obtained or derived from a body, such as blood, saliva, semen, tears, tissue extracts, exudates, body cavity wash, serum, plasma, tissue fluid and the like that is anticipated to contain said antibodies. In one embodiment the bodily fluid is blood or a derivative thereof such as serum or plasma. In one embodiment the kit comprises a panel of immunodominant surface antigens of M. haemofelis. As used herein a panel means a compiled set of markers that are measured together in an assay. In one embodiment the panel comprises two or more peptides that comprise an amino acid sequence selected from SEQ ID NO: 1 through SEQ ID NO: 60. In one embodiment the panel comprise ones or more amino acid sequences selected from the group consisting of SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, and SEQ ID NO: 125. Capture proteins compiled on a diagnostic chip can be used to measure the relative amount of anti-M. haemofelis antibodies present in a blood sample. This can be accomplished using a variety of platforms, different formulations of the peptide (e.g. phage expressed, cDNA derived, peptide library or purified protein), and different statistical permutations that allow comparison between and among samples. Comparison will require that measurements be standardized, either by external calibration or internal normalization. The assay format can range from standard immunoassays, such as dipstick and lateral flow immunoassays, which generally detect one or a small number of targets simultaneously, at low manufacturing cost, to ELISA-type formats which often are configured to operate in a multiple well culture dish which can process, for example, 96, 384 or more samples simultaneously and are common to clinical laboratory settings and are amenable to automation, to array and microarray formats where many more samples are tested simultaneously in a high throughput fashion. The assay also can be configured to yield a simple, qualitative discrimination (yes vs. no). The kit may further include a variety of containers, e.g., vials, tubes, bottles, and the like. Preferably, the kits will also include instructions for use. In one embodiment the kit may include additional reagents for detecting complexes formed between M. haemofelis antigens and anti-M. haemofelis antibodies including enzyme substrates, and labeled or unlabeled secondary binding agents. In one embodiment a labeled antibody specific for cat immunoglobins is provided as the secondary binding agent.
(45) Typically the specific binding agent (e.g., M. haemofelis antigens) is immobilized on a solid support. After the bodily fluid (e.g., animal serum sample) is placed in contact with the binding agent and allowed to bind, the solid support can optionally be washed to remove material which is not specifically bound to the binding agent. The agent/antibody complex may be detected by using a second binding agent which will bind the complex. Typically the second agent binds the substance at a site which is different from the site which binds the first agent. In one embodiment the second agent is an antibody that is labeled directly or indirectly by a detectable label. In one embodiment the second agent is a labeled anti-cat antibody. Alternatively, the second agent may be detected by a third agent wherein the third agent is labeled directly or indirectly by a detectable label. For example the second agent may comprise a biotin moiety, allowing detection by a third agent which comprises a streptavidin moiety and typically alkaline phosphatase as a detectable label.
(46) In one embodiment a method of detecting the presence or absence of antibodies directed against M. haemofelis antigens is provided wherein a sample suspected of containing said antibodies is contacted with at least two peptides (selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 60) for a time sufficiently long to allow a complex to be formed between the at least one of said peptides and any antibodies present. After an optional wash step the sample is analyzed to determine the presence or absence of the antibody-peptide complex.
(47) In accordance with one embodiment peptides comprising the sequences selected from SEQ ID NO: 1 through SEQ ID NO 60, or fragments thereof are formulated as vaccine compositions. In one embodiment a composition is provided comprising a sequence selected from SEQ ID NO: 1 through SEQ ID NO 60, or immunogenic fragment thereof, and a pharmaceutically acceptable carrier. In one embodiment the composition further comprises an adjuvant. In another embodiment, a polynucleotide vaccine is administered either alone or in conjunction with a polypeptide antigen. In one embodiment, the antigen is a polynucleotide selected from SEQ ID NO: 61 through SEQ ID NO 121. Methods of introducing DNA vaccines into individuals are well-known to the skilled artisan. For example, DNA can be injected into skeletal muscle or other somatic tissues (e.g., intramuscular injection). Cationic liposomes or biolistic devices, such as a gene gun, can be used to deliver DNA vaccines. Alternatively, iontophoresis and other means for transdermal transmission can be used for the introduction of DNA vaccines into an individual. In one further embodiment, the polypeptide antigen is administered as a booster subsequent to the initial administration of the polynucleotide vaccine. Accordingly, in one embodiment a method is provided for inducing an immune response to the novel immunodominant M. haemofelis antigens disclosed herein. The method comprises administering a composition comprising the peptides of SEQ ID NO: 1 through SEQ ID NO 60 and/or the nucleotide sequences of selected from SEQ ID NO: 61 through SEQ ID NO 121. In one embodiment the administered composition comprises one or more amino acid sequences selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO: 124, and SEQ ID NO: 125).
(48) The present disclosure also concerns antibodies that bind to peptides comprising a sequences selected from SEQ ID NO: 1 through SEQ ID NO 60. Antibodies that are immunospecific for the polypeptides as set forth herein are specifically contemplated. The antibodies of the subject invention can be prepared using standard materials and methods known in the art (see, for example, Monoclonal Antibodies: Principles and Practice, 1983; Monoclonal Hybridoma Antibodies: Techniques and Applications, 1982; Selected Methods in Cellular Immunology, 1980, Immunological Methods, Vol. II, 1981; Practical Immunology, and Kohler et al. [1975] Nature 256:495). These antibodies can further comprise one or more additional components, such as a solid support, a carrier or pharmaceutically acceptable excipient, or a label.
(49) In accordance with one embodiment an isolated nucleic acid sequence is provided that encodes a sequence selected from SEQ ID NO: 1 through SEQ ID NO 60, or a fragment thereof. In one embodiment an isolated nucleic acid sequence is provided that encodes an amino acid sequence comprising a contiguous 8 amino acid fragment of an amino acid sequence selected from SEQ ID NO: 1 through SEQ ID NO 60. In one embodiment the nucleic acid sequence encodes a peptide fragment comprising a contiguous span of at least 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 22, 23, 24, 25, 26, 27, 28, 29, 30 amino acids of a sequence selected from SEQ ID NO: 1 through SEQ ID NO 60. In a further embodiment the nucleic acid sequence comprises a nucleic acid sequence that encodes a peptide fragment comprises at least an 8 contiguous amino acid sequence of a sequence selected from SEQ ID NO: 1 through SEQ ID NO 60 or a peptide that differs from an amino acid sequence of SEQ ID NO: 1 through SEQ ID NO 60 only by 1, 2 or 3 amino acids.
(50) In accordance with one embodiment a nucleic acid sequence selected from SEQ ID NO: 61 through SEQ ID NO 121 is provided, or a nucleic acid fragment thereof. In accordance with one embodiment a nucleic acid sequence is provided comprising at least 6 nucleotides and having 75, 80, 85, 90, 95, 99 or 100% sequence identity with a contiguous nucleic acid sequence of a nucleic acid sequence selected from SEQ ID NO: 61 through SEQ ID NO 121. In accordance with one embodiment a nucleic acid sequence of 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 nucleotides is provided wherein the sequence has 75, 80, 85, 90, 95, 99 or 100% sequence identity with a contiguous nucleic acid sequence of a nucleic acid sequence of SEQ ID NO: 61 through SEQ ID NO 121. In one embodiment the nucleic acid sequence comprises a 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 nucleotide sequence that has 90, 95 or 99% sequence identity with a sequence selected from SEQ ID NO: 61 through SEQ ID NO 121. In one embodiment the nucleic acid sequence comprises a 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 nucleotide sequence that is identical to a corresponding sequence contained within a sequence selected from SEQ ID NO: 61 through SEQ ID NO 121.
(51) In one embodiment a nucleic acid sequence is provided that can hybridize to a sequence selected from SEQ ID NO: 61 through SEQ ID NO 121 under medium or high stringent conditions. In one embodiment the nucleic sequence is a primer for use in PCR wherein the primer is 6 to 25, 8 to 20, 8 to 15 nucleotides in length. In one embodiment the medium stringent conditions comprise a step of washing the hybridized nucleic acid sequences with 5×SSC, 0.5% SDS at 37° C. for 30 min. In one embodiment the high stringent conditions comprise a step of washing the hybridized nucleic acid sequences with 2×SSC, 0.5% SDS at 45° C. for 30 min. In another embodiment the high stringent conditions comprise a step of washing the hybridized nucleic acid sequences with 0.2×SSC, 0.5% SDS at 50° C. for 30 min. In one embodiment the high stringent conditions include, for example, using a series of washes starting with 6×SSC, 0.5% SDS at room temperature for 15 min, then repeating with 2×SSC, 0.5% SDS at 45° C. for 30 min, and then repeated twice with 0.2×SSC, 0.5% SDS at 50° C. for 30 min. A more stringent set of conditions uses higher temperatures in which the washes are identical to those above except the temperature of the final two 30 min washes in 0.2×SSC, 0.5% SDS is increased to 60° C.
(52) Furthermore, in one embodiment the nucleic acid sequence is inserted into an expression vector wherein a nucleic acid sequence selected from SEQ ID NO: 61 through SEQ ID NO 121, is operably linked to the regulatory sequences of the expression vector to allow expression of the encoded peptide. In a further embodiment a nucleic acid sequence selected from SEQ ID NO: 61 through SEQ ID NO 121, or any of the nucleic acid sequences disclosed herein, is operably linked to regulatory sequences that allow the gene to be expressed and the nucleic acid sequence is transfected into a cell. Accordingly, one embodiment of the present invention is directed to a host cell comprising a recombinant nucleic acid sequence encoding for a peptide comprising a sequence selected from SEQ ID NO: 1 through SEQ ID NO 60, or a fragment thereof. In one embodiment the recombinant nucleic acid sequence comprises an expression vector operably linked to a nucleic acid sequence selected from SEQ ID NO: 61 through SEQ ID 121. In one embodiment the expression vector encodes a peptide selected form the group consisting of P3-orf1165 (SEQ ID NO: 1), P6D-orf00908 (SEQ ID NO: 3), P7-orf0262 (SEQ ID NO: 8), P7-orf0263 (SEQ ID NO: 9), P10B-orf01747 (SEQ ID NO: 15), P10B-orf1749 (SEQ ID NO: 17, P10C-orf01238 (SEQ ID NO: 19, P10C-orf01239 (SEQ ID NO: 20), P10E-orf00279 (SEQ ID NO: 21), P15-orf00945 (SEQ ID NO: 27, P15-orf00946 (SEQ ID NO: 28), P15-orf00947 (SEQ ID NO: 29), P18-orf00128 (SEQ ID NO: 37), P21A-orf00675 (SEQ ID NO: 39), P21B-orf01544 (SEQ ID NO: 40), P24-orf01679 (SEQ ID NO: 45), P28-orf01521 (SEQ ID NO: 52) and P29-orf0177 SEQ ID NO: 57). In one embodiment the nucleic acid sequence encodes a peptide comprising the sequence of SEQ ID NO: 3, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 122, SEQ ID NO: 123, SEQ ID NO:124, and SEQ ID NO: 125, and in one embodiment the nucleic acid sequence encodes the peptide of SEQ ID NO: 20 or SEQ ID NO: 124. The host cell may be chosen from eukaryotic or prokaryotic systems, such as for example bacterial cells, (Gram negative or Gram positive), yeast cells (for example, Saccharomyces cereviseae or Pichia pastoris), animal cells (such as Chinese hamster ovary (CHO) cells), plant cells, and/or insect cells using baculovirus vectors. In some embodiments, the host cells for expression of the polypeptides include, and are not limited to, those taught in U.S. Pat. Nos. 6,319,691, 6,277,375, 5,643,570, or 5,565,335, each of which is incorporated by reference in its entirety, including all references cited within each respective patent.
(53) In accordance with one embodiment a diagnostic assay for detecting a M. haemofelis infection in a patient is conducted using standard nucleic acid diagnostic techniques known to those skilled in the art, coupled with the nucleic acid sequences disclosed herein. More particularly, the nucleic acids sequences disclosed herein are used to detect the presence of Mycoplasma haemofelis specific DNA or RNA, including for example mRNA, in a biological sample recovered from the patient. In one embodiment a method of detecting the presence and/or degree of a M. haemofelis infection in a patient is provided. The method comprises contacting a nucleic acid sequence recovered or derived from a biological sample with a nucleic acid sequence selected from SEQ ID NO: 61 through SEQ ID NO: 121, or a fragment, a complementary sequence, or derivative sequence thereof. Detection of binding between the nucleic acid sequence recovered or derived from the biological sample, if such nucleic acid sequence exists in the biological sample, and a nucleic acid sequence selected from SEQ ID NO: 61 through SEQ ID NO: 121, or a fragment, a complementary sequence, or derivative sequence thereof indicates the presence and/or degree of a M. haemofelis infection in the patient. In accordance with one embodiment, the method of detecting Mycoplasma haemofelis specific DNA or RNA comprises the use of a standard PCR reaction and the nucleic sequences disclosed herein to specifically amplify any Mycoplasma haemofelis specific DNA or RNA present in a biological sample and allow detection of the amplicon using standard techniques. In one embodiment the PCR primer is 6 to 25, 8 to 20, 8 to 15 nucleotides in length and that has 90, 95 or 99% sequence identity with a sequence selected from SEQ ID NO: 61 through SEQ ID NO: 121, or the primer hybridizes with a sequence selected from SEQ ID NO: 61 through SEQ ID NO: 121 under high stringent conditions such as 30 min washes in 2×SSC, 0.5% SDS at 45° C.
(54) In one embodiment the biological sample represents nucleic acid sequences isolated from a patient's tissues, including a blood, plasma or serum sample, and more particularly in one embodiment the patient is a feline species. Absent the presence of Mycoplasma haemofelis specific DNA or RNA, the PCR reaction will fail to produce an amplicon through the use of the Mycoplasma haemofelis specific PCR primers disclosed herein. In one embodiment a kit is provided comprising one or more of the nucleic acid sequences disclosed herein as well as reagents and a positive control for conducting PCR reactions. In one embodiment the kit further comprises a thermostable DNA polymerase.
(55) In accordance with one embodiment a method of detecting the presence and/or degree of a M. haemofelis infection in a patient is provided. In one embodiment, the method comprises the steps of contacting nucleic acid sequences recovered from a biological sample with a nucleic acid sequence selected from SEQ ID NO: 61 through SEQ ID NO: 121, or a fragment or derivative thereof, conducting a PCR amplification reaction on the reaction substrate, and detecting the presence of amplified products, wherein the detection of an amplified product indicates the presence of a M. haemofelis infection in the patient.
EXAMPLE 1
(56) Mycoplasma haemofelis infection frequently causes anemia in cats. Despite an intense immune response and/or antibiotic treatment, cats that are infected with this parasite often remain asymptomatic carriers. To date, no immunoassay has been developed, due largely to the inability to culture M. haemofelis in vitro. As disclosed herein it is anticipated that our screening for antibodies specific for M. haemofelis will provide a sensitive approach for identifying infected cats, particularly carriers. As a first step, immunogenic proteins of Mycoplasma haemofelis need to be identified that can be used for development of an immunoassay.
(57) To identify M. haemofelis proteins recognized by the cat's antibody responses, two whole-genomic libraries were created in EcoRI predigested lambda Zap II. Chromosomes were digested to completion with EcoRI and partially digested Tsp509I restriction enzymes. DNA was size fractionated in an agarose gel and fragments in the range of 5 to 10 kb were excised purified and cloned into the unique EcoRI site of the expression vector. A prokaryotic (Plac) promoter is upstream of the insertion site. After plating on Escherichia coli in the presence of isopropyl-β-D-thiogalactopyranoside (IPTG) to induce prokaryotic expression, the M. haemofelis expression library was immunoblotted and probed with pre-immune and convalescent-phase antiserum from experimentally infected cats. The analysis of individual phage clones resulted in the identification of several genes (21 immunoreactive clones representing 60 open reading frames, orfs) encoding immunogenic proteins, which had been previously identified. Bacteriophage-mediated immunoscreening using an appropriate vector system offers a rapid and simple technique for identification of putative candidate antigens for development of an immunoassay.
(58) Materials and Methods
(59) Antisera.
(60) M. haemofelis immune sera was obtained from random source cats that were inoculated with cryopreserved M. haemofelis organisms. Samples were collected immediately before (pre-immune serum) and post-inoculation for a period of several months (immune serum). Polymerase Chain Reaction (PCR) was used to detect the parasite DNA during the course infection.
(61) Construction of Lambda Zap II Genomic Libraries
(62) High-molecular-weight (HMW) Mycoplasma haemofelis genomic DNA (gMhf), collected during the peak of parasitemia, was purified using QIAGEN Genomic-tip 100/G kit (QIANGEN Inc., Valencia, Calif., USA) according to the manufacturer's recommendations. Spectrophotometry analysis of recovered DNA revealed that the dialyzed gMhf DNA was free of contaminants such as RNA, protein, and metabolites, and had a A260/A280 ratios between 1.7 and 1.9, making it well suited for use in library construction as well as subsequent use for development of an optical map and for complete genomic sequencing. Two M. haemofelis genomic libraries were constructed in Lambda Zap II (Stratagene, La Jolla, Calif., USA) according to the manufacturer's instructions. Briefly, chromosomal DNA from M. haemofelis was digested to completion with the 6-bp (GAA TIC) EcoRI and partially digested with the 4-bp (AA TT) Tsp5091 restriction enzymes. The DNA was size fractionated in a 1% agarose gel; 5-10 kb fragments from digests were excised, purified and ligated (Stratagene) directly into EcoRI-digested restriction site of Lambda Zap II DNA followed by packaging according to the manufacturer's protocol. The recombinant phages were plated onto lawns of E. coli XLI-Blue MRF' (Strategene) in the presence of IPTG and XgaI to allow for discrimination of non-recombinant plaques. The packaged libraries were stored in 7% DMSO at −80° C.
(63) Screening of Libraries
(64) The resulting libraries were plated and amplified on E. coli strain XLI-Blue, in the presence of IPTG to induce prokaryotic expression. Colony blotting is performed using standard techniques. Briefly, the plates containing bacteria infected with recombinant phage are overlaid with nitrocellulose filters previously soaked with IPTG and allowed to incubate overnight at 37° C. IPTG is used to induce and enhance expression of cloned mycoplasma genes by the lac promoter in the phage. Each filter is marked, the plates are cooled to 4° C., and the filters carefully removed. Nitrocellulose lifts were screened for antigen-positive plaques by first blocking the lifts with TBS-Tween (0.01 M Tris-0.14 M NaCl-0.5% Tween 20 [pH 7.4]) containing 5% skim milk and 1% normal goat serum (Santa Cruz Biotech, Santa Cruz, Calif., USA) overnight and then incubating overnight at 4° C. temperature with either diluted pooled cat anti-M. haemofelis immune serum, purified cat anti-M. haemofelis IgG (Protein A HP Spin Trap, GE Healthcare, Piscataway, N.J., USA), or non-immune cat serum. The lifts are washed 3× with TBS-Tween and then a goat anti-cat antibody conjugated with horseradish peroxidase (Santa Cruz Biotech, Santa Cruz, Calif., USA) was added, incubated for 1 hour and washed as above. Positive signals are visualized applying 3,3′,5,5′ tetramethylbenzidine (TMB) (Sigma-Aldrich, Saint Louis, Mo., USA) on the membranes for 5 to 15 min or until the signal is visible and the background is still low.
(65) Reactive plaques were isolated and placed in centrifuge tubes containing 500 uL of SM buffer and 20 uL of chloroform and were replaqued using the same methods to ensure clonality.
(66) Phagemid contents were excised and rescued with using ExAssist helper phage and Eschirichia coli SOLR strain (Stratagene). The plasmids were purified using QIAprep Spin Miniprep Kit (QIAGEN), and the insert DNA was sequenced using phagemid T3 and T7 sequencing primers.
(67) The reactive clones were then sub cloned in E-coli SOLR strain using a helper phage (ExAssist helper phage, Stratagene) for rescuing. The ExAssist helper phage together with SOLR cells is designed for the excision of the pBluescript phagemid containing the insert from the Lambda ZAP II vector, while eliminating problems with helper contamination problems. The phagemid contents were excised and rescued according to the ZAP II instruction manual (Stratagene). Colonies appearing on the LB agar plates (with ampicillin) containing the phagemid with the cloned DNA insert were picked and put to grow overnight in LB media for purification. The purification was performed using QIAprep Spin Miniprep Kit (QIAGEN, Valencia, Calif.), and the insert DNA was sequenced using the phagemid T3 and T7 sequencing primers.
(68) Sequence analysis.
(69) After removal of flanking vector sequences, DNA sequences were analyzed using PHPH Web based tool (Togawa & Brigido, 2003). Comparison against GenBank nucleotide and protein databases was performed using BLASTn (Altschul et al, 1990), BLASTx (Stephen et al, 1997) and ORF Finder against the Mycoplasma genetic code on the network server at the National Center for Biotechnology Information (NCBI). In addition, Dense Alignment Surface (DAS) method was used to predict protein localization based on transmembrane helices (Cserzo et al., 1997). To determine whether the clone sequences have transmembrane proprieties, transmembrane prediction software as DAS and TMHMM Server were applied. Twenty one positive, immunoreactive plaques were identified; their inserts were analyzed using the software described above and results are summarized in table 1. The products of these genes are putative serologic and vaccine targets based on their reactivity with M haemofelis specific immune sera.
(70) Plasmid Construction
(71) Discovered clones from the Lambda Zap II expression library that encode Immunoreactive product were PCR amplified and Gateway cloned (PCR cloning System with Gateway® Technology, Invitrogen Corp., USA Carlsbad, Calif.). PCR products were cloned into pDORN™ 221 and transformed in E. coli strain OMNIMAX™ cells (entry clone), grown in LB medium with Kanamycin (100 ug/mL). Plasmids were purified (QIAprep Spin Miniprep Kit, QIAGEN) and sequenced to confirm the inserts were in frame. The inserts from the entry clones were transferred into the expression vectors by performing a LR reaction with pDEST™ 17 containing a His6-tag in the N-terminal end, as a destination vector. The pDEST™ 17-Mhfr recombinant plasmid were transformed into E. coli strain DH5α cells with ampicillin and purified as described above (expression clone).
(72) Expression and Purification,
(73) The expression clones were transformed into E. coli strain BL21-A1 cells plated on LB-carbenecillin (100 ug/mL) agar plates. Transformants were picked and cultured in LB medium containing carbenecillin, and the expression was induced by adding 2% L-arabinose, at 37° C. with shaking for 12-14 hours. Uninduced cultures were used as negative controls. Expression of recombinants was exanimate with sodium dodecyl sulfate-polycrylamide gel electrophoresis (SDSPAGE, 15%). For isolation, the cells containing the recombinant proteins were harvested, and the proteins were extracted in denaturing conditions using 8M urea and native conditions by applying 4 cycles of freeze at −80° C. and thaw at 42° C. followed by sonication and centrifugation at 10,000×g for 20 minutes. For purification, the pellet was resuspended in extractor buffer (His60 Ni×Tractor Buffer, Clontech Laboratories, Inc., Mountain View, Calif., USA) containing Urea (8M). The sample was sonicated (4 cycles of 5 sec) and centrifuged for 20 minutes at 20,000×g at 4° C. The supernatant was then applied to a His-Select nickel affinity gel column (Clontech Laboratories, Inc.) using the protocol recommended by the manufacturer. The concentration of proteins was determined spectophotometrically and analyzed by SDS-PAGE for determination of purity.
(74) Western Blot Analysis.
(75) In order to confirm the immunoreactivity of recombinants, the proteins from the SDS-PAGE gels were transferred to a nitrocellulose membrane using a TRANS-BOT® SD Semi-dry transfer cell (BioRad Corp., Hercules, Calif., USA) for 1 hour at 10 Volts. Western Blot analysis was carried out using dilutions of the cat immune and non-immune serum against M. haemofelis. Goat anti-cat conjugated with horseradish peroxidase (HRP) was used for detection of bound antibodies. Proteins were visualized with TMB (Sigma-Aldrich).
(76) Results
(77) Construction and Screening of Lambda Zap II Genomic Libraries.
(78) The titers of the unamplified EcoRI and Tsp509I libraries for M. haemofelis were 1.1×10.sup.6 PFU and 1.4×10.sup.5 PFU. Following the immunoscreening, the strongest positive clones were grown up, phagemids were excised, and the inserts sequenced. The inserts were given an identification consisting of the letter P (plaque) and a number according to the order of discovery (eg. P5). If more then one insert was selected per plate, letters were added to the clone identification (eg. PlOA and PlOB). The clones selected from the plaque lifts and putative genes (ORFs) are summarized in Table 1. Twenty-two reactive clones were selected containing a total of 60 putative proteins. Sequence analysis shown that 26/60 putative genes discovered coincided with M. haemofelis sequences deposited in the GSS database (Berent & Messick, 2003), and the remaining 34 were never described before.
(79) Sequence Analysis and Plasmid Construction.
(80) Most of the inserts, when analyzed using the ORF finder tool contained several possible putative genes. The ORFs were given an identification number following the plaque name. The sequence analyses of each ORF are also included in Table 1. Based on the sequence analysis and protein characteristics such as transmembrane proprieties, sub cellular localization, and presence of signal peptide, 22 sequences were selected for plasmid construction for expression and western blot analysis. The selected sequences are show in Table 1.
(81) TABLE-US-00001 TABLE 1 Immunoreactive clones of Mhf in ZAP II libraries Accession Sequence similarity- Clone ID number BLASTx against the Mollicutes E value P3-orf1165 GS928052 ACQ84443.1 adhesin 0.002 [Mycoplasma hyopneumoniae] P5-orf01816 GS928053 NP_853366.1 thymidine 0.37 phosphorylase [M. gallisepticum] P6D-orf00908 GS928054 ZP_06610317.1 hypothetical 0.44 protein MALL_0643 [M. alligatoris] P6D-orf00909 GS928055 ZP_06610593.1 hypothetical 0.63 protein MALL_0515 [M. alligatoris] P7-orf00259 GS928056 ACU78513.1 triose-phosphate 8.00E−36 isomerase [M. mycoides] P7-orf00260 GS928057 NP_073101.2 phospho- 9.00E−128 glyceromutase [M. genitalium] P7-orf00261 GS928058 BAH70152.1 hypothetical protein 0.026 [M. fermentans] P7-orf00262 GS928059 NA P7-orf00263 GS928060 ABD47695.1 adhesin-like protein 1.4 P146 [M. hyopneumoniae] P7-orf00264 GS928061 AAZ44718.2 conserved 0.22 hypothetical protein [M. hyopneumoniae] P9D-orf01202 GS928062 ZP_06610215.1 type I restriction 2.00E−15 modification DNA protein [M. alligatoris] P9D-orf01203 GS928063 YP_003303059.1 type I 0.005 restriction enzyme specificity protein [M. hominis] P9D-orf01204 GS928064 ZP_02931536.1 type I restriction 4.00E−10 enzyme S protein [U. parvum] P9D-orf01205 GS928065 YP_003303059.1 type I 2.00E−12 restriction enzyme specificity protein [M. hominis] P10B-orf01747 GS928066 YP_002284694.1 putative 3.1 lipoprotein [U. urealyticum] P10B-orf01748 GS928067 YP_003515875.1 hypothetical 0.17 protein MAGa7180 [M. agalactiae] P10B-orf1749 GS928068 NA 1.1 P10B-orf01750 GS928069 YP_003560289.1 hyalurono- 1.1 glucosaminidase [M. crocodyli] P10C-orf01238 GS928070 YP_002000188.1 massive surface 0.004 protein MspK [M. arthritidis] P10C-orf01239 GS928071 ZP_04563876.1 transcriptional 0.002 regulator [Mollicutes bacterium D7] P10E-orf00279 GS928072 NP_757929.1 hypothetical protein 3.00E−50 MYPE5440 [M. penetrans] P10E-orf00280 GS928073 NP_975564.1 pseudouridylate 1.00E−41 synthase D [M. mycoides] P15-orf00941 GS928074 YP_002960937.1 hypothetical 0.0024 protein MCJ_004270 [M. conjunctivae] P15-orf0942 GS928075 NA P15-orf00943 GS928076 ACU78785.1conserved hypo- 0.28 thetical protein [M. mycoides] P15-orf00944 GS928077 AAO39838.1 AvgC variable 0.17 lipoprotein [M. agalactiae] P15-orf00945 GS928078 YP_002000023.1 massive surface 0.63 protein MspF [M. arthritidis] P15-orf00946 GS928079 ZP_02695921.2 hypothetical 1.8 protein UUR13 [U. urealyticum] P15-orf00947 GS928080 ZP_06610731.1 conserved 0.37 hypothetical protein [M. alligatoris] P15-orf00948 GS928081 YP_279005.1 lysyl-tRNA 0.63 synthetase [M. hyopneumoniae] P15-orf00949 GS928082 NP_758309.1 phenylalanyl-tRNA 0.48 synthetase subunit beta [M. penetrans] P17A-orf01526 GS928083 CAB62239.1 P75 protein 0.28 [M. hominis] P17A-orf01527 GS928084 ZP_04564868.1 conserved 0.002 hypothetical protein [Mollicutes bacterium D7] P17A-orf01528 GS928085 ZP_02971377.1 conserved 0.37 hypothetical protein [U. parvum] P17A-orf01529 GS928086 YP_016078.1 hypothetical protein 0.37 MMOB3810 [M. mobile] P18-orf00127 GS928087 NP_757967.1 hypoxanthine- 6.00E−07 guanine phosphoribo- syltransferase [M. penetrans] P18-orf00128 GS928088 YP_002000162.1 hypothetical 0.13 protein MARTH [M. arthritidis] P20-orf00326 GS928089 NP_757466.1 DNA-directed 0 RNA polymerase subunit beta′ [M. penetrans] P21A-orf00675 GS928090 NP_757933.1 translocase 3.1 [Mycoplasma penetrans] P21B-orf01544 GS928091 YP_002000128.1 massive surface 0.044 protein MspH [M. arthritidis] P21B-orf01545 GS928092 NP_757749.1 hypothetical protein 0.057 MYPE3620 [M. penetrans] P21B-orf1546 GS928093 YP_001256183.1 hypothetical 0.097 protein MAG_0390 [M. agalactiae] P21B-orf01547 GS928094 NP_975173.1 hypothetical protein 1.1 MSC_0170 [M. mycoides] P21B-orf01548 GS928095 YP_001799373.1 hypothetical 0.13 protein PAa [C. Phytoplasma australiense] P24-orf01679 GS928096 YP_002000015.1 massive surface 1.13 protein MspC [M. arthritidis] P24-orf1680 GS928097 NA P24-orf01681 GS928098 NP_758083.1 hypothetical protein 0.28 MYPE6950 [M. penetrans] P26-orf00285 GS928099 NP_853008.2 translation 8.00E−129 longation factor Tu (EF-Tu) [M. gallisepticum] P26-orf00286 GS928100 NP_757969.1 adenylosuccinate 4.00E−110 synthetase [M. penetrans] P26-orf00287 GS928101 ADC31594.1 ribosomal 2.00E−31 biogenesis GTPase [M. gallisepticum] P27A-orf1350 GS928102 YP_002000022.1 massive surface 2.00E−03 protein MspE [M. arthritidis] P28-orf01521 GS928103 YP_002961131.1 hypothetical 0.130 protein MCJ_006330 [M. conjunctivae] P28-orf01522 GS928104 YP_016010.1 SWF/SNF family 0.630 helicase [M. mobile] P28-orf01523 GS928105 ZP_04563267.1 conserved 0.220 hypothetical protein [Mollicutes bacterium D7] P29-orf00175 GS928106 YP_001621362.1 ketose 5.00E−102 bisphosphate aldolase [Acholeplasma laidlawii] P29-orf00176 GS928107 NP_072863.1 co-chaperone GrpE 4.00E−22 [M. genitalium] P29-orf0177 GS928108 NP_758284.1 heat shock protein 2.00E−69 DnaJ [M. penetrans] P29-orf00178 GS928109 NP_109915.1 elongation factor G 0 [M. pneumoniae] P32C-orf00088 GS928110 ZP_03079605.1 arginyl-tRNA 7.00E−75 synthetase [U. urealyticum] P33B-orf01097 GS928111 YP_002000188.1 massive surface 0.057 protein MspK [M. arthritidis]
Expression, Purification and Western Blot Analysis.
(82) The selected sequences, except for two, were PCR amplified and successfully gateway cloned. The expression was achieved culturing the recombinant BL-21 cells in 250 mL of LB media with 100 μg/mL of carbenicillin and inducing the expression by adding 20% L-Arabinose. Expression was checked by SDS-PAGE comparing between times before the addition of L-arabinose (T.sub.0), and after growing 12-16 hours with L-Arabinose (T.sub.F). The fusion proteins were western blotted using a goat anti His-tag (Invitrogen) as primary antibody to ensure the overexpression of the desired proteins.
(83) Eight out of 20 clones successfully expressed the fusion proteins and were selected to western blot analysis. Not all of the recombinant proteins were positive for the western blot probed with convalescent-phase antiserum. However, 4 fusion proteins (P6D-orf00908, P10C-orf01238, P10C-orf01239 and P10E-orf00279) were shown to be western blot positives when probed with convalescent-phase antiserum, and negative when probed with serum from SPF cats (See
(84) The western blot reactive proteins were fragments of the clones P6D-orf00908 (position 1-65), P10C-orf01238 (position 85-255), P10C-orf01239 (position 538-687), and P10E-orf00279 (position 1-159), with calculated sizes, including the 6 histidines (histag), of 18.65, 20.52, 17.49, 19.07 KDa, respectively. The fragment of DnaK (position 319-603), used as a control, was also reactive when blotted against convalescent-pooled serum and negative when blotted against serum from SPF cats, and the calculated size was 31.75 KDa.
(85) Discussion
(86) When M. haemofelis infects the cat, it elicits a spectrum of parasite-specific antibodies in the serum. Based on the hypothesis that detection of antibodies to M. haemofelis is a sensitive approach for identifying infected cats, particularly carriers, our objective was to identify, sequence and characterize genes encoding antigenic determinants of M. haemofelis. In order to achieve this, we used pooled sera from cats, collected at various time points throughout the course of experimental infection to perform immunoscreening of an expression library of M. haemofelis. Thus, immunogens expressed early in an infection, during parasitemia and in chronically infected cats could be potentially identified.
(87) It is likely that many of the proteins encoded by the genome of M. haemofelis perform routine functions and are conserved across the different species of hemoplasmas infecting cat, including ‘Candidatus Mycoplasma haemominutum’, ‘Candidates Mycoplasma turicensis’ and possibly others. This feature makes them less attractive as targets for a serologic assay to diagnose M. haemofelis infection—the specificity of an assay using such antigen(s) would be decreased. To select more suitable candidates for antigen screening, various approaches have been suggested.
(88) Since M. haemofelis cannot be grown in culture, only crude antigens preparations from blood of an infected cat can be obtained for electrophoresis-based methods. Several groups have reported contamination of hemoplasma antigen preparations with erythrocyte proteins, immunoglobulins and other host-derived blood proteins. Thus, the construction of expression libraries as a tool for detecting immune reactive proteins of M. haemofelis was the approach taken in this study. Once constructed these libraries it also could be used for sequencing and to study other genes, including those that don't encode for proteins that react to immune sera.
(89) Applicants have successfully prepared a library of M. haemofelis DNA and have identified potential immunodominant antigens of M. haemofelis. M. haemofelis was harvested from blood of an experimentally infected cat using standard detachment, filtration, and centrifugation procedures. High-molecular-weight M. haemofelis genomic DNA was extracted and then purified by drop dialysis. Whole-genome sequencing was performed using GS-FLX (454) and Titanium chemistry to sequence a paired end library. First pass annotation was achieved using blast2GO and Manatee annotation tools. Genomic features of M. haemofelis were typical of mycoplasmas, including small genome size of 1,156,468 bp, low G+C content (38.8%), as well as the codon usage of the opal stop codon (UGA) for tryptophan. The gene order for rpmH, dnaA, and dnaN was conserved with the origin of replication in an untranscribed AT-rich intergenic region near the dnaA gene. 16S, 23S and 5S ribosomal RNA genes were located within the same operon as single copies. 55 membrane proteins were identified, including 9 lipoproteins as well as proteins involved in transport of biomolecules, DNA and energy metabolism, protein synthesis, and others.
(90) Twenty-one immune reactive clones were identified in the expression libraries of M. haemofelis constructed in this study (see Table 1). Once sequenced, the correct open reading frame (ORFs) in the inserts were determined using a mycoplasma condon translation, where UGA is used to incorporate tryptophan rather than a stop codon. These predictions were verified against ORFs in the genome of M. haemofelis (data not shown), allowing for more confident translation of genes into their corresponding amino acid sequences. The amino acid sequences of these deduced peptides are represented by SEQ ID NO: 1 through SEQ ID NO: 60.
(91) In this study, genes within inserts encode proteins necessary for diverse cellular functions and adhesion, along with several novel genes of M. haemofelis. Since there are often multiple ORFs within a given insert, selecting which gene and specific regions of these gene(s) code for immunogenic proteins is the next step. An array of web-based tools for the prediction of antibody epitopes in protein antigens and T cell epitope mapping of discovered proteins with tools recently developed for the cat will be used to select potentially immunogenic regions for further testing. In addition, analysis of proteasomal cleavage is likely to improve immunoinformatics screening for these epitopes. One of the last steps in this process will be to determine if only immune sera to M. haemofelis recognize these epitopes.
(92) Of the 4 antigenic targets discovered herein, BLAST results showed that at least 3 of them are not represented in other organisms in the GenBank databases. Moreover, all the proteins were not find in the Mycoplasma suis genome (Accession number ADWK00000000.1; the only hemoplasma that has been sequenced other them M. hamofelis), supporting the hypothesis that these proteins might be unique for M. haemofelis.
(93) Although UGA in M. haemofelis genes serve as a stop codon in Escherichia coli, 21 positive clones were identified in the expression libraries we constructed. Nonetheless, every ORF revealed the presence of UGA codons suggesting that truncated proteins are expressed in this system and at least some of these are antigenic. Protein topology analysis revealed that many of the proteins identified herein are located in the membrane, however several were cytoplasmic. It is possible that the latter genes are not coding an antigenic protein. However, several previous studies have reported cytoplasmic proteins were immunogenic. It was postulated that cytoplasmic proteins are exposed to the immune system after destruction of the bacterial cells.
EXAMPLE 2
(94) TABLE-US-00002 Immunogenic peptides of M. haemofelis >orf1165 (SEQ ID NO: 1) MSALAPLKLAGLSCLGVGGTCSVVYAGSSWVSGVSSLETDDDNVIQTVAD KFSNRLIGKGKTSIWNARLQKLRSAGNSKQLDAGLKAIKDDTNKKDTDLQ TWCEEAKIKPQEGEGSKLIVEGVQDYCTYTIKDQANGTMSKTKTNVSDWK EVNTAFSKMKRDSLSKDLQAVWDKVKDKTDTSGDLKDWCFKKYDEPFEGR DSATYKDVVKVCKTVPKPAAAKPAAAKPVASKPSSDSKQVAGTEPTSPAP TKQAGDI* >orf1816_1 (SEQ ID NO: 2) LDMSTLLKGSLGLLGAGSATTAGAIYLGTDIFKSKEDKKVSISKLLKTSN PEKRLITSSQASDGDWKEAWKNYRVANKGKKLNEDEWKLSGWVTPQDGNI TNTENASDSFMNTCSINKDKEVSGTDDPLYKAVLVYCTRSTLVSDLISDN YPNKKILTSANNDDAGWKEAWTQYKTDNSGKSTQNSDAWQLAGWPTSTPD TVLESFKTKCGEKVKVATFKTDNEDYTNAVKWCTK* >orf0908 (SEQ ID NO: 3) VKAASGLGVAAATVGGGIFVAKGMEGSPSTPKSTVQDKLKQNGYSPLDLE KSDGWSEVLEAYNQHKNNPSIRFDHGDREISEQELKDACSSAFNSDDKYE NAKRWCVVPYSVSQVLTSKSLKVLNVNDTGDDDQDDQDEWDNLKGQYQEN AIPGLVLKSTEDWQSLRTKCKELVEKKPWSDGYEDSISHATRWCTHAFVN NSDS* >orf0909 (SEQ ID NO: 4) MEPLKLAFLATGAGATGLGTYGLYSHLSGSQKENVGTRLVSESFELLNDS HKAQWKTSLEKYNGKKDANASNIDETKLKAICKSLISKDKTSEADYKKAK LYCVVPQGVSERLSKLGFKVLNTSDTTHQNEWTKLATSYVTNGKGDKQIE SLTLTTPSGSTDNNWSTLKENCKTILGKSHWEESFDSYFEKSKMWCTEEA FNSLPKEKQ* >orf0259 (SEQ ID NO: 5) MKIVFGNLKMNFLYKDFQDYIENLRMKFLGETPKVHLGLAIPYIYLKSAS ESIGSKIKVLAQDLHPVDFGAFTSSVSAAQLASLNVPATLIGHSECRQLS QNSFVISNKIKSALRNGLEIIYCCGEDPEKEISEELFFMTEEEISKVIIA YEPISSIGTGQAMDPSGADSTLLKIRDLIADKYGRKVADSMKLLYGGSVN LSNYKGYLEKKNIDGVLVGGASLKVDDLWKMATLE* >orf0260 (SEQ ID NO: 6) MDGWGLTSESKGNAPLLAKTPTLDFLYKEYPNSTLSASEEAVGLPAGQMG NSEVGHINLGAGRVVYTGLSLINKCIKDGALESQPAVVEFFDLVKSRGSK LHFLSLISEGGVHSNMNHFLAFADICVKRNQPYILHAFTDGRDVSPNAAK TDFIPIVQKLKDTNGKLGVVSGRYYSMDRDKNWDREEKVFKYLVGSDKSR TFDDVLVYIEQSYASGVTDEFIEPAICSSSLDSVIGDNDVVVFLNFRPDR ARQISHMLVGSKGLYDYEPSVKLNNVSLFALMDYEKINLQNTLFPPFDIK NTLGEFLSNNGISQLRIAETEKYPHVTHFFDGGKTLDYPKMKKILIPSPK VATYDLQPEMSAPKITEALLPELKNFEVVILNFANPDMVGHTGSLEATIK ACESVDTQIGKIYEEVQKLGGVLVVIADHGNAEVMITADGSPHTAHTTNL VPFIVCKKGVTLRNDGVLGDIAPTLLSLLG LKQPVEMTGKVLVS* >orf0261 (SEQ ID NO: 7) MGKLVIFHKELRPDLSFFESFNHIEGVYFLSSDFKLYRFTDSLLVFFPPY RVFNNHKIFKAGEVFVDCSQDSKDKYCSFSISPKSLSIPDCYNISTDSLG ELDALIIDFEGSFIKESSLVRYSQRKLHFIRHTEINVRSYFYIEKVKKYL VDRDLAINVFDSFSISEGFKSFERMPALRNFKSSGNAELSKFDDLNLDVF DFCERKPDTSFKEESFFDSDEKIDPYYLEQLFKDPEFFKEIEKAKLSRIE ETHKNDYLSRIEKAIRRSRALSISVPEYNYPTAPFDSFPENLNYLREIEN FNEQEESAFKHIDLYTSYVSPMPLGRGVFIFRDLEELFDPYKGTINIPDI EDEIEIMNAYIDEALDFYFKKEISEPPYFSWEE* >orf0262 (SEQ ID NO: 8) LLVLHKLFFSGEVRRFRNLLLEIEVQGFINICIHNLYLILYIRNIYGSFI WIK* >orf0263 (SEQ ID NO: 9) VGGTKTSSSSATGSSCSSNDSSWTISCSSSINYSSQEK* >orf0264 (SEQ ID NO: 10) MEDEQEIVQEESLEEQEEPVAEEEEVFVPPTLEEVYDKSLFDNFSNLFYV RTAPPSHFNWFLSPFVVHVFEFLTSLRRDRAMVFSHEENFDSQPIRDKYL KDLSFLKSIEKYTHFPRFDYFISPFSYEYEKMFWTFTPYKKTMFTIQDSL FFLNSEPFGPQGRCMFWESHALNHPEECQAYIRRIEIEVKNKYSALNRAY EVFNRDLYGEYEDDFSMLDCPDINLGKFDKKARKEASKKVWYESEPPEAE IERHQEPKK* >orf1202_1 (SEQ ID NO: 11) VSFKSFISEDENVRYFRLGDVCKIYAGISFKSSFYRDRGFPIIKTRNIQD NQIVTGDLNYCDLANHKDAMIIKHGDVVMAKDGSCCGKIGINLTDEEFLF DSHVLQFIPNEKLLIKRYLYHFLLSCQDKIRELAVGSAIPGIRKSELEKI KIPVSSLEVQEKVASTLDKFREIEREISLRDKQYEYYRNYLIMGSHDSH* >orf1203_1 (SEQ ID NO: 12) LSIQADIASKLGKFQELKEELKEELLLRKKKHNYYRRQIWKTHLNGVQGL KL* >orf1204_1 (SEQ ID NO: 13) VFKGFLKAEVREFLLEDVCNIQNGYSFSSSKYRSTGHPIIRIGNIQGTQF KVEDLVYFERDDYKEDLSRFIIKPQDLVITARGSCGKVALNKTDSSFYLN QGVWRLDPNPLFLNREYLFYFLSNSDLSSMVIKGHIPRLNVNSI* >orf1205_1 (SEQ ID NO: 14) VSFKSFLSESKDVKHLKLKDVCKIIAGKRFTPYTSEGMPVLRSGNIIDGY VVDEDFVYCDREKHPRVDTVKYGDILIVRFGSAGVVGMNLINREFFLDAN LSKFSPDSKILHKQYLYHFLLSRQEEIKGWARGAVIPAIRKSDLEELMIP VPSLEQQQTIASKLDKLVELKRELILRKEQHSYYRKQIWEACSNGCSK* >orf1747 (SEQ ID NO: 15) MSLLTKSALGFAAAGTTAAGAAYAGGLFDGKEKEKTSISKLLQSLNPEKR LIMASEGSDPLWKEAWKNYKVKYSGKGLDPLKVLSGKALASDESAPADFM SSCKDLFDVKVVDGKDDSYQLVLNHCTRLTLVSDWIADRGHELVSQTEGD ATIWKDLWKKYKDAGKNAWSVSEYSSYQDG* >orf1748 (SEQ ID NO: 16) MTPLTKAASATAIAGTAATGGIYLGTDLFKDKKVEIASLLKTAYPNKRLI TSKTVSDDAWKKAYKAYREANKDKTKDIWSLKDWTKPQATVEETNATDDF ISKCNSNSKLSVVGKDDPLYKQVLAYCTRDTLVSDLISEYGKGKKLLSKD GSDQDAAWKAAWNVYKTRNKDKGENLDPWKLNNWNTKKSGDELPDNYKDK CVEYSKKAAYQLEDENYKNVLDWCTA* >orf1749 (SEQ ID NO: 17) MTSLSKAALGFSAAGTTAAGALYMGGAFKGEEEKPVKTAISKLLKELNPK KRLIESSVQASDAIWKAAWKAYRTKNKDSKVGEDTWKLKGWTTRSNEAQI TEEEAPPHFIQACSDNGKEEVIGINDDLYKEVLEFCTRDVSIKDWISDAG RSAIGKEDTEGWKKTWKLYRAKNKDIAAGQDTWKVSSWDPKTTSDDNVVE DFKTKCTSKLDLKSSDSSFDEEYPRVLEWCTK* >orf1750 (SEQ ID NO: 18) LRDSWGDMTALTKAASATAVAGTAAGGGIYFGTDLLKSKKVDISSLMKEV DPQKRFITATSTGDDSWKAAYKSYRESGKDVWGLGVKTASPETLIDATTE FLAKCKSNGKVKVSGKDDPLYKQVLAYCTRDTTVRDLIEEGKTGRKLLDS SDTGNDKESGWEDAWTAYRTKNHVEGGTSQNTWEVEGWDNKKTGNTLPTD YKTKCAEKAKQPAYRLEDENYKNVLAWCTK* >orf1238 (SEQ ID NO: 19) MINKGIAFTTIFLSGSLYSFGSFIHDWQDYQFQQVEGSGILQDKRRGSFL RGELPFTPSFRDRLAPSHIQKTSFQQHKHLFAPEMQKYLTEVNEEDIKEG HYSSKKKELLDLIHYKKEWILTSDKEISYKSGYFQEKLNNFGDNKLVQDI LWSLVEESQVNATLIRPESITINFKREKVGYQKNPLLDKSDVIKNLHIKF RIFNPNRQKTFVFKSIEIDPTSETDVEITLREGELKPVSTALAALAAHKL SASSWSIFPIEEGFKVTKEVVYPNKVKTQEHKDSLFLLYNSSRFFEKWVG NPRSRSVSTHTHSLVDYEYVRKSLSAKLVNITTDQVKKDIERWYGSFTAF ILRTKIEDMINLINLLQKNTFFDKRGNKVSVVDNAINDFTFRHNLYNHFQ FDSNLRKVLDTLFLQNKNKPELKITVKEAKALLNSWVYQLEQIKDSIRIE LKWEKEPQKTNADLGYENIYPAFSYKFTQKFVFTKEVKIPLKGTYNTTEN KFEEATTETENKHKFDLSNRLKNVKVFLTPISFLFNSMNGGSIGGVSIMD VLIPDVANFVDLESLTIDANQEIKNTYESKNSPITLAIGGEEDMQKIHFP GTNIGWKSLDVTHSQDLSKFTKLFYKLYEKFDTYKDKSNQALGALQLLKE NSRLKADPISFIAHAINSLFDKNYLQSKVSEESKRPWPVFFNSLLGKPLD FKSRQLLTGLSSLFFEWDKEWDSKSEEDKCDGQGQGQGQEKYYCTKFSLK NSRKKQILPNSEETKNVTQKFFPTYSSYFPEKPVVFGTTDDTTAYDAFLA KEGKSSIGLVNNYTKLKEVFKSRFEKDPNFFPSNKEINWNNAKVSYVRLD LEKAIKSVLALENTAYGGLGLMVSAVGIEFHKILGEALVRDGFWINMNLM DEKGSFWTIEHPIKHMFYSPFSESWLFVKPDLDHTKLELGTFSTKRK* >orf1239 (SEQ ID NO: 20) VFFILPSRRKLAIGAGGIFFASGFIYFRVAEKEPFEKIEGSLPLRNKNKL NFQDKQLSLQGFLKQDHLYSQNYQVFDPSIRKYLEIPISPRRVEESGNLF KAFNSLKGWNRTASTISDRDLSYRDNPFIGGVNSLKKEEIIRDILESILD ESEYLSTLIRADSIKIEFKKEEGFSLVKDFNLRLRILNPRKRKAYLFKSI EIDPLSENDIHISLSQSEIKPTTVSVNLGHSKQISWSLFPKDSAWKITKI THSPNHRKTEETKFSLPLIYGTSAALKDLQELLPRKEVDHPFPIASSLDY GYVREKLTPLLVNISENQMEKDIEAWFGAHKAHQIRVYISDLQNLIEMFK KRSFLDKNGRKASLIEMVMKSHTFKDGLYNHMKLSSSYRKVLDSLLTSEG KELKLTEEECYALLDSWSYQLKQMQDSIKISITWDEKPKRVIQPLGYTSP YPAVSFKFKQKISFEKAVKIPLNGSWDSSQKKYDASSGDQKFDITKRLSS LGTILAPIRSVFKEMGNGGSFMGADIFDVLMPDVSQFLGIDGLEIDANEY IENIYEASNSPIGIAIGDSEDYQGINIKGKNIGWKALDVSSSINLANFSK FFYKLYEKIDTYKDPSNSALGVSQLWNFTTLLQQRPISFIIHAIHSTFDH QYLKSGNSTSEDKRPWPVFFKSLFQDPITLKHKQVFVGYSGAFFDVKEWF RSETKSSEQYSTSWDISTKKQRDEWEILSPKNEDVALINQKFALNYSSFS PEQPIIINSEENKSQYDAFLAKEGSTSIGLVNHYDRLKSVFRDNNKSNIY YPNIDWENMKVSYAQLNLEKAIKSVLAIRHTFQGFSSLTLTALGIEIHKI LGEALIRNPFWINMNFMKEIGSWSKNEIPFKYMSYSVYSEESLYITPQLD KTKLNLGRFIKL* >orf0279 (SEQ ID NO: 21) MDGQEKGKKDIANDPEVRKELEAYEKYILQQKHEIFNRIILNAIHTLKIQ QPIISCCKRIDLSSLPGFNEETIGQLLGKDGQHKQHFINLTKVDLQVDQK CPNHGIVLSKYNSVNVEKAVELVKKLLELKSWNLEKMKSLYEKVNKEFED KCNKIGGQWLEQFLGYENYPDFLATHVGTLQFVYSFSQNILEHSIEVAQL SANIAFQLGLDPLKAKRAGFFHDIGKAKANLGDHVDEGLKIGQEANFEEY ILNAIESHHGRVPPNNPYSIIVKAADKLSAGREGARPRQIELIDKRRKMI EDKIMSIPWIEKTIIKNAGNLIQIFIKPAEFHGDKILEMKEEVRAKLKEL KAEYSYNYQI EFHLVFKEEFKFSE* >orf0280 (SEQ ID NO: 22) VSSYSIIFENKNFLIVNKASGIAVHKNIYDREFNLINEVNKDQKANYSLV HRIDKYTSGAVLIAKNKETLLLLQNLFLNNEVEKHYLALTSKELPAKKLK ITLSLGRSKNDKLRFTNRNAKNYKPACTEVEVIDRYFLKILLKTGRTHQI RAHLFSINCPVLNDPIYGNRCFNPEFGQYLHAYKLEFTCPITNEFISVTA PLPQEFKDKLSELNIEYTE* >orf0941 (SEQ ID NO: 23) MALAGATGAAGGGVLVHKLINKGEDTKSNTISNHIKPEYLLTNTHASQWT HRLNLLGKAQETDLSEALLSFKKGKSSLTTEDLKGWCESSLKSEFKSKED KKFLNTRLYCGLNMGDSIQENKVSSTTENGNTGLKSQFEKLKTKKVTELV SALFAIKDKNNADSSWEGNVALKDWCTKALDMPMEEGLTYDNAKEYCVLT AS* >orf0942 (SEQ ID NO: 24) VAAVPVAANAPNPFKSDVFMTKRVDKYKTPKLPCKPFHLY* >orf0943 (SEQ ID NO: 25) MKTSLLKGLGAFAATGTAATGGFVAWKQATKPTDVKSRLVWEGLTVADVN GKGVWGAIYLAKKDVSGFLDFATTKDNKETASAQLKKKCSELFNVSAGDE KYEESYEKAKKWCLNPELTTIEIQFEFEDREFASGDDDFKNLFTLYKGTS SFVDVVKTSARDFTAQTALETAKGNVQTWCNSMKSKSPKGDDLKNAISWC TKPESNFKSFMEKKGFRLLADGEWGNHFSSLKSKGGDTALDGDIKSETGS DDGSKLKSWCDKKNVGTVQIHTLSADLEKIEGRCFVRK* >orf0944 (SEQ ID NO: 26) LIWDGLSVADSKSLGVYKAIYLANSDKAGFSSFVSASDKEKAAPLLKTKC DDLLGISASSDKYAQSLEEAKKWCLVPKKTTIEISLLVDGMELSSADDDY KNTFALSRSSQDFINAIKKGSDGLTTSSDVNTGFSKVKEWCAEVIKKSAF DKDAQNAKLWCVKPDSKLGDFMDKQGFKPVESTGWDSHFTSLSSDNTLTS DMSSVSGTEGNGNKLKSWCEGKNLANVQIHTLLTDLEKIKSRCFVRK* >orf0945 (SEQ ID NO: 27) MSSALVKGLAGVSAVGGVSAGGFFAYKNFQSQNIRDVLVGKGLTVANVNS VGAWKVIAMGNKDNDAFFTFLGITKTSDRKVAGSKLQERCGSILNASIKD ENYSSLLSKAESWCIQPTPKNLEEQLLMDELETDLSDDDFKNVHKILAQD KAFTDAIEVTKGTESDGYKKVKKWCEVELKKPANSPKDAAKSRCATPFKN LREALNSGGLSLISSAEDWSSRYSSIKGTDTSLSSDQITDSDGKGGTSLS TWCSTEVDKKIHELTSNYTEHLDKVKKRCVTVKL* >orf0946 (SEQ ID NO: 28) LNLNLEGKASKLAWGLGIVGSLVLIISSIYWISPTVQDSLEDQELQLISK SNESIDLYKRSFKRHKNTLISIGVDDFINENTVEDEGSVALHIWCDANLR SKRWLVNLDGYKRFCALSMGDVLWLDKKDEGIINSHRFFILEEEDKRFSS RLFSKFGLTWKNDKHIDNYEIWKSRCESELSEPYSYLNKHLKTDIKDNC F* >orf0947 (SEQ ID NO: 29) MNTLAKGAIALTGAGGAAGGGFLISQNLGKTDTIANHIKKEYLLTSEQTD KWNHRVGLLKKAQEGGLDSSLLPLKKEGLTNSELQTWCANQLKEKFEGLG SNKFLNVRLYCGLNMGNKIAGNKVSSSTSDSENKLATNFGKLNGKTEQEL GSALLEIGKKTNQSSGWEGNKALKEWCLKTFDLAFEETSKDYANAKTYCV LV* >orf0948 (SEQ ID NO: 30) MEISGLFKAFLALAGVTGAAGGGVLLHKVINKDTISKHIDPKNLLTSAQQ DKWTHRLGLLNKAADTDLSKDLLSAKKSKTTLTIDDLKSWCASNLESEFL GTKDKKFKNIKLYCGLNMGDKIQGTKVASTTGGDNSSLKTNFGKLKNKTS SELVSQLFSIRNADNTNSPWSGSTSLRDWCLSAFDMPFESGLTYDNAKDY CVITD* >orf0949 (SEQ ID NO: 31) MSAKTTLLKGLGASATAGTVATGGFFAWKGLSQTSDITSRLTGEGLSVAD VNKKGPWRVIYLTKKDVEGFSDFVDASDQENAVSQLQKKCSELLSASPQD ENYEKSYEQVKKWCVNPELKTIEMQFVFDEREWAAAGDDFKSLFTLHQND GNFINAVQSSTGFFNASMVLDEAKTEVETWCNSLKSKTPEGDDLQNAVSW CTKPESNFKSFMDKKGFRMLNESEWASRFSSLKGGQDSDLSTDVSDDDSD GSKLKGWCEGKKLDTVQIHTLGSDLNKIEARCFVKKE* >orf1526 (SEQ ID NO: 32) MELSFAAKMSTGAIGAGSIAGGGAFAAYKFLNQETIEKYLNSLHRELATS NEDWELIKNNYAADKEDNPIPNIPKASIGDKLNDLKKWCSDHLNEEFSQE KASKGDYNLIQSWCTKQVKISSYLKHLKLEALETIGTKDNERWTKLKDSY PNGSLKVHEINTSGNTKSEGNAVDNLSGSDQKIKDWCSWASDQYFRYKED TLFKRYEYFCTKPA* >orf1527 (SEQ ID NO: 33) MVSKAGVAAVGALGAGTASYMGYEYVFNSKEEVKKTTIRERLGDLLLDTS SSDKWAARKTKLSQAEDTSLVEELKSLKNGVSEDQVKGWCSGAATKTYED VSALYFENVRTYCTFYIEDKLPEGYITKDSQDWSKASDRLKNVQTGVALS DQMKAIKDKLTTQGSSGTNDDLKNWCVGVYEKPFLGEDNQDFVDAKVYCA KIETTSTGSVSPAAA* >orf1528 (SEQ ID NO: 34) MLMLGVAGTTGTAGLGFLIAKNQKDESQKLRSKYPHALLTLDSDSSWSDK FNLLKTKTPSHPILKQAKTQFSNTQQSQSLYKKGCNAIYDSEGTQYLEDF KTFCAKTNKDGITGTWIKGGADVNTKWDEKLTNLKKSTDKLSSRFLEVQQ SLSSDSFNDEMRTNIQKACDNANSEIYLGSESVETRNIKNFCLTSES* >orf1529 (SEQ ID NO: 35) MNPEMMKGAYALGAASAIGGGAFTAKYIYDRSSSISIESHLKSKNLTVIS SLNSTSQWEEEYKLDKDAIKAEIQITNDNEGGTKLKEWCSQQLSKPFKEG EDLSKIERWCTVGKISQRIPKGKELLQDGAESSEWEKLYNKNTDQSERSK LSLASSKEDGTKNSDLTAIKKFCSDNKDKPFLADRKATEYDLVILWCIK Q* >orf0127 (SEQ ID NO: 36) MSCSCEKPSVSNVHLDLGYWFQVYSAYFRYFLIKGRIGEDTFESFIKKFE SLGLKFGCEASLDFKSLNRELDSELSPEERDLLSQINEVEATEAAEKLAI KDICDYQVRDFYDHLNNFKKLAFDFRYLSENSDSSNPLGIQFSIYFKDLQ LLVDKFQSNRRFVESFNFETDINGSDSFEILNFLTRELDLFPVQFQSYSS CNWFFLAIRELARFAREVAGFVQLHGFSLSLGDMDEYLLSNVIEACDRVE KNSENVSCSLESFKIMMIDISNLFSNLNKVCLNIKPDEEFWKPCESNEHL DSLYLKIFSPHLLEENLNYIFLNEPEIRNIVNKLSSKINEGCAHHGDPVC LIFEQRESIPFIGQLLPYLDFPCTLVPLEDLSKESVERCEGVLDGRKAIF LGTLLREASYIDKIKESIMKEDLKIGFLFVFDSLASTPIDIDFLGECIPD EDWVGFGLGSKHKCCNLNAIGVLRE* >orf0128 (SEQ ID NO: 37) MHNDIRVHLKYLAEILKDTLNKMVFMGKIEFPKKLEAYANLWKEEFKDPF TIPLTEAEWQDIKGIAPQFRGNRELQSSIKNVKRTLERQQFRNLSILNLM DEKLNLYMHILETNRQLSLLTRSSQDEVAYISKDFKKRRLMGCQYIHREV KNVTKLTKKHVIVNDIGSYINMFVDFSVKELEHLTHFIKIIRGIVDETIV GEKLALLKTRIREGSFDLPSFRQYMKLESSVNKK* >orf0326 (SEQ ID NO: 38) MARRSSSAFKSQSSPNDFTIKALQISLASPEYVRSLSKGEVTSFETINYK SLRPEKGGLFCESIFGPIKDYECSCGKYKQVKYKGKKCEKCKVYITQSLV RRDWMGHIELACPVAHIWMIKELPLPAKISLILGIKYKHVEEVVYFVNYI VLDPGHLQVEGKTLFDPLEIIDVSNSKSSIASLAKLRTLLRTIYETIQKE NPESYLTDLNYQQGRAYYKALSNSNLPFSIMDMFEYIEKHTGLKVGIGAE AIYELLKKVDLESLEYKLTQELNVNFPSGLNYADPKVRKILSRLQVIRWF KESKNRPEWMILKVIPVIPPNLRPIIQLSGGRFTSSDINTFYRRIIVRND RLARILNFNVAHIISNNEKRMLQEAVDSLIDNSSRKKPLTARDRHPLKSI TDHLKGKQGLFRQNLLGKRVDYSGRSVIVVGSELKMYQVGLPILMILSLF KPFIIRDLIRKVDDNGVECVPIAANIKTASKMIMEQSDEIWPVVHKVIKE RPVLLNRAPTLHRLSIQAFEPILVEGKAICLHPLVTTAFNADFDGDQMAV HLPLSAEAVHEARSMLLAPWQILGPKDGKPIVTPSQDMVLGIYHLTTEDK EAIGFGSLFATPDEVVHAYQLGKVDLSSIIAIGTSGFPKKRFPKSGILIT TVGKIIFNSRLPEDYKFINQSEGMWVSENDILDYGVSRLDYINAYQEKEP FAKSVIGRLIEDLYDNYSCQDLAPVLDSIKDMGFEYSTKSCTTISAFDVP KFSDKQSLLEEADKLVEQQKSFFRKGLVTDDEKYKNVIAIWSSVKDKVSD HIKNALKSKEFQSNPIVIMARSGARGNVSNFIQLSGMRGLMNKSYNYDQN TNTKVVRDIIEVPIKHSFIEGLTVIEYFNSSYGARKGMTDTAMKTAKSGY TTRKLVDAAQEVIVKVEDCGSNKGLIVEELRDKEHSMPIKTLKDRIVFKC AHIDILHPETGEVIVGANEVITKEAADKIVAAGITKVQVRSVLHCRLKQG ICQKCFGYDLTTKQMIDVGTTIGVIAAQSIGEPAVQLTMRTFHSGGVAGE SNISQGFERLRQLFEIVAPKKWETSVISEITGTVENIEIRDDERVVTVSS DINRREYNCDLNLPILVKKGQKINFGDRICDGSVDLKKLLEVSGVEAVRQ YIVQEIWKVYWIQGIDVSEKYIEIIVRQLTSRLKVLSPNDSKWAMGEVVD YSSFVDECAKLLLDGKTPPIATSIIFGLEEVPEKTNSFLAAASFQDTKKI LTDACVRGQIDYLNSLKENIMVGNLIPAGTGLKSADEVISDERSNRNVFN Y* >orf0675 (SEQ ID NO: 39) MTTAVKTSLLAGGAAAASGIGAIAYGDLLSFQTQKEAISSLLSKDPAKRA IGTTEEEEWKKTWARYRDSKEDIWKLGDLSGDAPTEFKNACKSKLDLEVS GSDSKEYKDFLLYCSRDTLISDLIKENSKGRVLLEGTDVSSTDWQNAWKA YSEDSRNQKGESETNIWNLSDWKTQNSQQNAPQSFITKCSSNIKHPSHDI HDPLYIDTVKFCTKDKTTAPASTNNG* >orf1544 (SEQ ID NO: 40) MAVSSLYKGAALLGGAGSVAGGYALATHLSSDKKQENKVTSTEDRLRSEG YTPLDFTNTNGDGWSKIKEAYKLENSEDKRFSGVEKEGNNTLSGIRDSCL RYLKEDSTNESNYKMSRRWCVVPISVKDKLGASNLLKSGTNESDDHSKWD EVVKKNDKDANKFVTFSESGKSSDDKRAEIKKQCEAKAAIETTKEEFEES LNQVNLWCTQAAGTAG* >orf1545 (SEQ ID NO: 41) MKGGVAAATVGTTATGAYVGSRYLTNTTSVSKHLTSSGYKLISSIKNPDH LKLQWKEEFKSDKASIKSLLNLKEDDESKGGEALGKWCTSKLAEEYSDKV DGLESVKKYCVIKTIKDWLIRNGNKAILTENQDDNSKWEATYNKRKQAKT PRTQTGLTETWPADSGTDKKDTDLPIIKRWCKEKNDSDFLAYEDTYSHVK DWCTESANA* >orf1546 (SEQ ID NO: 42) MPTLKTLVTFPIVGVSGAFIVSNLDLIFHDEPVNIRSKLIRDGFRLLSSD SSYWELLLSKHEEESSLKEKLPILVNNLESFKVACEEVIQFTDLNTYYSQ ASRWCVVPQGFEDRLKFIGNKEILESDGIWGDLVSKYEKDSNNSFVSSLG SQSTQELKIKELQKFCKDTKEKELKTYDKD FSKDFPLFLMWCTKR* >orf1547 (SEQ ID NO: 43) MSIIPKIAMGTLGLGGVAGGGILLARNLGNKNTLASKLESEGFTLMGEGH DQWSKTLAEYNKVKGTAEEAFKIASIDLTVDQLKEQCLSILKSESYSETD KNKASRWCTIPITIQSRIEKQGRRVLNDVDDNQDDKDTWVSLVRKHLTSP ESSRMSVSITDLQNDTVDDERIKAMKGGCRSLKSKTSLEKTYLNDYSKFQ DWCSAPK* >orf1548 (SEQ ID NO: 44) MALSTLTKGSILLGGVGSSVGGYFLVNNLTSGDKKEAKAITSIRDKLTQE GYTPLNFENTAGSDWEKIKTEYKKENTDTKRFSGVNKDDDATVLEGIKNS CLQYLLGDSSNEDNYQLSRRWCVVPVSVQNKLKGRTFLNTEAGQPNNDGE WDKIVTKHDSHPNKWIIFEASKSKEEKRTKIKEKCSAQAKLETTHTDFED ALRNVDLWCTKESV* >orf1679 (SEQ ID NO: 45) MSKLIPASLGAMGVSGAGVGSYIYLTSSENKKEEKVMTFKEKYSHAPLDL EGNTNDTIWSSKLTALKTGSPHHPDLISAKNAITPQGEDKAKPLHKEACR KIYGSSSDNQDYFHDFKKYCSKLLGDLVTGTWISSDSNSNSSWDGKLNDL ISKKSELVSQTLKSFAESLKTGSLTEEQRKTIKDWCSTQKDQLFSGEGDN VIQEIKSYCTSN* >orf1680 (SEQ ID NO: 46) LTSPSKFNNAEGYLDLMEVIGASSGVDCHGLRAINPPAPKPPAPAVPSAA KAPFPMLIRSAITLDLLYYVISFSRK* >orf1681 (SEQ ID NO: 47) MGKGAFAALGTAGAGGLGAGGLIALKPWQSTPDEAPITSIRSKYPSALLN LEGDVNIWEKKYKALETKTPHHPTLQKALSTGKGTGANLTEAKSLLKSGC RAIYESDSDNSNNFQDFKSFCSKTNEDATKSGKQWIADATSKADGNKWDT VLTSLKGHNTWSLDSVLETLKKGVQGDSSSFPEARRKELKDWCDKAKLEV FVGESSSEFQSQEAFCKAD* >orf0285 (SEQ ID NO: 48) MITGAAQIDAAILVVSATDGTMPQTREHILLARQVGVERMVVFLNKCDMV EDVEMQDLVEMEVRDLLTSYGYDGSATPVVRGSALKALEGDEKYVQSIKD LLGNLDEYVPLPVREVDKPFLLSIEDVLTITGRGTVVTGRCERGTLKVNE EVEIVGLKETSKAVVTGIEMFRKPLDEVLAGDNAGVLLRGVNKDEVSRGQ VLAKPKSITPHKKFHAQIYALKKEEGGRHTAFTKGYKPQFYFRTTDVTGT IDLPEGSEMVMPGDNAKILVELINVVAIEKGSKFSIREGGKTIGAGTVVD IVE* >orf0286 (SEQ ID NO: 49) VSCGEGQIVSVLGVFFGDEGKAKIVDYISKDFDYVVRYQGGDNAGHTVCI GDRKYIFQLIPCGILQTKAFIAHGVVLNPESLLKEIQDLSECVEIKDRLF ISDHAHVICDWNIAYDKFLENLRGSQAIGTTNRGIGPTYSNKALRLGIRV KDLLDYDSLREKIDLNLKIYNVLFKSYGHPTFDLEVETKKYFEYGQKIKP YLVDSYHWIYGELSKGKRFLFEGSQGLMLDLDLGTYPFVTSSNITGSLIS GTSLSFRHFKRIVGVVKTYSSRVGNGEFITEIHDQDLSGYIRKVGNEFGS VTGRPRKIGWLDLVALKYVVTISGITEIVLTLVDVLNNLGEVKVCNSYEY SSKEPIPVYKSFKGWKEDYSSIKRYSDFSDEFKNFVKYIEDFVGVPVTII SYGRSREDTLVRMNEN* >orf0287 (SEQ ID NO: 50) MKIKLELPSHVKHSISNLNRFKKEVDLVINVVDARASKTSNLNLYISRIF SKSKILDIFSKSDLASSEGLENSFNFKIQSNRNRILHLIKKALQEERNRL QESGYLNPHFKILVVGMPNTGKSTLINLLKNKKISKAANTPGITRKITQY YLGDNLWLFDSPGIFFYQDISPELLWKLIVINAVPSNFKEYSEILEITFW YLKDKYPNSMDELSADSYLSFIELLAKRYNFKNRGGTFDLERAEEKFLFL LRNGGIRDVSWD* >orf1350 (SEQ ID NO: 51) LSNSSQNWLSLNLKTSLLVGAASISAAGTTSSVLSNASGGVLEAVKNSSQ PIIDPFQKGYSKLSEQLDSFSKQGYNAGVDAKSWVTENLSKSKIKTGETN IYQNLSDWYRAVKGFADSARTTISEFFQKWSEHRETMHVVFKALGNSFSL LGGLMGSFESDGESGLKILFEVIGKPKFKDFMTQVSSLVSKNPNLMSSLE GNDVMDVLSAFRQDEDTVVDTLKGLSEKDAGTVDKATLMNALKLYSLMDK ARNLMSKARTILESKDKEKAKQLIQEITEAHKQMEALIKANEGQATE* >orf1521_1 (SEQ ID NO: 52) LGSMSLSLASKATAGIAGTGAVAGGGAFAAYKFLNQETIEKYLNSLHREL AVSNEDWELIKNNYAADKAENPIPNIPKSTIKDKLNDLKKWCSDRLNEEF SQEKASKGDYNLIQAWCTKQVKISDYLKHLKLASLDTSGTKDDTTWNKLK DEYSTSGGLKVNEITGQEGSKTEGGEVSTLSDNTKLKTWCSWSVSQYFKH QEDSLFKRYKHFCTKQAN* >orf1522_1 (SEQ ID NO: 53) MLSKAGVAAVGALGAGTASYMGYEYVFNAKEEVKKVTIGEALEPFLLNTE SSDKWASRKDKLSKANEDSLVEELKSLKSGVTEDQVKNWCSVASTKVYSE VSGLYLENVRSYCTFHIEDKLPSGYIKDTEDWEKANSRLKEVNPDTGLSS HMKEVKDKLSKQDSPDTNALKDWCMGAYGKPYLGDDNQDFVDARTYCSKV AEASPSGSTQAASLPA* >orf1523_1 (SEQ ID NO: 54) MSKLAALILGIAGTAGTAGLGFLIAKNQKDETKKIKNNYPHAILTFSNNE GWNSKFQLLNSKETTHPTLKKAKAQFSNTSQSQELYKKGCNEIYDSEGTQ YLDDFKTFCSKTNKDAITGSWISDAASVNTNWDKKLTSLKERNSGLSSEF LEVQSSLGSGSFDETARGKIKKACDDSHSEIYLGPNDIKTQSIKDFCLSE QT* >orf0175 (SEQ ID NO: 55) MALVSAREILLKAYKEGYAVAQINTNNLEWTKAILLTVQELKSPVIIGAS EGAIKYMGGFRTVASLVKAMIEDLGITVPIILHLDHGSYEGCKKAMDAGF SSVMFDGSHFPIDENFQKSKEIVDLANSRGISVELEVGTIGGEEDGVIGA GENASVDECVKIGGLDLSMLAAGIGNIHGPYPDNWKGLNFPLLKEISDAV KKPMVLHGGTGIPEDQIKKAISLGISKINVNTELQLAFAAATRKYIEEKN DLNMSKKGFDPRKLLKYGYDGICQVIKDKLTMFGSVGKA* >orf0176 (SEQ ID NO: 56) MSKDNKEQKEEEIVEEVSELDQLKAKLKEWEDKFSELEKESNQRLLEFVE KKSKEASDIIAKKEEEISQRYKKELEEAKDYLYEKPLASLVGVISQFEAV IKMTVDPNISQYLVGFRMFLTQFNDLLREFSISIIEPKDGDEFDSSFMEA TVVEKVSDDSLNNKVISVFSKGYRLKDRIIRLASVKVGKI* >orf0177 (SEQ ID NO: 57) MASKDYYSILGISRNATEDDIKKAYRKLAKKYHPDINKEAGAEAKFKDIN EAYETLGDPQKRSNYDNFGTSGDGMGGAGGANPFDIWNSFFSGQASGGFS EFDIFGGSDSHQSQPQYENYQDRIVISFLASIKGVNHSFTYESEKRCEVC KGNKALDGDSKYIITCDNCRGTGWEMLRKQTIFGVVNTKASCRRCNGQGK MISKPCKECGGRGYKKFHKTQNFSIPAGVQDKDVLVAWDKTGIVDKKISI HVSVRPSEIFSRKGNDLYTRIVINPFVAIFGGTASIPTISGIKSIKIAAG TNSGEKLKLKGLGVKSSAGRGDLIGEVCFAPVPKLTKEQKEVLKSLSDLE VPEVTRWVSKAKKAVVSD* >orf0178 (SEQ ID NO: 58) MAHIDAGKTTTSERILFHTGKTYKIGEVHDGAATMDWMEQEKEKGITITA AATSVSWKNHQLNLIDTPGHVDFTVEVERSLRVLDGAVAVLDSQMGVEPQ TETVWRQATKYSVPRIVYCNKMDKIGADFFKSVQSLRDKLKVKAVLVQLN IGKESEFTGIIDLIAKKAYSFDGKQEEEYKEIPIPDNLKGEVDRLHQELL DEVLVFDEKIMEKYLGGEEVTIDEIKRCIRIGTIQTKLFPVFCGSSFKNK GVKFLLDAIIDYLPSPVDLPETPAFDKEQNPISIKNSAEGEFVGMAFKIA TDPFVGRLTFIRVYSGILKKGSAIYNTTQDLPEKAGRLVQMHSNHRTEIE SIQAGEICAIVGLKNTRTGDTLTVKGNAVVLESMNFAEPVISLAIEPKTK VDQEKMSMVLSRLSEEDPTFKISTNVETGQTIISGMGELHLEILIDRMNR EFGLQVNIGQPQVAFRETFTQVSDVEGKYIKQSGGRGNYGHVWIKFEPNK DKGFEFVDKIVGGKIPKEYIKSIRQGLIDAMKSGPLAGYPIIDIKATLFD GSFHEVDSNEMAFRIAASLALKDASKKCASILLEPIMNVEITVPLQYFGT VMGDVTSRRGLIEGTEQVENAQIIKSKIPLKEMFGYATVLRSFTQGRGIY TMQFSHYQPLPKSITQEMLEGRK* >orf0088 (SEQ ID NO: 59) LQKIKDYLSSEFNLAAQALGYRLTGIEASFDFTKDYKFGDIFTNFACRIS SKYKKNPKDVGEELLKQVGELKYVSSAKVEKNGFINIFFSPEIFSEYYSE ILEKREDIWRKHPINSWYFVEIVSANPTGLLHIGHARNGIFSDTLANLLE YGGYFVHREYLVNNLGNQIKELLESIWIKYKAKLTSIPRESNTKVVKYNG KEIDECVDYLISTHGQRWIFDRNIFESKSYPELEKLVVSYFLNEIEKDLA RYNIEVNAWKFESSFVNSESINDLFKSMKEYLRVKDGAIWFKAGEILDEC KDEVLIKNDGKHTYYCQDLIYHLYKLSLLGNEGKIINVLGSDHYGHIDKL KAFLKLKEVDDDRVHFICMQLVKLMEHSTLVKISKRDSKVIYLRDLMNYM TYEEARWFLVSQHPDSPLEIDIQRLKQKNYNNPAFYVMYAYSRIFQILRK HGEPYFYSKKEVLFKTITDGIEKTIMNTLMQWDEVIHEAIETLQPYRITQ YLFKLAKEFHSFYEETKLLQEGHEEEWLRDRLALLNAAKYTIHSGLSILK IKPKSVI* >orf1097 (SEQ ID NO: 60) MTYAKLGAATLGTAGAAGGGYLAYPHVFPERTLLDELKSQNKSVINGNES QWTLKKELYNKGTNSSKITIDNKEKASITEAELKKWCSDNLKAPYSKAKD SILGKVEKWCLKPNIKEALSKETKEIISFTGTTIDAAWESKLTTNSSSVK GELIDKWKLPVSSEGNDKVSKESLRDACQLKVEGEYISENDENYTLSKKW CLKP*