CD138-targeted interferon demonstrates potent apoptotic and anti-tumor activities
09803021 · 2017-10-31
Assignee
Inventors
Cpc classification
A61K45/06
HUMAN NECESSITIES
C07K2317/73
CHEMISTRY; METALLURGY
C07K16/2896
CHEMISTRY; METALLURGY
C07K2319/74
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K39/00
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
C07K19/00
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
Abstract
In various embodiments chimeric moieties (constructs) are provided that show significant efficacy against cancers. In certain embodiments the constructs comprise a targeting moiety that specifically binds CD138 attached to an interferon or to a mutant interferon. In certain embodiments, the constructs comprise anti-CD138 antibody attached to an interferon alpha (IFN-α) or to a mutant interferon alpha.
Claims
1. A method of killing or inhibiting growth and/or proliferation of a cell that expresses or overexpresses CD138, said method comprising contacting said cell with a chimeric construct in a therapeutically effective dose, where said construct comprises an interferon alpha attached by a peptide linker to an a full-length antibody that binds CD138, wherein the amino acid sequence of said peptide consists of the sequence SGGGGS (SEQ ID NO:8), and wherein said construct, when contacted to said cell, results in the killing or the inhibition of growth or proliferation of said cell.
2. The method of claim 1, wherein said antibody comprises the complementarity determining regions of the B-B4 monoclonal antibody.
3. The method of claim 2, wherein antibody comprises the VH and/or VL domain of the B-B4 monoclonal antibody.
4. The method of claim 1, wherein said antibody is a full IgG.
5. The method of claim 4, wherein said antibody is the B-B4 monoclonal antibody.
6. The method of claim 1, wherein said method further comprises administering to said subject one or more cytotoxic agents.
7. The method of claim 6, wherein said one or more cytotoxic agents comprises Bortezomib and said chimeric construct and said Bortezomib are synergistic in their activity on said cell.
8. The method of claim 7, wherein said cancer cell is a metastatic cell.
9. The method of claim 7, wherein said cancer cell is in a solid tumor.
10. The method of claim 7, wherein said cancer cell is cell produced by a cancer selected from the group consisting of multiple myeloma, ovarian carcinoma, cervical cancer, endometrial cancer, kidney carcinoma, gall bladder carcinoma, transitional cell bladder carcinoma, gastric cancer, prostate adenocarcinoma, breast cancer, prostate cancer, lung cancer, colon carcinoma, Hodgkin's and non-Hodgkin's lymphoma, chronic lymphocytic leukemia (CLL), acute lymphoblastic leukemia (ALL), acute myeloblastic leukemia (AML), a solid tissue sarcoma, colon carcinoma, non small cell lung carcinoma, squamous cell lung carcinoma, colorectal carcinoma, hepato-carcinoma, pancreatic cancer, and head and neck carcinoma.
11. The method of claim 7, wherein said cancer cell is a cell of a multiple myeloma.
12. The method of claim 6, wherein said one or more cytotoxic agents comprises lenalidomide and said chimeric construct and said lenalidomide are synergistic in their activity on said cell.
13. The method of claim 1, wherein said cell is a cancer cell.
14. The method of claim 1, wherein said method inhibits, delays, and/or prevents the growth of a cancer tumor and/or spread of malignant cancer cells.
15. The method of claim 1, wherein said contacting comprises systemically administering said construct or formulation to a mammal.
16. The method of claim 1, wherein said contacting comprises administering said construct or formulation directly into a tumor site.
17. The method of claim 1, wherein said contacting comprises administering said construct or formulation via a route selected from the group consisting of oral administration, intravenous administration, intramuscular administration, direct tumor administration, inhalation, rectal administration, vaginal administration, transdermal administration, and subcutaneous depot administration.
18. The method of claim 1, wherein said cell is a cell in a human.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
DETAILED DESCRIPTION
(26) Interferon alpha (IFNα) is an important cytokine in initiating the innate immune response and also demonstrates a wide spectrum of anti-tumor activities. The clinical use of interferon (e.g., IFNα) as an anticancer drug, however, is hampered by its short half-life, which significantly compromises its therapeutic effect. In certain embodiments this invention pertains to the discovery that the therapeutic index of interferon can be improved by attaching the interferon to a targeting moiety that specifically/preferentially binds a marker on or associated with the target cell (e.g., a tumor cell). This permits the delivery of higher doses of interferon to the target site with fewer systemic complications. In certain embodiments the construct shows lower side effects/toxicity than an untargeted interferon.
(27) In particular, anti-CD138-IFNα2 antibody fusion proteins were constructed. CD138, also known as syndecan-1, is a heparan sulfate proteoglycan expressed by multiple myeloma (MM) cell lines, and in patients, it is expressed on malignant plasma cells in peripheral blood and in the bone marrow (Wijdenes 1996, Ridley 1993, Chilosi 1999). The ectodomain of CD138 is secreted into the serum in vivo (Dhodapkar 1997), and is shed by cultured cells (Subramanian 1997). CD138 mediates adhesion to growth factors (Kiefer 1990) and extracellular matrix components (Bernfield 1992) such as type I collagen (Ridley 1993).
(28) As explained below and in the Example, targeting of human IFN (e.g., IFNα) via the anti-CD138 antibody moiety improves the cytoreductive effects of the cytokine Multiple mechanisms of action such as induction of apoptosis, blockage in cell cycle progression and induction of senescence appear to be involved as HMCLs have different responses to treatment with fusion protein as explained below. It is also demonstrated that the fusion protein is effective against primary human myeloma patient cells and against MM tumors in a mouse xenograft model. In addition, mutations that increase the affinity of IFNα for IFNAR resulted in a more effective molecule in vitro and in vivo.
(29) Antibody fusions were produced by genetically fusing IFN to the end of CH3 of an IgG1K antibody molecule. A schematic of this fusion protein specific for CD138 is illustrated in
(30) As illustrated in the Examples, the proteins were expressed following gene transfection into Chinese hamster ovary (CHO) cells and were purified using protein A sepharose or agarose. The proteins expressed from the transfected genes were of the appropriate size and are assembled into H2L2 molecules.
(31) A mutant IFNα (mutated IFNα2 or IFNα2.sup.YNS having the mutations H57Y, E58N, and Q61S (YNS) (see, e.g., Kalie et al. (2007) J. Biol. Chem., 282: 11602-11611)) was fused to the terminus of CH3 in an identical fashion used to fuse wild-type IFNα. The mutant IFNα has higher affinity for IFNAR.
(32) A first construct was made comprising an antibody specific for CD20. Based on the published data for anti-CD20 antibodies we expected it to exhibit higher anti-proliferative activity against CD20 expressing lymphoma cells than fusion proteins containing wild-type IFNα. However, instead we found that it was less effective (see
(33) When we changed the binding specificity of the fusion proteins containing mutIFNα from CD20 to CD138 (using an anti-CD138 antibody), to our surprise we found that they were more effective than those containing wild-type IFNα in inhibiting the proliferation of most myeloma cell lines. Shown in
(34) IRF4 is a protein shown to be essential for the survival of myeloma cells. The anti-CD138-mutIFNα construct was shown to be more effective than the anti-CD138-IFNα construct in inhibiting its expression in U266 cells (see, e.g.,
(35) Increased expression of cyclin D has been shown to be associated with the growth of myeloma cells and anti-CD138-mutIFNα was shown to be more effective than anti-CD138-IFNα in inhibiting its expression in U266 cells (see
(36) Cellular senescence is one pathway for inhibiting tumor growth. Anti-CD138-mutIFNα was shown to be more effective than anti-CD138-IFNα in inducing cellular senescence in H929 and OCI-My5 myeloma cells (see
(37) Apoptosis is one mechanism for inhibiting tumor growth. The anti-CD138-mutIFNα construct was shown to be more effective than the anti-CD138-IFNα construct in inducing apoptosis in U266 and H929 myeloma cells (see
(38) An important readout is which protein is most effective against primary myeloma cells. Anti-CD138-mutIFNα was shown to be more effective than anti-CD138-IFNα against primary myeloma cells from patients (see
(39) In vivo efficacy in a treatment model is very important. Anti-CD138-mutIFNα was shown to be more effective than anti-CD138-IFNα in treating tumors in mice bearing xenografts of either OCI-MY5 or U266 cells (see
(40) In view of these findings it is believed that anti-CD138-interferon constructs, and in particular anti-CD138-mutant interferon constructs show surprising and unexpected efficacy against cells expressing or over expressing CD138.
(41) Thus, in certain embodiments, the constructs (e.g., chimeric moieties) comprising an interferon (e.g., IFN-α, IFNβ, mutant IFNα, mutant IFNβ, truncated IFNα, truncated IFNβ, etc.) attached to a targeting moiety (e.g., to an antibody that specifically binds CD138). The constructs include chemical conjugates as well as fusion proteins. Also provided are nucleic acids encoding the fusion proteins as well as cells transfected with the nucleic acids to express the fusion proteins. Also provided are methods of inhibiting growth and proliferation of cells that express or overexpress CD138 using the constructs described herein. In certain embodiments, the cells that express or over express CD138 are cancer cells. Accordingly in various embodiments, methods are provided for inhibiting, delaying and/or preventing the growth of a tumor and/or spread of malignant tumor cell using the constructs described herein. In addition, kits comprising the constructs are provided, e.g., for the treatment of various cancers.
(42) I. Constructs Comprising a Targeting Moiety Attached to an Interferon.
(43) It was a surprising discovery that constructs (chimeric constructs) comprising a targeting moiety that binds (e.g., that preferentially or specifically binds) to CD138 attached to a native (wildtype) or modified IFN (e.g., mutant IFN-α) can be effectively used to inhibit the growth and/or proliferation of target cells (e.g., cancer cells) that express or overexpress CD138. In certain embodiments the CD138 targeting moieties are chemically conjugated to the interferon, while in other embodiments, the CD138 targeting moiety (or a component thereof) is expressed as a fusion protein with the interferon. When produced as a fusion protein the CD138 targeting moiety (e.g., antibody) (or a component thereof) can be directly fused to the interferon or attached by means of a peptide linker (e.g., a (Gly.sub.4Ser).sub.3 (SEQ ID NO:1) linker, a Gly.sub.4Ser (SEQ ID NO:2) linker, a SerGly.sub.4Ser linker (SEQ ID NO:8), an AEAAAKEAAAKA (SEQ ID NO:15) linker, and the like.
(44) A) CD138 Targeting Moieties.
(45) In various embodiments, the targeting moiety is a molecule that specifically or preferentially binds CD138 expressed, or overexpressed, by (e.g., on the surface of) or associated with the target cell(s) (e.g., cancer cells such as multiple myeloma cells). While essentially any cell that expresses or overexpresses CD138 can be targeted, certain preferred cells include those associated with a pathology characterized by hyperproliferation of a cell (i.e., a hyperproliferative disorder).
(46) Hyperproliferative disorders characterized as cancer include but are not limited to solid tumors, proliferation of metastatic cells, and the like.
(47) While the examples focus on the use of the constructs to inhibit/kill multiple myeloma cells, it has been recognized that CD138 is expressed/overexpressed in a number of other cancers. Thus for example, CD138 has been shown to be expressed/overexpressed on the following cancers: ovarian carcinoma, cervical cancer (Numa et al. (2002) Int. J. Oncol., 20(1): 39-43.), endometrial cancer (Choi et al. (2007) Int. J. Cancer, 121(4): 741-750), kidney carcinoma, gall bladder, transitional cell bladder carcinoma, gastric cancer (Wiksten et al. (2008) Gastric: Anticancer Res. 28(4C): 2279-2287), prostate adenocarcinoma (Zellweger et al. (2003) Prostate 55(1): 20-29), mammary carcinoma (Loussouarn et al. (2008) Br. J. Cancer, 28: 1993-1998), non-small cell lung carcinoma (Shah et al. (2004) Cancer 101(7): 1632-1638), squamous cell lung carcinoma (Toyoshima et al. (2001) Lung Cancer, 31(2-3): 193-202), colon carcinoma cells and cells of Hodgkin's and non-Hodgkin's lymphomas, colorectal carcinoma (Hashimoto et al. (2008) BMC Cancer 8: 185), hepato-carcinoma (Li et al. (2005) World J Gastroenterol. 11(10): 1445-1451), chronic lymphocytic leukemia (CLL), pancreatic (Conejo et al. (2000) Int. J. Cancer, 88(1): 12-20), and head and neck carcinoma (Anttonen et al. (1999) Br. J. Cancer, 79(3/4): 558-564) to name just a few. It is believed the methods described herein will be effective in these various cancers and others.
(48) These disorders have been well characterized in humans, but also exist with a similar etiology in other mammals, and can be treated by administering the constructs described herein (alone or in the context of a combined treatment plan (e.g., in combination with radiation therapy and/or the use of other anti-cancer compounds).
(49) Anti-CD138 Antibodies.
(50) In certain embodiments, the targeting moieties can comprise antibodies, unibodies, or affybodies that specifically or preferentially bind CD138. Antibodies that specifically or preferentially bind CD138 are well known to those of skill in the art and many are commercially available. For example Wijdenes et al. (1996) British Journal of Haematology, 94, 318-323 describe an antibody that is specific for CD138 (syndecan-1) and this antibody is commercially available from Abcam, Miltenyi Biotec, and the like. Other illustrative and non-limiting anti-CD138 antibodies include, but are not limited to the polyclonal rabbit anti-human CD138 antibody LS-B3341 and the monoclonal mouse anti-Human CD138 Antibody LS-B4051 available from LifeSpan Biosciences, Inc., monoclonal antibody (MI15) available from Pierce Antibodies, Biotest BT-062 anti-CD138, and the like. Other anti-CD138 antibodies include, but are not limited to B-B2, 1D4, MI15 and 104-9 (see, e.g., Gattei et al. (1999) British J. Haematol., 104(1): 152-162).
(51) In addition, anti-CD138 antibodies can be made using methods well known to those of skill in the art. For example, antibodies can be produced by immunizing an animal with CD138 or an immunogenic fragment thereof and raising the antibodies in that animal. Polyclonal antibodies can be recovered and used or converted to monoclonal antibodies according to methods well known to those of skill in the art.
(52) In certain embodiments, single chain anti-CD138 antibodies can be created using a phage display library. One such method is described by Fernandez et al. (2005) Journal of Clinical Oncology, 2005 ASCO Annual Meeting Proceedings. 23(16S), Part I of II (June 1 Supplement), 2005: 2550. The authors used combinatorial immunoglobulin (Ig) libraries with phage display to generate in vitro human Ig Fab fragments without the need to maintain on-going hybridoma culture. A library of 10.sup.10 clones from the cDNA of peripheral blood mononuclear cells of patients with adenocarcinoma were used to identify anti-CD138 specific Ig. Generally following removal of non-specific Fabs by exposing the Ig library to the epithelial cell line HEK, specific anti-CD138 Fabs were selected by exposing the Fab library to HEK transduced with human CD138. Six rounds of selection resulted in a panel of anti-CD138-bearing phage. The anti-CD138-bearing phages bound multiple myeloma CD138+ cell lines (U266, SBN) by ELISA analysis while phage alone did not. Sequencing the Fab VH and VL genes confirmed the heterogeneity of the panel of anti-CD138 Fabs.
(53) The constructs described herein need not be limited to the use of the antibodies described above, and other such antibodies as they are known to those of skill in the art can be used in the constructs, formulations, and methods described herein.
(54) In certain embodiments, the antibody has an affinity (K.sub.D) for CD138 of at least 1×10.sup.−6 M, or at least 1×10.sup.−7 M, or at least 1×10.sup.−8 M, or at least 1×10.sup.−9 M, or at least 1×10.sup.−10 M, or at least 1×10.sup.−11 M.
(55) It will be recognized that the antibodies described above can be provided as whole intact antibodies (e.g., IgG), antibody fragments, or single chain antibodies, using methods well known to those of skill in the art. In addition, while the antibody can be from essentially any mammalian species, to reduce immunogenicity, it is desirable to use an antibody that is of the species in which the construct is to be used. In other words, for use in a human, it is desirable to use a human, humanized, or chimeric human antibody.
(56) While the above discussion pertains to antibodies, it will be recognized that affybodies and/or unibodies can be used instead of antibodies.
(57) Unibodies.
(58) UniBody are antibody technology that produces a stable, smaller antibody format with an anticipated longer therapeutic window than certain small antibody formats. In certain embodiments unibodies are produced from IgG4 antibodies by eliminating the hinge region of the antibody. Unlike the full size IgG4 antibody, the half molecule fragment is very stable and is termed a uniBody. Halving the IgG4 molecule left only one area on the UniBody that can bind to a target. Methods of producing unibodies are described in detail in PCT Publication WO2007/059782, (see, also, Kolfschoten et al. (2007) Science 317: 1554-1557) and can be used to create unibodies based on any known anti-CD138 antibody.
(59) Affibodies.
(60) Affibody molecules are class of affinity proteins based on a 58-amino acid residue protein domain, derived from one of the IgG-binding domains of staphylococcal protein A. This three helix bundle domain has been used as a scaffold for the construction of combinatorial phagemid libraries, from which Affibody variants that target the desired molecules can be selected using phage display technology (see, e.g., Nord et al. (1997) Nat. Biotechnol. 15: 772-777; Ronmark et al. (2002) Eur. J. Biochem., 269: 2647-2655.). Details of Affibodies and methods of production are known to those of skill (see, e.g., U.S. Pat. No. 5,831).
(61) B) Interferons
(62) In various embodiments chimeric moieties of this invention comprise an interferon (e.g., IFN-α, IFNβ, etc.) joined to the targeting moiety (e.g., anti-CD138 antibody). The interferon can be a full length wild-type interferon (e.g. IFN-α, IFNβ, IFN-γ, etc.) an interferon fragment (e.g., an IFN-α fragment), and/or a mutated interferon. Typically the interferon fragment is one that possesses the endogenous binding affinity and/or activity of the native interferon, preferably at a level of at least 60%, or of at least 80%, more preferably at least 90% or 95%, most preferably at least 98%, 99%, 100%, or a level greater than the wild-type interferon (in its isolated form).
(63) Means of identifying such modified interferon molecules are routine to those of skill in the art. In one illustrative approach, a library of truncated and/or mutated IFN-α is produced and screened for IFN-α activity. Methods of producing libraries of polypeptide variants are well known to those of skill in the art. Thus, for example error-prone PCR can be used to create a library of mutant and/or truncated IFN-α (see, e.g., U.S. Pat. No. 6,365,408).
(64) The resulting library members can then be screened according to standard methods known to those of skill in the art. Thus, for example, IFN-α activity can be assayed by measuring antiviral activity against a particular test virus. Kits for assaying for IFN-α activity are commercially available (see, e.g., ILITE™ alphabeta kit by Neutekbio, Ireland).
(65) In various embodiments use of a mutated interferon alpha 2 (IFNα2) is contemplated. Certain mutants include a mutation of the His at position 57, and/or the E at position 58, and/or the Q at position 61. In certain embodiments the mutants include the mutation H57Y, and/or E58N, and/or Q61S. In certain embodiments the mutants include a mutated IFNα2 having the mutations H57Y, E58N, and Q61S (YNS) (see, e.g., Kalie et al. (2007) J. Biol. Chem., 282: 11602-11611).
(66) In other embodiments mutants include a mutation of the His at position 57, and/or the E at position 58, and/or the Q at position 61 to A (alanine) In certain embodiments the mutants include a mutated IFNα2 having the mutations H57A, E58A, and Q61A (HEQ) (see, e.g., Jaitin et al. (2006) Mol. Cellular Biol., 26(5): 1888-1897). In certain embodiments the mutant interferon comprises a mutation of His at position 57 to A, Y, or M, and/or a mutation of E at position 58 to A, or N, or D, or L, and/or a mutation of Q at position 61 to A, or S, or L, or D.
(67) A mutated IFNβ comprising a serine substituted for the naturally occurring cysteine at amino acid 17 has also been demonstrated to show efficacy (see, e.g., Hawkins et al. (1985) Cancer Res., 45, 5914-5920.
(68) In various embodiments use of truncated interferons is also contemplated. Human INFα, for example, with deletions of the first 15 amino-terminal amino acid residues and/or the last 10-13 carboxyl-terminal amino acid residues, have been shown to exhibit virtually the same activity as the parent molecules (see, e.g., Ackerman (1984) Proc. Natl. Acad. Sci., USA, 81: 1045-1047). Accordingly the use of IFN-αs having 1, 2, 3, up to 13 carboxyl terminal amino acid residues deleted and/or 1, 2, 3, up to 15 amino terminal amino acid residues deleted are contemplated.
(69) It has also been demonstrated that activity resides in huIFN-α fragment HuIFN-α (1-110) (Id.). Accordingly carboxyl truncated IFNs with truncations after residue 110 and/or with 1, 2, 3, up to 15 amino terminal amino acid residues deleted are contemplated.
(70) Certain C-terminally truncated interferon betas (IFNβ) have been shown to have increased activity (see, e.g., U.S. Patent Publication 2009/0025106 A1). Accordingly, in certain embodiments the interferon used in the constructs described herein includes the C-terminally truncated IFNβ described as IFN-Δ1, IFN-Δ2, IFN-Δ3, IFN-Δ4, IFN-Δ5, IFN-Δ6, IFN-Δ7, IFN-Δ8, IFN-Δ9, or IFN-Δ10 as described in U.S. Patent Publication NO: 2009/0025106 A1. In certain embodiments the interferon is IFN-Δ7, IFN-Δ8, or IFN-Δ9 (SEQ ID NOs: 57, 59, and 61 in US 2009/0025106 A1 (see, Table 1).
(71) TABLE-US-00003 TABLE 1 Truncated IFNβ showing enhanced activity (see U.S. Patent Publication 2009/0025106 A1). SEQ ID Truncated Amino Acid Sequence NO IFN-Δ7 Met Gly Lys Met Ala Ser Leu Phe 3 Ala Thr Phe Leu Val Val Leu Val Ser Leu Ser Leu Ala Ser Glu Ser Ser Ala Cys Asp Leu Pro Gln Thr His Ser Leu Gly Ser Arg Arg Thr Leu Met Leu Leu Ala Gln Met Arg Arg Ile Ser Leu Phe Ser Cys Leu Lys Asp Arg His Asp Phe Gly Phe Pro Gln Glu Glu Phe Gly Asn Gln Phe Gln Lys Ala Glu Thr Ile Pro Val Leu His Glu Met Ile Gln Gln Ile Phe Asn Leu Phe Ser Thr Lys Asp Ser Ser Ala Ala Trp Asn Glu Thr Leu Leu Asp Lys Phe Tyr Thr Glu Leu Tyr Gln Gln Leu Asn Asp Leu Glu Ala Cys Val Ile Gln Gly Val Gly Val Thr Glu Thr Pro Leu Met Lys Glu Asp Ser Ile Leu Ala Val Arg Lys Tyr Phe Gln Arg Ile Thr Leu Tyr Leu Lys Glu Lys Lys Tyr Ser Pro Cys Ala Trp Glu Val Val Arg Ala Glu Ile Met Arg Ser Phe Ser Leu Ser Thr Asn Leu Gln IFN-Δ7 Met Gly Lys Met Ala Ser Leu Phe 4 Ala Thr Phe Leu Val Val Leu Val Ser Leu Ser Leu Ala Ser Glu Ser Ser Ala Cys Asp Leu Pro Gln Thr His Ser Leu Gly Ser Arg Arg Thr Leu Met Leu Leu Ala Gln Met Arg Arg Ile Ser Leu Phe Ser Cys Leu Lys Asp Arg His Asp Phe Gly Phe Pro Gln Glu Glu Phe Gly Asn Gln Phe Gln Lys Ala Glu Thr Ile Pro Val Leu His Glu Met Ile Gln Gln Ile Phe Asn Leu Phe Ser Thr Lys Asp Ser Ser Ala Ala Trp Asn Glu Thr Leu Leu Asp Lys Phe Tyr Thr Glu Leu Tyr Gln Gln Leu Asn Asp Leu Glu Ala Cys Val Ile Gln Gly Val Gly Val Thr Glu Thr Pro Leu Met Lys Glu Asp Ser Ile Leu Ala Val Arg Lys Tyr Phe Gln Arg Ile Thr Leu Tyr Leu Lys Glu Lys Lys Tyr Ser Pro Cys Ala Trp Glu Val Val Arg Ala Glu Ile Met Arg Ser Phe Ser Leu Ser Thr Asn Leu IFN-Δ7 Met Gly Lys Met Ala Ser Leu Phe 5 Ala Thr Phe Leu Val Val Leu Val Ser Leu Ser Leu Ala Ser Glu Ser Ser Ala Cys Asp Leu Pro Gln Thr His Ser Leu Gly Ser Arg Arg Thr Leu Met Leu Leu Ala Gln Met Arg Arg Ile Ser Leu Phe Ser Cys Leu Lys Asp Arg His Asp Phe Gly Phe Pro Gln Glu Glu Phe Gly Asn Gln Phe Gln Lys Ala Glu Thr Ile Pro Val Leu His Glu Met Ile Gln Gln Ile Phe Asn Leu Phe Ser Thr Lys Asp Ser Ser Ala Ala Trp Asn Glu Thr Leu Leu Asp Lys Phe Tyr Thr Glu Leu Tyr Gln Gln Leu Asn Asp Leu Glu Ala Cys Val Ile Gln Gly Val Gly Val Thr Glu Thr Pro Leu Met Lys Glu Asp Ser Ile Leu Ala Val Arg Lys Tyr Phe Gln Arg Ile Thr Leu Tyr Leu Lys Glu Lys Lys Tyr Ser Pro Cys Ala Trp Glu Val Val Arg Ala Glu Ile Met Arg Ser Phe Ser Leu Ser Thr Asn
(72) In certain embodiments the use of chemically modified interferon is also contemplated. For example, in certain embodiments, the interferon is chemically modified to increase serum half-life. Thus, for example, (2-sulfo-9-fluorenylmethoxycarbonyl).sub.7-interferon-α2 undergoes time-dependent spontaneous hydrolysis, generating active interferon (see, e.g., Shechter et al. (2001) Proc. Natl. Acad. Sci., USA, 98(3): 1212-1217). Other modifications, include for example, N-terminal modifications including, but not limited to the addition of PEG, protecting groups, and the like. U.S. Pat. No. 5,824,784, for example, described N-terminally chemically modified interferon.
(73) The foregoing interferons are intended to be illustrative and not limiting. Using the teaching provided herein, other suitable modified interferons (e.g., modified IFN-α, IFNβ, IFN-γ, etc.) can readily be identified and produced.
(74) C. Attachment of the Targeting Moiety (e.g., Anti-CD138 Antibody) to the Interferon.
(75) In various embodiments, the targeting moiety (e.g., an anti-CD138 antibody) and the interferon can be joined together in any order. Thus, for example, the antibody can be joined to either the amino or carboxy terminal of the interferon. The antibody can also be joined to an internal region of the interferon, or conversely, the interferon can be joined to an internal location or to any terminus of the antibody, as long as the attachment does not interfere with binding of the antibody to that target marker (e.g., CD138).
(76) The antibody and the interferon (e.g., IFN-α, IFNβ, etc.) can be attached by any of a number of means well known to those of skill in the art. In certain embodiments, the interferon is conjugated, either directly or through a linker (spacer), to the antibody. In certain embodiments, however, it is preferable to recombinantly express the construct as a fusion protein (e.g., with a single chain antibody, or with one chain of a multi-chain antibody).
(77) i) Chemical Conjugation of the Targeting Moiety to the Interferon.
(78) In certain embodiments, the targeting moiety (e.g., an anti-CD138 antibody) is chemically conjugated to the interferon (e.g., IFN-α, IFNβ, mutIFNα, etc.) molecule. Means of chemically conjugating molecules are well known to those of skill.
(79) The procedure for conjugating two molecules varies according to the chemical structure of the agent. Polypeptides typically contain a variety of functional groups; e.g., carboxylic acid (COOH) or free amine (—NH.sub.2) groups that are available for reaction with a suitable functional group on the other peptide, or on a linker to join the molecules thereto.
(80) Alternatively, the antibody and/or the IFN-α can be derivatized to expose or attach additional reactive functional groups. The derivatization can involve attachment of any of a number of linker molecules such as those available from Pierce Chemical Company, Rockford Ill.
(81) A “linker”, as used herein, typically refers to a molecule that is used to join the antibody to the interferon. In various embodiments, the linker is capable of forming covalent bonds to both the antibody and to the interferon. Suitable linkers are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers. In certain embodiments, the linker(s) can be joined to the constituent amino acids of the antibody and/or the interferon through their side groups (e.g., through a disulfide linkage to cysteine). In certain preferred embodiments, the linkers are joined to the alpha carbon amino and/or carboxyl groups of the terminal amino acids of the antibody and/or the interferon.
(82) A bifunctional linker having one functional group reactive with a group on the antibody and another group reactive on the interferon, can be used to form the desired conjugate. Alternatively, derivatization can involve chemical treatment of the targeting moiety. Procedures for generation of, for example, free sulfhydryl groups on polypeptides, such as antibodies or antibody fragments, are known (See U.S. Pat. No. 4,659,839).
(83) Many procedures and linker molecules for attachment of various compounds including radionuclide metal chelates, toxins and drugs to proteins such as antibodies are known. See, for example, European Patent Application No. 188,256; U.S. Pat. Nos. 4,671,958, 4,659,839, 4,414,148, 4,699,784; 4,680,338; 4,569,789; and 4,589,071; and Borlinghaus et al. (1987) Cancer Res. 47: 4071-4075. In particular, production of various immunotoxins is well-known within the art and can be found, for example in “Monoclonal Antibody-Toxin Conjugates: Aiming the Magic Bullet,” Thorpe et al., Monoclonal Antibodies in Clinical Medicine, Academic Press, pp. 168-190 (1982); Waldmann (1991) Science, 252: 1657; U.S. Pat. Nos. 4,545,985 and 4,894,443, and the like.
(84) ii) Production of Fusion Proteins.
(85) In certain embodiments, a chimeric targeting moiety-interferon fusion protein is synthesized using recombinant DNA methodology. Generally this involves creating a DNA sequence that encodes the fusion protein, placing the DNA in an expression cassette under the control of a particular promoter, expressing the protein in a host, isolating the expressed protein and, if required, renaturing the protein.
(86) DNA encoding the fusion proteins or encoding one chain of the antibody attached to an interferon can be prepared by any suitable method, including, for example, cloning and restriction of appropriate sequences or direct chemical synthesis by methods such as the phosphotriester method of Narang et al. (1979) Meth. Enzymol. 68: 90-99; the phosphodiester method of Brown et al. (1979) Meth. Enzymol. 68: 109-151; the diethylphosphoramidite method of Beaucage et al. (1981) Tetra. Lett., 22: 1859-1862); the solid support method of U.S. Pat. No. 4,458,066, and the like.
(87) Chemical synthesis produces a single stranded oligonucleotide. This can be converted into double stranded DNA by hybridization with a complementary sequence, or by polymerization with a DNA polymerase using the single strand as a template. One of skill would recognize that while chemical synthesis of DNA is limited to sequences of about 100 bases, longer sequences may be obtained by the ligation of shorter sequences.
(88) Alternatively, subsequences can be cloned and the appropriate subsequences cleaved using appropriate restriction enzymes. The fragments can then be ligated to produce the desired DNA sequence.
(89) In certain embodiments, DNA encoding fusion proteins can be cloned using DNA amplification methods such as polymerase chain reaction (PCR). Thus, for example, the gene for IFN-α is PCR amplified, using a sense primer containing the restriction site for, e.g., NdeI and an antisense primer containing the restriction site for HindIII. This can produce a nucleic acid encoding the mature IFN-α sequence and having terminal restriction sites. An antibody having “complementary” restriction sites can similarly be cloned and then ligated to the IFN-α and/or to a linker attached to the IFN-α. Ligation of the nucleic acid sequences and insertion into a vector produces a vector encoding IFN-α joined to the anti-CD138 antibody.
(90) While the two molecules can be directly joined together, one of skill will appreciate that the molecules can be separated by a peptide spacer consisting of one or more amino acids. Generally the spacer will have no specific biological activity other than to join the proteins or to preserve some minimum distance or other spatial relationship between them. In certain embodiments, however, the constituent amino acids of the spacer can be selected to influence some property of the molecule such as the folding, net charge, or hydrophobicity.
(91) It was a surprising discovery, however, that certain linkers are unsuitable for preparation of fusion proteins of the present invention. Thus, for example, the (Gly.sub.4Ser).sub.3 (SEQ ID NO:1) linker was not well suited for the production of an anti-CD20-IFN-α construct. Without being bound to a particular theory, it is believed the interferon was being removed from the fusion protein by proteolysis. Western blot analysis using anti-Fc and anti-interferon, confirmed that both of the upper bands were heavy chains, but only the largest contained interferon.
(92) Accordingly, in certain preferred embodiments, it is desirable to use a linker that is resistant to proteolysis. Certain preferred linkers are linkers that are not the (Gly.sub.4Ser).sub.3 (SEQ ID NO:6) linker. Certain preferred linkers are linkers shorter than 15 amino acids, or linkers shorter than 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2 amino acids in length. In certain embodiments the linker is an alpha helical linker ranging in length up to about 12 or 13 or 14 amino acids in length.
(93) Certain illustrative proteolysis-resistant linkers well suited for use in the constructs of this invention are shown in Table 2.
(94) TABLE-US-00004 TABLE 2 Illustrative proteolysis- resistant linkers. SEQ Linker Seq ID NO GGG GGS GGGGS 7 SGGGGS 8 GGGGSGGGGS 9 A EAAAK A 10 A EAAAK EAAAK A 11 A EAAAK EAAAK EAAAK A 12 A EAAAK EAAAK EAAAK EAAAK A 13 A EAAAK EAAAK EAAAK EAAAK EAAAK A 14 AEAAAKEAAAKAG 15 AEAAAKEAAAKAGS 16 GGGGG 17 GGAGG 18 GGGGGGGG 19 GAGAGAGAGA 20 RPLSYRPPFPFGFPSVRP 21 YPRSIYIRRRHPSPSLTT 22 TPSHLSHILPSFGLPTFN 23 RPVSPFTFPRLSNSWLPA 24 SPAAHFPRSIPRPGPIRT 25 APGPSAPSHRSLPSRAFG 26 PRNSIHFLHPLLVAPLGA 27 MPSLSGVLQVRYLSPPDL 28 SPQYPSPLTLTLPPHPSL 29 NPSLNPPSYLHRAPSRIS 30 LPWRTSLLPSLPLRRRP 31 PPLFAKGPVGLLSRSFPP 32 VPPAPVVSLRSAHARPPY 33 LRPTPPRVRSYTCCPTP 34 PNVAHVLPLLTVPWDNLR 35 CNPLLPLCARSPAVRTFP 36 LGTPTPTPTPTGEF 37 EDFTRGKL 38 L EAAAR EAAAR EAAAR EAAAR 39 L EAAAR EAAAR EAAAR 40 L EAAAR EAAAR 41 L EAAAR 42 EAAAR EAAAR EAAAR EAAAR 43 EAAAR EAAAR EAAAR 44 EAAAR EAAAR 45 EAAAR 46
(95) The nucleic acid sequences encoding the fusion proteins can be expressed in a variety of host cells, including E. coli, other bacterial hosts, yeast, and various higher eukaryotic cells such as the COS, CHO and HeLa cells lines and myeloma cell lines. The recombinant protein gene is typically operably linked to appropriate expression control sequences for each host. For E. coli this includes a promoter such as the T7, trp, or lambda promoters, a ribosome binding site and preferably a transcription termination signal. For eukaryotic cells, the control sequences will include a promoter and preferably an enhancer derived from immunoglobulin genes, SV40, cytomegalovirus, etc., and a polyadenylation sequence, and may include splice donor and acceptor sequences.
(96) The plasmids of the invention can be transferred into the chosen host cell by well-known methods such as calcium chloride transformation for E. coli and calcium phosphate treatment or electroporation for mammalian cells. Cells transformed by the plasmids can be selected by resistance to antibiotics conferred by genes contained on the plasmids, such as the amp, gpt, neo and hyg genes.
(97) Once expressed, the recombinant fusion proteins can be purified according to standard procedures of the art, including ammonium sulfate precipitation, affinity columns, column chromatography, gel electrophoresis and the like (see, generally, R. Scopes (1982) Protein Purification, Springer-Verlag, N.Y.: Deutscher (1990) Methods in Enzymology Vol. 182: Guide to Protein Purification., Academic Press, Inc. N.Y., and the like). Substantially pure compositions of at least about 90 to 95% homogeneity are preferred, and 98 to 99% or more homogeneity are most preferred for pharmaceutical uses. Once purified, partially or to homogeneity as desired, the polypeptides may then be used therapeutically.
(98) One of skill in the art would recognize that after chemical synthesis, biological expression, or purification, the fusion protein (e.g., anti-CD138-IFN-α, anti-CD138-mutIFN-α, etc.) may possess a conformation substantially different than the native conformations of the constituent polypeptides. In this case, it may be necessary to denature and reduce the polypeptide and then to cause the polypeptide to re-fold into the preferred conformation. Methods of reducing and denaturing proteins and inducing re-folding are well known to those of skill in the art (see, e.g., Debinski et al. (1993) J. Biol. Chem., 268: 14065-14070; Kreitman and Pastan (1993) Bioconjug. Chem., 4: 581-585; and Buchner, et al. (1992) Anal. Biochem., 205: 263-270). Debinski et al., for example, describe the denaturation and reduction of inclusion body proteins in guanidine-DTE. The protein is then refolded in a redox buffer containing oxidized glutathione and L-arginine.
(99) In certain embodiments a transient expression system can be used to express the chimeric constructs described herein. Although many cell lines potentially can be used, one cell line that works well for transient expression is 293T. For transient expression of 293T on Day 0, 9 million cells in 25 ml are seeded for each 150 mm tissue culture plate. A 1 mg/ml of PEI (Polyethylenimine) is made using sterile water. For the expression of a complete antibody or antibody fusion protein, 25 μg each of H and L (50 ug total) is used per plate. A volume of 5 ml is used for transfection of each 150 mm plate. The DNA is mixed with DMEM, the PEI is then added and the mixture is incubated at room temperature for 10 mins. 1.75 μg PEI is used for each ug of DNA. For transfection, the old medium is removed, discarded and replaced with 20 ml of fresh medium (Iscoves+5% calf serum). The transfection mix is added and the plate is swirled. On Day 2, the medium is replaced with 30 ml of Iscoves medium containing 1% FBS (fetal bovine serum) to minimize the amount of bovine Ig present. Supernatants are collected from the cells on Days 4, 6 and 13 by removing the medium and replacing it with 30 ml of fresh Iscoves containing 1% FBS.
(100) The cloning and expression of an anti-CD138-IFN-α fusion protein is illustrated herein in Example 1.
(101) One of skill would recognize these expression methods are illustrative and not limiting. Modifications can be made to the fusion proteins described herein without diminishing their activity/efficacy. Some modifications may be made to facilitate the cloning, expression, or incorporation of the targeting molecule into a fusion protein. Such modifications are well known to those of skill in the art and include, for example, a methionine added at the amino terminus to provide an initiation site, or additional amino acids placed on either terminus to create conveniently located restriction sites or termination codons.
(102) Other modifications can be made to increase serum half-life and/or bioavailability. Such modifications include, but are not limited to the incorporation of D amino acids (especially in the linker), the use of non-naturally occurring amino acids, pegylation of the fusion protein, and the like.
(103) D. Other Multi-valent Targeting Moieties.
(104) In certain embodiments this invention contemplates the use of multivalent, preferably trivalent, quadravalent, pentavalent or greater targeting moieties to target the interferon to a target cell.
(105) For example, multivalent anti-CD138 moieties can be produced by any of a number of methods. For example, linkers having three, four, or more reactive sites can be reacted with anti-CD138 antibodies to form a trimer or greater conjugate.
(106) In certain embodiments, phage display, yeast display, bacterial display, or other display systems can be used to express and display multiple copies (e.g., at least 3, at least 4, at least 5, at least 6 copies, etc.) of a targeting antibody (e.g., anti-CD138 such as B-B4) and thereby effectively provide a multivalent targeting moiety.
(107) In certain embodiments the use of diabodies and triabodies (e.g., comprising two domains that bind CD-138 or one domain that binds CD138 and another domain that binds, for example, a member of the EGFR receptor family (e.g., EGFR, HER3, etc.). Typically, diabodies comprise a heavy (VH) chain variable domain connected to a light chain variable domain (VL) on the same polypeptide chain (VH-VL) connected by a peptide linker that is too short to allow pairing between the two domains on the same chain. This forces pairing with the complementary domains of another chain and promotes the assembly of a dimeric molecule with two functional antigen binding sites (see, e.g., Holliger et al. (1993) Proc. Natl. Acad. Sci., 90: 6444-6448). In certain embodiments to construct bispecific diabodies the V-domains of antibody A and antibody B are fused to create the two chains VHA-VLB, VHB-VLA. Each chain is inactive in binding to antigen, but recreates the functional antigen binding sites of antibodies A and B on pairing with the other chain.
(108) II. Combined Uses.
(109) The constructs described herein are useful for inhibiting the growth and/or proliferation of target cells (e.g., cancer cells). In various embodiments the constructs can be used to inhibit disease progression, to reduce the rate of secondary tumor formation, to shrink tumor size, and/or to stabilize regression/remission.
(110) Particularly in the treatment of cancer, the constructs, formulations, and methods described herein may also include additional therapeutic and/or pharmacologically acceptable agents. For instance, the constructs, formulations, or methods may involve other agents for the treatment of cancer. Such agents include, but are not limited to alkylating agents (e.g., mechlorethamine (Mustargen), cyclophosphamide (Cytoxan, Neosar), ifosfamide (Ifex), phenylalanine mustard; melphalen (Alkeran), chlorambucol (Leukeran), uracil mustard, estramustine (Emcyt), thiotepa (Thioplex), busulfan (Myerlan), lomustine (CeeNU), carmustine (BiCNU, BCNU), streptozocin (Zanosar), dacarbazine (DTIC-Dome), cis-platinum, cisplatin (PLATINOL® (cisplatin), PLATINOL® (cisplatin) AQ), carboplatin (Paraplatin), altretamine (Hexalen), etc.), antimetabolites (e.g. methotrexate (Amethopterin, Folex, Mexate, Rheumatrex), 5-fluoruracil (Adrucil, Efudex, Fluoroplex), floxuridine, 5-fluorodeoxyuridine (FUDR), capecitabine (Xeloda), fludarabine: (Fludara), cytosine arabinoside (Cytaribine, Cytosar, ARA-C), 6-mercaptopurine (Purinethol), 6-thioguanine (Thioguanine), gemcitabine (Gemzar), cladribine (Leustatin), deoxycoformycin; pentostatin (Nipent), etc.), antibiotics (e.g. doxorubicin (Adriamycin, Rubex, Doxil, Daunoxome-liposomal preparation), daunorubicin (Daunomycin, Cerubidine), idarubicin (Idamycin), valrubicin (Valstar), mitoxantrone (Novantrone), dactinomycin (Actinomycin D, Cosmegen), mithramycin, plicamycin (Mithracin), mitomycin C (Mutamycin), bleomycin (Blenoxane), procarbazine (Matulane), etc.), mitotic inhibitors (e.g. paclitaxel (Taxol), docetaxel (Taxotere), vinblatine sulfate (Velban, Velsar, VLB), vincristine sulfate (Oncovin, Vincasar PFS, Vincrex), vinorelbine sulfate (Navelbine), etc.), chromatin function inhibitors (e.g., topotecan (Camptosar), irinotecan (Hycamtin), etoposide (VP-16, VePesid, Toposar), teniposide (VM-26, Vumon), etc.), hormones and hormone inhibitors (e.g. diethylstilbesterol (Stilbesterol, Stilphostrol), estradiol, estrogen, esterified estrogens (Estratab, Menest), estramustine (Emcyt), tamoxifen (Nolvadex), toremifene (Fareston) anastrozole (Arimidex), letrozole (Femara), 17-OH-progesterone, medroxyprogesterone, megestrol acetate (Megace), goserelin (Zoladex), leuprolide (Leupron), testosteraone, methyltestosterone, fluoxmesterone (Android-F, Halotestin), flutamide (Eulexin), bicalutamide (Casodex), nilutamide (Nilandron), etc.), inhibitors of synthesis (e.g., aminoglutethimide (Cytadren), ketoconazole (Nizoral), etc.), immunomodulators (e.g., RITUXIMAB® (Rituxan), trastuzumab (HERCEPTIN®), denileukin diftitox (Ontak), levamisole (Ergamisol), bacillus Calmette-Guerin, BCG (TheraCys, TICE BCG), interferon alpha-2a, alpha 2b (Roferon-A, Intron A), interleukin-2, aldesleukin (ProLeukin), etc.) and other agents such as 1-aspariginase (Elspar, Kidrolase), pegaspasgase (Oncaspar), hydroxyurea (Hydrea, Doxia), leucovorin (Wellcovorin), mitotane (Lysodren), porfimer (Photofrin), tretinoin (Veasnoid), and the like.
(111) III. Pharmaceutical Compositions.
(112) In certain embodiments, in order to carry out the methods described herein, one or more active agents (constructs described herein) are administered, e.g. to an individual diagnosed as having (or at risk for) a cancer. The active agent(s) can be administered in the “native” form or, if desired, in the form of salts, esters, amides, prodrugs, derivatives, and the like, provided the salt, ester, amide, prodrug or derivative is suitable pharmacologically, i.e., effective in the present method. Salts, esters, amides, prodrugs and other derivatives of the active agents can be prepared using standard procedures known to those skilled in the art of synthetic organic chemistry and described, for example, by March (1992) Advanced Organic Chemistry; Reactions, Mechanisms and Structure, 4th Ed. N.Y. Wiley-Interscience.
(113) For example, acid addition salts are prepared from the free base using conventional methodology that typically involves reaction with a suitable acid. Generally, the base form of the drug is dissolved in a polar organic solvent such as methanol or ethanol and the acid is added thereto. The resulting salt either precipitates or can be brought out of solution by addition of a less polar solvent. Suitable acids for preparing acid addition salts include both organic acids, e.g., acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malic acid, malonic acid, succinic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid, and the like, as well as inorganic acids, e.g., hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like. An acid addition salt may be reconverted to the free base by treatment with a suitable base. Particularly preferred acid addition salts of the active agents herein are halide salts, such as may be prepared using hydrochloric or hydrobromic acids. Conversely, preparation of basic salts of the active agents of this invention are prepared in a similar manner using a pharmaceutically acceptable base such as sodium hydroxide, potassium hydroxide, ammonium hydroxide, calcium hydroxide, trimethylamine, or the like. Particularly preferred basic salts include alkali metal salts, e.g., the sodium salt, and copper salts.
(114) Preparation of esters typically involves functionalization of hydroxyl and/or carboxyl groups which may be present within the molecular structure of the drug. The esters are typically acyl-substituted derivatives of free alcohol groups, i.e., moieties that are derived from carboxylic acids of the formula RCOOH where R is alky, and preferably is lower alkyl. Esters can be reconverted to the free acids, if desired, by using conventional hydrogenolysis or hydrolysis procedures.
(115) Amides and prodrugs can also be prepared using techniques known to those skilled in the art or described in the pertinent literature. For example, amides may be prepared from esters, using suitable amine reactants, or they may be prepared from an anhydride or an acid chloride by reaction with ammonia or a lower alkyl amine. Prodrugs are typically prepared by covalent attachment of a moiety that results in a compound that is therapeutically inactive until modified by an individual's metabolic system.
(116) The active agents (e.g., constructs) described herein are useful for parenteral, topical, oral, nasal (or otherwise inhaled), rectal, or local administration, such as by aerosol or transdermally, for prophylactic and/or therapeutic treatment of one or more of the pathologies/indications described herein (e.g., atherosclerosis and/or symptoms thereof). The pharmaceutical compositions can be administered in a variety of unit dosage forms depending upon the method of administration. Suitable unit dosage forms, include, but are not limited to powders, tablets, pills, capsules, lozenges, suppositories, patches, nasal sprays, injectables, implantable sustained-release formulations, lipid complexes, etc.
(117) In various embodiments the active agents (e.g., constructs) described herein are typically combined with a pharmaceutically acceptable carrier (excipient) to form a pharmacological composition. Pharmaceutically acceptable carriers can contain one or more physiologically acceptable compound(s) that act, for example, to stabilize the composition or to increase or decrease the absorption of the active agent(s). Physiologically acceptable compounds can include, for example, carbohydrates, such as glucose, sucrose, or dextrans, antioxidants, such as ascorbic acid or glutathione, chelating agents, low molecular weight proteins, protection and uptake enhancers such as lipids, compositions that reduce the clearance or hydrolysis of the active agents, or excipients or other stabilizers and/or buffers.
(118) Other physiologically acceptable compounds include wetting agents, emulsifying agents, dispersing agents or preservatives that are particularly useful for preventing the growth or action of microorganisms. Various preservatives are well known and include, for example, phenol and ascorbic acid. One skilled in the art would appreciate that the choice of pharmaceutically acceptable carrier(s), including a physiologically acceptable compound depends, for example, on the route of administration of the active agent(s) and on the particular physio-chemical characteristics of the active agent(s).
(119) The excipients are preferably sterile and generally free of undesirable matter. These compositions may be sterilized by conventional, well-known sterilization techniques.
(120) In therapeutic applications, the constructs described herein or formulations comprising such constructs are administered to a subject, e.g., to patient suffering e.g. from a cancer, or at risk of cancer (e.g. after surgical removal of a primary tumor) in an amount sufficient to prevent and/or cure and/or or at least partially prevent or arrest the disease and/or its complications. An amount adequate to accomplish this is defined as a “therapeutically effective dose.” Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health. Single or multiple administrations of the compositions may be administered depending on the dosage and frequency as required and tolerated by the patient. In any event, the composition should provide a sufficient quantity of the active agents of the formulations of this invention to effectively treat (ameliorate one or more symptoms) the patient.
(121) The concentration of active agent(s) can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the patient's needs. Concentrations, however, will typically be selected to provide dosages ranging from about 0.1 or 1 mg/kg/day to about 50 mg/kg/day and sometimes higher. Typical dosages range from about 3 mg/kg/day to about 3.5 mg/kg/day, preferably from about 3.5 mg/kg/day to about 7.2 mg/kg/day, more preferably from about 7.2 mg/kg/day to about 11.0 mg/kg/day, and most preferably from about 11.0 mg/kg/day to about 15.0 mg/kg/day. In certain preferred embodiments, dosages range from about 10 mg/kg/day to about 50 mg/kg/day. In certain embodiments, dosages range from about 20 mg to about 50 mg given orally twice daily. It will be appreciated that such dosages may be varied to optimize a therapeutic regimen in a particular subject or group of subjects.
(122) In certain embodiments, the active agents (e.g., constructs described herein) are administered orally (e.g. via a tablet) or as an injectable in accordance with standard methods well known to those of skill in the art. In other preferred embodiments, the constructs may also be delivered through the skin using conventional transdermal drug delivery systems, i.e., transdermal “patches” wherein the active agent(s) are typically contained within a laminated structure that serves as a drug delivery device to be affixed to the skin. In such a structure, the drug composition is typically contained in a layer, or “reservoir,” underlying an upper backing layer. It will be appreciated that the term “reservoir” in this context refers to a quantity of “active ingredient(s)” that is ultimately available for delivery to the surface of the skin. Thus, for example, the “reservoir” may include the active ingredient(s) in an adhesive on a backing layer of the patch, or in any of a variety of different matrix formulations known to those of skill in the art. The patch may contain a single reservoir, or it may contain multiple reservoirs.
(123) In one embodiment, the reservoir comprises a polymeric matrix of a pharmaceutically acceptable contact adhesive material that serves to affix the system to the skin during drug delivery. Examples of suitable skin contact adhesive materials include, but are not limited to, polyethylenes, polysiloxanes, polyisobutylenes, polyacrylates, polyurethanes, and the like. Alternatively, the drug-containing reservoir and skin contact adhesive are present as separate and distinct layers, with the adhesive underlying the reservoir which, in this case, may be either a polymeric matrix as described above, or it may be a liquid or hydrogel reservoir, or may take some other form. The backing layer in these laminates, which serves as the upper surface of the device, preferably functions as a primary structural element of the “patch” and provides the device with much of its flexibility. The material selected for the backing layer is preferably substantially impermeable to the active agent(s) and any other materials that are present.
(124) In certain embodiments elevated serum half-life can be maintained by the use of sustained-release protein “packaging” systems. Such sustained release systems are well known to those of skill in the art. In one preferred embodiment, the ProLease™ biodegradable microsphere delivery system for proteins and peptides (see, e.g., Tracy (1998) Biotechnol. Prog. 14: 108; Johnson et al. (1996), Nature Med. 2: 795; Herbert et al. (1998), Pharmaceut. Res. 15, 357) a dry powder composed of biodegradable polymeric microspheres containing the active agent in a polymer matrix that can be compounded as a dry formulation with or without other agents.
(125) The ProLease™ microsphere fabrication process was specifically designed to achieve a high encapsulation efficiency while maintaining integrity of the active agent. The process consists of (i) preparation of freeze-dried drug particles from bulk by spray freeze-drying the drug solution with stabilizing excipients, (ii) preparation of a drug-polymer suspension followed by sonication or homogenization to reduce the drug particle size, (iii) production of frozen drug-polymer microspheres by atomization into liquid nitrogen, (iv) extraction of the polymer solvent with ethanol, and (v) filtration and vacuum drying to produce the final dry-powder product. The resulting powder contains the solid form of the active agents, which is homogeneously and rigidly dispersed within porous polymer particles. The polymer most commonly used in the process, poly(lactide-co-glycolide) (PLG), is both biocompatible and biodegradable.
(126) Encapsulation can be achieved at low temperatures (e.g., −40° C.). During encapsulation, the protein is maintained in the solid state in the absence of water, thus minimizing water-induced conformational mobility of the protein, preventing protein degradation reactions that include water as a reactant, and avoiding organic-aqueous interfaces where proteins may undergo denaturation. A preferred process uses solvents in which most proteins are insoluble, thus yielding high encapsulation efficiencies (e.g., greater than 95%).
(127) In another embodiment, one or more components of the solution can be provided as a “concentrate”, e.g., in a storage container (e.g., in a premeasured volume) ready for dilution, or in a soluble capsule ready for addition to a volume of water.
(128) The foregoing formulations and administration methods are intended to be illustrative and not limiting. It will be appreciated that, using the teaching provided herein, other suitable formulations and modes of administration can be readily devised.
(129) IV. Kits.
(130) In certain embodiments, kits for the treatment of a primary cancer and/or in an adjunct therapy are provided. In various embodiments the kits typically comprise a container containing a construct described herein (e.g., anti-CD138-IFNα, anti-138-mutIFNα, anti-CD138-IFNβ, etc.). In various embodiments the construct can be present in a pharmacologically acceptable excipient.
(131) In addition the kits can optionally include instructional materials disclosing means of use of the chimeric moiety (e.g. to treat a cancer and/or as an adjunct therapeutic). The instructional materials may also, optionally, teach preferred dosages, counter-indications, and the like.
(132) The kits can also include additional components to facilitate the particular application for which the kit is designed. Thus, for example, in certain embodiments, the kit can additionally contain one or more additional anti-cancer drugs (e.g., doxirubicin, vinblastine, etc.), and the like.
(133) While the instructional materials typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention. Such media include, but are not limited to electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. Such media may include addresses to internet sites that provide such instructional materials.
EXAMPLES
(134) The following examples are offered to illustrate, but not to limit the claimed invention.
Example 1
Anti-CD138-IFNα and Anti-CD138-mutIFNα Constructs Demonstrate Potent Apoptotic and Anti-Tumor Activities Against Multiple Myeloma
(135) Materials and Methods
(136) Cell Lines
(137) HMCL cell lines were cultured in RPMI 1640 (Invitrogen, Carlsbad, Calif.) supplemented with 5% fetal calf serum (FCS; Atlanta Biologics, Lawrenceville, Ga.). ANBL-6 cells were cultured as described with the addition of 2 ng/mL of IL-6. Chinese Hamster Ovary (CHO) cells were cultured in IMDM supplemented with 5% FCS. Daudi cells were purchased from ATCC and grown in RPMI 1640 supplemented with 2 mM L-glutamine, 50 μM β-mercaptoethanol, and 10% FCS.
(138) Construction of Expression Vectors
(139) The heavy and light chain variable region amino acid sequences of an anti-CD138 antibody were obtained from US Patent Publication No: 2009/0175,863, which is incorporated herein by reference for the antibodies, and amino acid sequences (e.g., VH and VL sequences) described herein. A signal peptide with the amino acids
(140) TABLE-US-00005 (SEQ ID NO: 47) MGWSYIILFLVATATGVHS
was added 5′ of the heavy chain variable region. Similarly, a signal peptide with the amino acids
(141) TABLE-US-00006 (SEQ ID NO: 48) MKSQTQVFIFLLLCVSGAHG
was added 5′ of the light chain variable region. The amino acid sequences were sent to DNA 2.0 for custom DNA synthesis using codons optimized for CHO expression. The nucleotide sequence
(142) TABLE-US-00007 (SEQ ID NO: 49) 5′ GGATATCCACC 3′,
containing a Kozak ribosomal recognition site, was also added 5′ of each sequence to facilitate downstream cloning. To further facilitate downstream cloning, the sequence
(143) TABLE-US-00008 (SEQ ID NO: 50) 5′ GCTAGCC 3′
was added 3′ of the heavy chain variable region, and the sequence
(144) TABLE-US-00009 (SEQ ID NO: 51) 5′ CGTAAGTCGACG 5′
was added 3′ of the light chain variable region.
(145) The heavy chain variable region flanked by EcoRV and NheI restriction sites was sequence verified and cloned into an expression vector containing IgG1 alone, or IgG1 fused to human interferon alpha (hIFNα). The light chain variable region flanked by EcoRV and SalI restriction sites was also sequence verified before cloning into an expression vector containing a human kappa constant region.
(146) TABLE-US-00010 VH sequence: (SEQ ID NO: 52) M G W S Y I I L F L V A T A T G V H S Q V Q L Q Q S G S E L M M P G A S V K I S C K A T G Y T F S N Y W I E W V K Q R P G H G L E W I G E I L P G T G R T I Y N E K F K G K A T F T A D I S S N T V Q M Q L S S L T S E D S A V Y Y C A R R D Y Y G N F Y Y A M D Y W G Q G T S V T V S S VL sequence: (SEQ ID NO: 53) M K S Q T Q V F I F L L L C V S G A H G D I Q M T Q S T S S L S A S L G D R V T I S C S A S Q G I N N Y L N W Y Q Q K P D G T V E L L I Y Y T S T L Q S G V P S R F S G S G S G T D Y S L T I S N L E P E D I G T Y Y C Q Q Y S K L P R T F G G G T K L E I K
(147) To construct anti-CD138-mutIFNα, nested polymerase chain reaction (PCR) was used to introduce three amino acid mutations—H57Y, E58N, and Q61S. The first round of PCR was done using the forward primer
(148) TABLE-US-00011 (SEQ ID NO: 54) 5′-CGC GGA TCC TGT GAT CTG CCT CAA ACC CAC-3′
and reverse primer
(149) TABLE-US-00012 (SEQ ID NO: 55) 5′-CCT CTA GAA TCA TTC CTT ACT TCT TAA ACT-3′.
The nested PCR was done using forward primer
(150) TABLE-US-00013 (SEQ ID NO: 56) 5′-CCTGTCCTCTACAATATGATCTCACAGATCTTC-3′
and reverse primer
(151) TABLE-US-00014 (SEQ ID NO: 57) 5′-GAAGATCTGTGAGATCATATTGTAGAGGACAGG-3′,
which contain the mutations to IFNα. The insert was cloned into pCR2.1-TOPO vector (Invitrogen) and DNA sequence was verified. The XbaI/BamHI fragment containing the mutIFNα sequence was cloned into an anti-CD20 human γ1 H chain-IFNβ fusion vector pAH6747, yielding pAH11015. The BamHI/AvrII fragment from pAH11015 was then used to replace the wild-type IFNα sequence from expression vector pAH6905, which contains the anti-CD138 V.sub.H yielding vector pAH11016.
(152) Protein Production and Purification
(153) Fusion proteins were produced in CHO cells by transfection of H and L chain expression vectors. Stably transfected cells were isolated by selection on histidinol. For IgG and IgG fusion protein production, cells were seeded into roller bottles. At confluency, cells were expanded to 100 mL with IMDM+1% Fetal Clone (Thermo Fisher, Waltham, Mass.). The supernatant was removed every 2-3 days and replaced with fresh medium. Cell free culture supernatants were then passed through a protein A-Sepharose 4B fast flow column (Sigma-Aldrich, St. Louis, Mo.) and the bound protein eluted with 0.1 M citric acid, pH 3.5. Eluted fractions were neutralized immediately with 2 M Tris-HCl pH 8.0. Fractions were run on SDS-PAGE gels and stained with Coomassie blue to verify protein purity and integrity. Concentrations of proteins were determined using the BCA assay (Pierce, Rockford, Ill.). Anti-CD20-IFNα used as untargeted control protein was produced as described previously (Xuan et al. (2010) Blood, 115: 2864-2871).
(154) Cell Viability Assay
(155) HMCLs were seeded in 96-well plates and incubated with 0.00002 pM-25 nM of anti-CD20-IFNα, IFNα, anti-CD138-IFNα or anti-CD138-mutIFNα or anti-CD138-IFNα at 37° C. in a 5% CO.sub.2 atmosphere for 3, 4 or 7 days. Percent cell viability was determined using MTS solution (Promega, Madison, Wis.) by measuring absorbance at 490 nm using a Synergy HT Multi-Detection Microplate Reader (BioTek Instruments, Inc., Winooski, Vt.) with untreated cells being 100%. GraphPad Prism (GraphPad Software Inc., La Jolla, Calif.) was used to analyze data by non-linear regression with the log (inhibitor) vs. the response with a variable slope with the IC.sub.50 calculated. Data are expressed as a percentage of maximum metabolic activity. The experiments were performed in triplicate.
(156) Apoptosis Assay
(157) Cells were incubated with 500 pM of IFNα, anti-CD138-IFNα or anti-CD138-mutIFNα for 3 days and stained with Alexa Fluor 488 labeled Annexin V and propidium iodide (PI) using the Vybrant Apoptosis Kit #2 (Molecular Probes, Carlsbad, Calif.) as per manufacturer's instructions. Cells were analyzed by flow cytometry using FlowJo software.
(158) Cell Cycle Analysis
(159) Cells were treated with 500 pM of IFNα, anti-CD138-IFNα, or anti-CD138-mutIFNα for 4 days. Cells were incubated with 1 ml of hypotonic DNA staining buffer (1 mg/ml sodium citrate, 100 μg/ml PI, 20 μg/ml RNase A, and 0.3% Triton X-100 in dH.sub.2O) for 30-60 min at 4° C. in the dark. Cells were analyzed by flow cytometry and cell cycle analysis performed using FlowJo software with the Watson Model.
(160) Cell Proliferation Assay
(161) Cells were treated for 3 days with 0.3 pM-25 nM IFNα, anti-CD138-IFNα, or anti-CD138-mutIFNα. The proliferative status of the cells was determined by measuring .sup.3[H]-thymidine incorporation.
(162) β-Gal Activity as a Marker for Senescent Cells
(163) Senescence induced β-galactosidase (β-gal) activity was detected as described previously (Debacq-Chainiaux et al. (2009) Nature Protocols, 4: 1798-1806). Briefly, cells were treated with 1 nM of anti-CD138 IgG, anti-CD138-IFNα or anti-CD138-mutIFNα for 3, 4, 6 or 7 days. To induce lysosomal alkalinization, cells were incubated in 100 nM bafilomycin A1 (Sigma) for 1 h. Then cells were incubated for 30 min with the β-gal substrate dodecanoylaminofluorescein di-β-D-galactopyranoside (C.sub.12FDG; Invitrogen), which becomes fluorescent after cleavage by β-gal. After washing twice with cold PBS, cells were resuspended in cold PBS containing 1 mM phenylethyl thiogalactoside (PETG), a β-gal inhibitor, and analyzed by flow cytometry for C.sub.12-fluorescein.
(164) Treatment of Primary MM Cells from Patients
(165) Patients with active myeloma were biopsied while off therapy and myeloma cells isolated by negative antibody selection to >95% purity. Cells were incubated with 25 or 100 nM of anti-CD138 IgG, anti-CD138-IFNα or anti-CD138-mutIFNα for 24, 48 or 72 h. Trypan blue and MTT assays were used to determine the number of viable cells. The percentage of viable recovered cells was calculated based upon the number of viable cells recovered from DMSO-treated control cells, which was arbitrarily designated as 100%.
(166) Western Blots
(167) Cells were treated for 48 h with anti-CD138, IFNα, IFNβ, anti-CD138-IFNα, or anti-CD138-mutIFNα. Cells were lysed using RIPA buffer (50 mM Tris HCl pH 8, 150 mM NaCl, 1% NP-40, 0.5% sodium deoxycholate, 0.1% SDS) containing a protease inhibitor cocktail (Roche Applied Science, Indianapolis, Ind.). The cytosolic fractions were reduced with β-mercaptoethanol and separated by SDS-PAGE. Following transfer to nitrocellulose membrane (Whatman, Piscataway, N.J.) and blocking, samples were incubated with the following primary rabbit antibodies: anti-IRF4 (Epitomics, Berlingham, Calif.), anti-glyceraldehyde-3-phosphate dehydrogenase (GAPDH; Sigma), anti-ppRb Ser807/811 (Santa Cruz Biotechnology, Santa Cruz, Calif.), anti-cyclin D (Millipore, Billerica, Mass.), or anti-β tubulin (Abcam, Cambridge, Mass.). Secondary anti-rabbit IgG-HRP (GE Healthcare, Billerica, Mass.) was used and the blots were developed using enhanced chemiluminescence (ECL; Thermo Scientific, Waltham, Mass.).
(168) In Vivo Anti-tumor Activity Against OCI-My 5 and U266 Cells
(169) Six- to eight-week old female SCID white mice were used to establish OCI-My 5 tumors. After washing in cold HBSS (Invitrogen), mice were inoculated subcutaneously with 1×10.sup.7 cells in 200 μl of HBSS at the base of the tail. Mice were treated intravenously with PBS, 100 μg of anti-CD138, anti-dansyl (DNS)-IFNα, anti-CD138-IFNα, anti-CD20-mutIFNα, or anti-CD138-mutIFNα on days 14, 16, 18 post tumor challenge. Eight mice were included in each group. Bidirectional tumor growth measurements were obtained throughout the experiment, and mice were sacrificed when tumors reached 1.5 cm in diameter as per institutional guidelines. All studies were performed in compliance with the U.S. Department of Health and Human Services Guide for the Care and Use of Laboratory Animals and were approved by the UCLA Animal Research Committee.
(170) For U266 tumors, NOD scid IL-2 receptor gamma chain knock out (NSG) mice were injected subcutaneously with 1×10.sup.7 U226 cells and treated on days 14, 16 and 18 with 100 μg of the indicated proteins. One group was treated two additional times with anti-CD138-mutIFNα on days 25, 32 and 63. Eight mice were treated for each group except 6 mice for the group that received six treatments with anti-CD138-mutIFNα. Survival was monitored as well as the size of the tumors.
(171) Results
(172) Production and Characterization of Anti-CD138-IFNα Fusion Proteins
(173) The V.sub.H and V.sub.L of the anti-CD138 antibody B-B4 were cloned into vectors for the expression of human anti-CD138 IgG1 either unfused or fused to IFNα (
(174) Anti-CD138-IFNα Fusion Protein is Effective Against Some MM Cell Lines
(175) MM cell lines have been shown to differ in their responses to various drugs and treatment. They also show biological and genetic heterogeneity and have been classified using various methods (Carrasco et al. (2006) Cancer Cell 9: 313-325; Drexler et al. (2000) Leukemia, 14: 777-782; Lombardi et al. (2006) Genes Chromosomes Cancer, 46: 226-238; Moreaux et al. (2011) Haematologica, 96: 574-582). Therefore, we assembled a panel of thirteen MM cell lines (XG-1, XG-2, OPM-1, OPM-2, S6B45, Delta 47, 8266/Dox40, 8266/S, H929, ANBL-6, MM144, U266, and OCI-My 5) to investigate their response to IFNα and the fusion protein. The panel includes both hyperdiploid and nonhyperdiploid cells with various chromosomal translocations (Table 3). Anti-CD138 IgG was found to bind all of the MM cell lines but did not bind to Daudi cells (data not shown), indicating that they express CD138 antigen.
(176) TABLE-US-00015 TABLE 3 Panel of MM cell lines. Mode of Action of anti- CD138- Cell IFNα Line Ras TP53 RB MYC fusion XG-1 Hypodiploid 11q13::14q32 CCND1 mut abnormal 8q24::14q32 Monosomy 13 XG-2 Hyperdiploid 12q24.31::14q32 Unknown mut abnormal (unknown target target) MAFB insCλ20q11 on 20t(11; 14:?) (q13; q32; ?) OPM-1 Hyperdiploid der(4), CH insertion 74 der(14) of ins(Cq; 14) t(1; 8)(q12?; 124): i(ins(Cq; 14)) der(8) OPM-2 Hyperdiploid 4; 14 FGFR3 wt abnormal 8; 14 67 der(4), der and CH insertion (14) MMSET on ins(Cq; 14) t(1; 8)(q12?; 1wr): der(8) S6B45 Wt and mutated Delta 47 Hyperdiploid 11?p insCλ@8q24 45 on der(19)t(8; 19) (q13; q13) 8226/Dox 40 8226/SAka Hyperdiploid 14; 16 c-maf mut abnormal one c-myc Apoptosis RPMI8266*** 60 t(1; 14)(p13; allelic insertion on q32) loss t(16; 22)(q23; 111):der(16) H929 Hyperdiploid 14p16::14q32 Overexp mut Wt one 8q24::20q11 Apoptosis 45 FGFR3 allelic T(8; 20)q24; ?): Block in and loss der(8) cell cycle MMSET ANBL-6 Hyperdiploid 14q32::16q23 Overexp Wt abnormal ? Apoptosis 82 c-maf MM144 14; 16 Overexp ? ? ? Apoptosis c-maf Block in cell cycle U266* Hyperdiploid Insertion at* Overexp Wt abnormal biallelic LMYC (not Apoptosis 39 Cyclin loss c-myc) D1 tp13::1p34 OCI- Hyperdiploid 14q32::16q23 Overexp ? ? ? 8q24::14q32 & Block in My 5 46 c-maf dup(14)(q32q?22) cell cycle senescence† †Apoptosis and senescence was observed only with anti-CD138-mutIFNα treatment and not with IFNα alone or anti-CD138-IFNα treatment *U266-Lombardi and Moreaux says t(11; 14) while Gabrea says 11q13 on der(11)t(11; ?)(q14; ?) ***This cell line may be the same as RPMI-8226. There is conflicting data as Lombardi says that RPMI-8226 has complex rearrangement involving “c-MYC insertion on t(16; 22)(q32; q11):der(16)” but Moreaux says 14; 16 $Zhang (1994) The designation t(A; B)(p1; q2) is used to denote a translocation between chromosome A and chromosome B. The information in the second set of parentheses, when given, gives the precise location within the chromosome for chromosomes A and B respectively - with p indicating the short arm of the chromosome, q indicating the long arm, and the numbers after p or q refer to regions, bands and subbands seen when staining the chromosome with a staining dye. See also the definition of a “genetic locus”.
(177) To determine if the HMCLs were sensitive to treatment with IFNα fusion protein, HMCLs were incubated with varying concentrations of anti-CD138-IFNα, and cell viability was assessed. Anti-CD138-IFNα was used to target IFNα to the MM cell lines while anti-CD20-IFNα was used as an untargeted control. After 3 days of treatment, cell viability was measured by MTS activity. The MM cell lines differed in their response to treatment with the fusion proteins. The targeted anti-CD138-IFNα was found to be more effective than untargeted anti-CD20-IFNα for H929, ANBL-6, U266, MM144 and OCI-My 5 cell lines. The fusion protein had little or no effect on the XG-1, XG-2, OPM-1, OPM-2, Delta 47 cell lines while an intermediate effect was observed for S6B45, 8266/Dox40, and 8266S (
(178) The Effects of IFNα, Anti-CD138-IFNα and Anti-CD138-mutIFNα Fusion Proteins on HMCLs
(179) IFNα and IFNβ share a common receptor comprised of two transmembrane proteins, IFNAR1 and IFNAR2, and have many overlapping activities. However, differential activities of the various type I IFNs have also been reported. IFNβ has been reported to have a ˜20- to 50-fold greater affinity for IFNAR1 than IFNα2 and this greater affinity has been shown to correlate with a significantly higher anti-proliferative activity (Jaitin et al. (2006) Mol Cell Biol 26: 1888-1897; Kalie et al. (2007) J. Biol. Chem., 282: 11602-11611). In an initial attempt to determine if IFNβ fusion proteins would be an effective anti-cancer therapeutic, we fused mouse or human IFNβ to the C-terminal end of an anti-tumor IgG. Although the mouse IFNβ fusion protein retained its activity, the human IFNβ fusion protein had a >100-fold decrease in activity (unpublished results). As an alternative approach, we chose to make an anti-CD138 fusion protein using a mutant IFNα2 designed to mimic IFNβ with greater affinity for IFNAR1 and enhanced anti-proliferative activity (Kalie et al. (2007) J. Biol. Chem., 282: 11602-11611). This mutant IFNα2 (mutIFNα) contains mutations at three positions (H57Y, E58N, Q61 S), which confer upon it a 60-fold increased affinity for IFNAR1 than wild-type IFNα2 and a 3-fold higher affinity than IFNβ. In addition, mutIFNα was shown to exhibit an increase in anti-proliferative activity (80- and 150-fold increase, depending on the cell line used) when compared to wild-type IFNα, and a slight increase in activity when compared to IFNβ. Surprisingly, targeted anti-CD20-mutIFNα was found to be less effective in inhibiting the proliferation of CD20 expressing Daudi cells than targeted wild type IFNα (anti-Cd20-IFNα). The anti-viral activity of wild-type IFNα, mutIFNα and IFNβ were found to be very similar (Id.).
(180) The anti-tumor activities of IFNα, anti-CD138-IFNα and anti-CD138-mutIFNα against six sensitive cell lines were examined. More specifically, we examined their ability to inhibit cell proliferation, influence cell cycle progression, and cause apoptosis. The cytoreductive activity of anti-CD138-IFNα and anti-CD138-mutIFNα was compared to untargeted IFNα by MTS assay. The targeted fusion proteins were more effective at decreasing cell viability than IFNα alone for all HMCLs except H929, in which IFNα and the fusion proteins had very similar activity. When compared to one another, anti-CD138-IFNα and anti-CD138-mutIFNα showed similar effects in 8226/S, MM144 and H929. Anti-CD138-IFNα was more effective than anti-CD138-mutIFNα for the ANBL-6 cell line. In contrast, anti-CD138-mutIFNα was more effective than anti-CD138-IFNα in U266 and OCI-My5 cells (
(181) The cytoreductive effects of the IFNα fusion proteins were further investigated by determining if HMCLs were blocked in cell cycle progression or were undergoing apoptosis. To determine if there were changes to the cell cycle, HMCLs were analyzed for DNA content by flow cytometry following permeabilization and staining with PI after 4 days of treatment (
(182) In contrast MM144 and H929 showed a marked accumulation of cells in G.sub.2/M, with H929 also having an accumulation of cells with sub-G.sub.0 content of DNA (apoptotic cells). To test if HMCLs were undergoing apoptosis as a result of treatment, cells were stained with Alexa Fluor 488 labeled Annexin V and PI and analyzed by flow cytometry (
(183) TABLE-US-00016 TABLE 4 The differential effects of IFNα and fusion proteins against MM cell lines. Construct 8226/S ANBL-6 H-929 MM144 U266 OCI-My 5 Cell cycle arrest IFNα − − + ++ − − Anti-CD138- − − + ++ − − IFNα Anti-CD138- − − ++ + − + mutIFNα Apoptosis IFNα +/− + + + + − Anti-CD138- +/− + + + + − IFNα Anti-CD138- +/− + ++ + ++ − mutIFNα Senescence IFNα + − + +/− − − Anti-CD138- + − + +/− − − IFNα Anti-CD138- + − + +/− − + mutIFNα
(184) Although there was some change to the cell cycle when OCI-My 5 cells were treated with anti-CD138-mutIFNα, apoptosis was not observed. In addition, treatment with IFNα and anti-CD138-IFNα did not cause apoptosis or blocks to cell cycle progression in OCI-My 5 cells. To confirm that IFNα and the fusion proteins have a cytoreductive effect, we tested the proliferative status of the cells after treatment. .sup.3[H]-thymidine incorporation was measured after 3 days of treatment with varying concentrations of IFNα, anti-CD138, anti-CD138-IFNα, or anti-CD138-mutIFNα (
(185) Another possibility for the decrease in cell viability and proliferation is oncogene-induced senescence (OIS). OIS is thought to be part of a safeguard mechanism to prevent abnormal cells from further expansion. Cells in senescence have been shown to be metabolically active in vitro but do not divide. We examined if IFNα and/or the fusion proteins could induce senescence in OCI-My 5 cells. One common marker for the detection of senescence is β-gal activity at pH 6, which is a barometer for increased lysosomal content of senescent cells. OCI-My 5 cells were treated for 3, 4, 6 or 7 days with 1 nM of IFNα, anti-CD138, anti-CD138-IFNα, or anti-CD138-mutIFNα and β-gal activity detected by flow cytometry. At all time points, there was little or no increase in β-gal activity following treatment with IFNα, anti-CD138 IgG, or anti-CD138-IFNα. However, there was a large increase in β-gal activity in cells treated with anti-CD138-mutIFNα. A representative experiment at 3 days is shown in
(186) Taken together, these data indicate that although IFNα and the fusion proteins have cytoreductive activity against many HMCLs, the cell lines have differential responses against this cytokine. These differences underscore the fact that HMCLs and MM cells in vivo are heterogeneous in nature.
(187) Fusion Proteins are Effective Against Primary MM Cells from Patients
(188) To determine if the fusion proteins are effective against primary tumors, cells were isolated from multiple myeloma patients. Cells were treated with 25 nM of unfused anti-CD138, fused anti-CD138-IFNα or anti-CD138-mut IFNα for 3 days and the percentage of viable cells compared to DMSO-treated control (arbitrarily designated as 100%) was determined. The assays used were trypan blue exclusion or MTT assay.
(189) There was some variability in the response of the cells from five patients. Generally, the unfused IgG had little effect, while treatment with IFNα fusion proteins, especially the mutant, caused significant decreases in cell viability (
(190) Fusion Proteins are Effective in a Murine Xenograft Model of MM
(191) To determine if the fusion proteins would be able to provide protection against MM in vivo, we used a murine xenograft models of MM using OCI-My 5 cells or U266 cells. SCID mice were injected subcutaneously with 1×10.sup.7 OCI-My 5 cells and treated on days 14, 16 and 18 with 100 μg of anti-CD138-IFNα or anti-CD138-mutIFNα. Treatment with PBS, anti-CD138, and untargeted anti-DNS-IFNα and anti-CD20-mutIFNα served as controls. Survival was monitored as well as the size of the tumors. Unfused anti-CD138 and untargeted anti-DNS-IFN increased survival slightly as compared to PBS control. Treatment with the targeted anti-CD138-IFNα resulted in a significant increase in survival (p≦0.001 compared to PBS), but an even greater effect was observed with anti-CD138-mutIFNα (p=0.0004 compared to anti-CD138-IFNα).
(192) To determine the in vivo efficacy of fusion protein treatment against the U266 tumor, NSG mice were injected subcutaneously with 1×10.sup.7 U226 cells and treated on days 14, 16 and 18 as indicated by the black arrows with 100 μg of the indicated proteins. One group was treated two additional times with anti-CD138-mutIFNα on days 25, 32 and 63 as indicated by the grey arrows. Eight mice were treated for each group except 6 mice for the group that received six treatments with anti-CD138-mutIFNα. Survival was monitored as well as the size of the tumors. Targeted anti-CD138-IFNα was much more effective than untargeted anti-DNS-IFNα in protecting against tumor growth. Moreover, targeted anti-CD138-mutIFNα was even more effective than anti-CD138-IFNα. When mice were treated with two additional doses of 100 μg of anti-CD138-mutIFNα on days 25 and 32, tumor growth was delayed with palpable tumors not observed until day 60. At day 63 mice were treated with an additional 100 μg of anti-CD138-mutIFNα which served to delay but not completely prevent tumor growth. However, it can be speculated that treatment with additional quantities of fusion protein may have succeeded in completely inhibiting tumor growth.
(193) Discussion
(194) IFNα therapy has been used for treatment of MM, but disagreement exists as to its efficacy. However, meta-analysis of 17 trials among 2333 patients who received IFN-chemotherapy induction treatment or chemotherapy alone showed significantly superior outcomes in IFN treated patients for relapse-free and overall survival; similarly, meta-analyses of maintenance treatments also showed outcomes significantly better in the IFN treatment arms than in untreated controls (Fritz and Ludwig (2000) Ann. Oncol., 11: 1427-1436), underscoring the fact that IFNα can be an effective therapeutic against MM. However the systemic toxicity associated with IFNα treatment as well as its short in vivo half-life have limited the clinical efficacy of IFN treatment. Our approach to circumventing these problems is to fuse IFNα to anti-CD138 IgG in order to increase its half-life and by targeting, deliver an effective dose of IFNα to the tumor site without systemic toxicity.
(195) MM is characterized by significant heterogeneity. Our studies as well as others (Gomez-Benito et al. (2005) FEBS Lett., 579: 6217-6122; Gomez-Benito et al. (2007) Cell Signal 19: 844-854) showed that not all MMs are responsive to treatment with IFNα. However, for those HMCLs that are sensitive, targeting via the anti-CD138 antibody portion improved the efficacy of IFNα against MM, and in some cases, anti-CD138-mutIFNα, which has a higher affinity for IFNAR, was more effective than anti-CD138-IFNα. However, the responsiveness of MM cell lines to IFNα does not appear to always correlate with the level of expression of IFNAR (Gomez-Benito et al. (2005) FEBS Lett., 579: 6217-6122). Our analysis of HMCLs revealed that different cell lines exhibit different responses. Consistent with previous studies (Arora and Jelinek (1998) J. Biol. Chem., 273: 11799-11805; Minami et al. (2000) Exp. Hemat., 28: 244-255; Chen et al. (2001) Blood, 98: 2183-2192; Crowder et al. (2005) Blood, 105: 1280-1287; Gomez-Benito et al. (2005) FEBS Lett., 579: 6217-6122; Arulampalam et al. (2011) Exp. Cell Res., 317: 9-19), the mechanism of action of IFNα against MM was found to include apoptosis, blockage in cell cycle progression and senescence.
(196) Following treatment H929 and MM144 cell lines both showed dramatic changes to cell cycle progression and were blocked at G2/M, with H929 also having a significant number of cells in the sub-G0 phase. Both also underwent apoptosis. Our results were consistent with previous studies that showed that MM144 is blocked in G2 when treated with IFNα. H929 contains a 4p16::14q32 translocation (overexpresses FGFR3 and MMSET) while MM144 contains a 14q32::16q23 translocation (overexpresses c-maf). Thus, although the two cell lines have a similar response to treatment, they contain different genetic abnormalities. The stop in cell cycle progression is different from what has been reported for Daudi cells treated with IFNα, which show a stop at G1 (Subramanian et al. (1997) J. Biol. Chem., 272: 14713-14720).
(197) In contrast, 8226/S, ANBL-6 and U266 did not display changes in the cell cycle, but did undergo apoptosis in response to IFNα alone and to IFNα fusion treatment; ANBL-6 is IL-6 dependent. Both 8226/S and ANBL-6 are hyperdiploid with a 14q32::16q23 translocation. On the other hand, U266 is hypodiploid with a 11q13 insertion and overexpresses cyclin Dl. U266 has previously been shown to have biallelic deletion of RB gene and does not express pRB (Dao et al. (1994) Leukemia, UK 8: 1280; Corradini et al. (1994) Leukemia, 8: 758).
(198) Unlike the other HMCLs analyzed, the OCI-My 5 cell line did not undergo apoptosis, become blocked in cell cycle progression or undergo senescence when treated with IFNα or anti-CD138-IFNα. However, changes to the cell cycle and induction of senescence were observed when cells were treated with anti-CD138-mutIFNα, suggesting that the higher affinity of mutIFNα for IFNAR is necessary to affect this cell line. The reason for the cytoreductive effects of anti-CD138-IFNα against OCI-My 5 cells as detected by MTS assays (
(199) The two main pathways of oncogene-induced senescence are p16INK4a-RB and ARF-p53, which are involved in the execution of proliferative arrest. IFNα has been shown to induce senescence in endothelial cells (Pammer et al. (2006) Lab. Invest., 86: 997-1007); however, no studies have yet reported IFNα-induced senescence in MM.
(200) There did not appear to be a correlation between the type of genetic abnormality and their responsiveness to IFNα fusion treatment. For example, the four cell lines with the 14q32::16q23 translocation and overexpression of c-maf (OCI-My 5, 8226/S, H929 and ANBL-6) showed apoptosis, cell cycle, or senescence in response to IFNα fusion protein treatment.
(201) These findings suggest that the variable responses of the different HMCLs may be attributed to the heterogeneity, some of which is outlined in Table 4, in the molecular pathogenesis of MM.
(202) In addition to in vitro data using HMCLs, we show that the targeted IFNα fusion proteins are effective against primary cells from MM patients and in a murine xenograft model. These data suggest that targeting of IFNα via the anti-CD138 moiety may be an effective strategy in the treatment of MM. In primary cells (and in the mouse model?), the higher affinity anti-CD138-mutIFNα fusion protein was more effective than being more effective than wildtype anti-CD138-IFNα. Although the treatments were effective in prolonging survival in mice, the fusion proteins may prove to be even more effective in the treatment of human MM patients because of immunomodulatory activities of IFNα as well as the IgG Fc region. It is conceivable that in addition to the direct effects of IFNα, the fusion proteins may also activate ADCC and CDC, further contributing to cancer cell killing in patients.
(203) Signaling
(204) pRb protein is involved in regulating progression through G1 into S phase; however, the HMCLs with blocks in cell cycle progression were arrested at G2/M and some at sub-G0.
Example 2
Anti-CD138-interferon α2 Fusion Proteins are Effective In Vitro and In Vivo Against Multiple Myeloma
(205) Translational Relevance
(206) It is estimated that in the United States 22,350 individuals will be diagnosed with and 10,700 will die of myeloma in 2013. Although much progress has been made in the treatment of myeloma, most treated individuals relapse, and myeloma remains an incurable disease. Therefore, innovative therapeutic approaches are desperately needed. IFN treatment has shown some efficacy for the treatment of myeloma, but the associated toxicities have limited its efficacy. We propose a novel approach in which IFN is targeted to myeloma cells expressing CD138 using anti-CD138-IFN fusion proteins. We believe that the targeted IFN is effective in killing myeloma cells and in eliciting a tumor specific immune response.
(207) Purpose:
(208) Multiple myeloma, a plasma cell malignancy characterized by a high degree of heterogeneity, is the second most prevalent hematologic malignancy in the US. Although much effort has been made trying to understand the etiology and the complexities of this disease with the hope of developing effective therapies, multiple myeloma remains incurable at this time. Because of their anti-proliferative and pro-apoptotic activities, IFNs have been used to treat various malignancies including multiple myeloma. Although some success has been observed, the inherent toxicities of IFNs limit their efficacy.
(209) Experimental Design:
(210) To address this problem, we produced anti-CD138 antibody fusion proteins containing either IFNα2 or a mutant IFNα2 (IFNα2.sup.YNS) with the goal of targeting IFN to CD138 expressing cells, thereby achieving effective IFN concentrations at the site of the tumor in the absence of toxicity.
(211) Results:
(212) The fusion proteins inhibited the proliferation of a variety of cell lines that represent different molecular and biological multiple myeloma subtypes. Depending on the cell line, the interference with growth following treatment with the fusion proteins included the induction of apoptosis, blocks in cell cycle progression and/or senescence. In addition, the fusion proteins were effective against primary cells from multiple myeloma patients, and treatment with fusion proteins prolonged survival in two different xenograft models. These studies suggest that IFNα antibody fusion proteins may be effective novel therapeutics for the treatment of multiple myeloma.
(213) Introduction
(214) Multiple myeloma is a disease characterized by an excess of malignant plasma cells in the bone marrow. Accumulation and proliferation of malignant myeloma cells result in disruption of normal hematopoiesis and changes to bone marrow vascularization and bone physiology. Analyses of patient myeloma cells and human myeloma cell lines (HMCLs) have revealed the extensive molecular heterogeneity of this disease (Carrasco et al. (2006) Cancer Cell 9: 313-325; Drexler et al. (2000) Leukemia, 14: 777-782; Lombardi et al. (2006) Genes Chromosomes Cancer, 46: 226-238; Moreaux et al. (2011) Haematologica, 96: 574-582). The survival rate for multiple myeloma is 7-8 years when patients are treated with drugs such as proteasome inhibitor bortezomib, or thalidomide and lenalidomide, which target myeloma cells in the bone marrow microenvironment (Kumar et al. (2008) Blood, 111: 2516-2520). Currently there is no cure for multiple myeloma.
(215) Besides their anti-viral and immunostimulatory activities, IFNs have anti-proliferative activity and can induce apoptosis in hematological malignancies and solid tumors (Borden et al. (2000) Semin. Cancer Biol., 10: 125-144; Borden et al. (2007) Nat. Rev. Drug Discov., 6: 975-990). Many studies have shown that type I IFNs, which were the first recombinant proteins used in the treatment of cancer, may be highly effective against a variety of tumor cell targets (reviewed in Borden et al. (2007) Nat. Rev. Drug Discov., 6: 975-990). Both IFNα and IFNβ bind to the same receptor composed of two transmembrane proteins, IFNAR1 and IFNAR2. However, IFNβ has a 20- to 50-fold greater affinity for IFNAR1 than IFNα2, and this greater affinity has been shown to correlate with a significantly higher anti-proliferative activity against some malignancies (Jaitin et al. (2006) Mol. Cell Biol., 26: 1888-1897; Kalie et al. (2007) J. Biol. Chem., 282: 11602-11611). However, the effectiveness of type I IFNs for cancer therapy has been overshadowed by their associated side effects when used at high doses (Weiss (1998) Semin. Oncol., 25: 9-13) and a short half-life of only 1 hour (Peleg-Shulman et al. (2004) J. Med. Chem., 47: 4897-4904). Previously, we produced an anti-CD20-IFNα2 fusion protein and showed that targeting to CD20 expressed on tumor cells resulted in potent anti-proliferative and pro-apoptotic effects on human B cell lymphoma cell lines in vitro and in a murine lymphoma model (Xuan et al. (2010) Blood, 115: 2864-2871). We have also shown that fusion of IFNα or IFNβ to IgG increased the half-life to 8 hours (Huang et al. (2007) J. Immunol., 179: 6881-6888; Trinh et al. (2013) J. Immunother., 36: 305-318).
(216) To determine if this approach would also be effective against multiple myeloma, we constructed fusions of anti-CD138 with IFNα2 and IFNα2.sup.YNS, a high affinity IFNα2 mutant (Jaitin et al. (2006) Mol. Cell Biol., 26: 1888-1897; Kalie et al. (2007) J. Biol. Chem., 282: 11602-11611). CD138, also known as syndecan-1, is a heparan sulfate proteoglycan that is highly expressed on HMCLs and malignant plasma cells in peripheral blood and in the bone marrow in patients (Chilosi et al. (1999) Mod. Pathol., 12: 1101; Ridley et al. (1993) Blood 81: 767-774; Wijdenes et al. (1996) Br. J. Haematol., 94: 318-323). Treatment with IFNα fusion proteins resulted in the induction of apoptosis, blockage in cell cycle and/or senescence in different HMCLs. In addition, the fusion proteins were effective against primary patient cells and in vivo against multiple myeloma tumors in murine models.
(217) Materials and Methods
(218) Cells
(219) HMCLs were obtained through the generous gift of Dr. W. Michael Kuehl and Dr. Diane Jelinek. Their authenticity was confirmed by anti-CD138 staining Primary cells were obtained after informed consent and approved by the institutional medical ethical committee. HMCLs were cultured in RPMI 1640 (Invitrogen) supplemented with 5% fetal calf serum (FCS; Atlanta Biologics). ANBL-6 cells were cultured as described with the addition of 2 ng/mL of IL-6. Chinese Hamster Ovary (CHO) cells were cultured in Iscove's Modified Dulbecco's Medium (IMDM; Invitrogen) supplemented with 5% FCS.
(220) Construction of Expression Vectors, Protein Production and Purification
(221) The anti-CD138 heavy and light chain variable (V) region amino acid sequences were obtained from US Patent Application No: 2009/0175863. The sequences were used to construct expression vectors as described in Supplemental methods. To construct the DNA vector for the expression of anti-CD138-IFNα2.sup.YNS, nested PCR was used to introduce three amino acid mutations (H57Y, E58N, and Q61S) as described in Supplemental methods.
(222) Expression vectors were stably transfected into CHO cells to produce fusion proteins and purified using protein A affinity chromatography as described in Supplemental methods.
(223) MTS and Apoptosis Assays
(224) HMCLs were treated with IFNα2, IFNβ, anti-CD138, anti-CD20-IFNα2, anti-CD20-IFNα2.sup.YNS, anti-CD138-IFNα2 or anti-CD138-IFNα2.sup.YNS. Metabolic activity was determined using MTS assay as described in Supplemental methods. Apoptosis was measured by staining cells with Alexa Fluor 488-labeled Annexin V and propidium iodide (PI) as described in Supplemental methods.
(225) Cell Cycle Analysis
(226) Cells were treated with 500 pM of IFNα2, IFNβ, anti-CD138-IFNα2, or anti-CD138-IFNα2.sup.YNS for 4 days at 37° C. Cells were incubated with 1 ml of hypotonic DNA staining buffer (1 mg/ml sodium citrate, 100 μg/ml PI, 20 μg/ml RNase A, and 0.3% Triton X-100) for 30-60 minutes at 4° C. in the dark. Cells were analyzed by flow cytometry and cell cycle analysis performed using FlowJo software with the Watson Model.
(227) Detection of ppRb and IRF-4
(228) Cells were treated for 48 hours with 1 nM IFNα2, IFNβ, anti-CD138-IFNα2, or anti-CD138-IFNα2.sup.YNS and analyzed by Western blotting using anti-IRF-4 or anti-ppRb Ser807/811 as described in Supplemental methods.
(229) Assays for Replicative Senescence
(230) Cells were treated with IFNα2, anti-CD138, anti-CD138-IFNα2, or anti-CD138-IFNα2.sup.YNS for 3 days. Senescence induced β-galactosidase (β-gal) activity was detected as described previously (Debacq-Chainiaux et al. (2009) Nat. Protoc., 4: 1798-1806) and in Supplemental methods. To detect Ki-67 protein, cells were stained and analyzed by flow cytometry as described in Supplemental methods.
(231) In Vivo Anti-Tumor Activity Against OCI-My5 and U266 Cells
(232) Six-to-eight week old female scid mice were used to establish OCI-My5 tumors. Mice were inoculated subcutaneously with 1×10.sup.7 cells at the base of the tail. Mice were treated intravenously with PBS or 100 μg of anti-CD138, anti-dansyl (DNS)-IFNα2, anti-CD138-IFNα2, anti-CD20-IFNα2.sup.YNS, anti-CD138-IFNα2.sup.YNS on days 14, 16, 18 post tumor challenge. Each group consisted of eight mice. Bidirectional tumor growth was measured throughout the experiment, and mice were sacrificed when tumors reached 1.5 cm as per institutional guidelines. For U266 tumors, experiments were carried out as described above except that NOD-scid IL2rγ.sup.null (NSG) mice were used. All animal studies were performed in compliance with the U.S. Department of Health and Human Services Guide for the Care and Use of Laboratory Animals and were approved by the UCLA Animal Research Committee.
(233) Treatment of Primary Myeloma Cells from Patients
(234) Patients with active myeloma were biopsied while off therapy and myeloma cells isolated by negative antibody selection to >95% purity. Cells were incubated with 25 or 100 nM of anti-CD138, anti-CD138-IFNα2 or anti-CD138-IFNα2.sup.YNS for 72 hours. Percent viable cell recovery was determined by trypan blue staining, with untreated control cells designated as 100%.
(235) Results
(236) Production and Characterization of Anti-CD138-IFNα2 and Anti-CD138-IFNα2.sup.YNS Fusion Proteins
(237) The aim of this study was to test the effectiveness of using antibodies specific for CD138 to target IFN to multiple myeloma cells. The approach was to genetically fuse IFN to the end of the C.sub.H3 domain of human IgG1 containing the V regions from the anti-CD138 antibody B-B4 (Wijdenes et al. (1996) Br. J. Haematol., 94: 318-323). We elected to target IFNα2, which has been used successfully in the treatment of multiple myeloma in the clinic. IFNβ binds to the same receptor as IFNα but has a greater affinity and activity than IFNα2. However, we found that fusion of human IFNβ to IgG resulted in a >100-fold decrease in activity (data not shown). As an alternative approach, we also elected to target IFNα2 containing mutations at three positions, H57Y/E58N/Q61S (anti-CD138-IFNα2.sup.YNS). These mutations result in a 60-fold increased affinity for IFNAR1 and a large increase in anti-proliferative activity compared to wildtype IFNα2 (Kalie et al. (2007) J. Biol. Chem., 282: 11602-11611). Anti-CD138 IgG1 either unfused or fused to human IFNα2 or IFNα2.sup.YNS (
(238) IFNα2 Fusion Proteins Inhibit the Growth of HMCLs
(239) Multiple myeloma is characterized by biological and genetic heterogeneity (Carrasco et al. (2006) Cancer Cell 9: 313-325; Drexler et al. (2000) Leukemia, 14: 777-782; Lombardi et al. (2006) Genes Chromosomes Cancer, 46: 226-238; Moreaux et al. (2011) Haematologica, 96: 574-582) and often differ in their responses to various drugs and treatments. Therefore, we assembled a panel of thirteen HMCLs (XG-1, XG-2, OPM-1, OPM-2, S6B45, delta 47, RPMI 8226, 8226/Dox40, U266, OCI-My5, ANBL-6, NCI-H929 and MM1-144) to investigate their response to IFNα and the fusion proteins. The panel includes both hyperdiploid and nonhyperdiploid cells with various chromosomal translocations (Drexler et al. (2000) Leukemia, 14: 777-782; Moreaux et al. (2011) Haematologica, 96: 574-582; Gabrea et al. (2008) Genes Chromosomes Cancer, 47: 573-590). All of the HMCLs were bound by anti-CD138 IgG, indicating that they express CD138 (data not shown).
(240) To determine if the HMCLs were sensitive to treatment and if targeted IFNα2 was more effective, cells were incubated with varying concentrations of fusion proteins for 3 days and metabolic activity assessed by MTS assay. Anti-CD138-IFNα2 was used to target IFNα while anti-CD20-IFNα2 was used as an untargeted control since HMCLs do not express CD20. HMCLs showed different responses to treatment. Under these conditions both fusion proteins had little or no effect on XG-1, XG-2, OPM-1, OPM-2, and delta 47 while some effect was observed only at high concentrations for S6B45, RPMI 8226, and 8226/Dox40 (data not shown). However, the targeted anti-CD138-IFNα2 was >10-fold more effective than untargeted anti-CD20-IFNα2 for U266, OCI-My5, ANBL-6, NCI-H929 and MM1-144 (
(241) In a different experiment, anti-CD138-IFNα2 fusion protein was compared to equimolar concentrations of anti-CD138 alone and recombinant IFNα2 alone. Anti-CD138-IFNα2 was more effective than recombinant IFNα2 in inhibiting the growth of OCI-My5, ANBL-6, and MM1-144, but not NCI-H929. Comparison of IC.sub.50 between anti-CD138-IFNα2 and IFNα2 calculated from the data shown in
(242) To determine if apoptosis was being induced in the HMCLs, cells were treated for 3 days at high (500 pM) or low (1 pM or 5 pM for OCI-My5) concentrations of IFNα2 and fusion proteins, stained using Alexa Fluor 488-labeled Annexin V and PI and examined by flow cytometry. When treated at 500 pM, IFNα2 and the fusion proteins caused apoptosis in all HMCLs (
(243) IFNα2 and Fusion Proteins can Induce Alterations in Cell Cycle Progression and Senescence in Some HMCLs
(244) HMCLs were also analyzed for changes in cell cycle progression following treatment with IFNα, IFNβ or fusion proteins for 4 days. All treatments resulted in increases in the percentage of dead cells with sub-G.sub.0/G.sub.1 DNA content (
(245) TABLE-US-00017 TABLE 5 The percentages of live cells in different phases of the cell cycle after treatment with the indicated proteins are shown. % G.sub.1 % S % G.sub.2/M >G.sub.2 Sub G.sub.0/G.sub.1 U266 Untreated 42.6 28.5 17.4 10.3 5.2 IFNα2 52.5 23.6 14.3 5.7 14.0 Anti-CD138-IFNα2 53.9 21.4 15.1 5.5 13.2 Anti-CD138-IFNα2.sup.YNS 58.5 13.1 20.2 6.4 15.9 IFNβ 58.7 12.4 20.1 7.1 17.0 OCI-My5 Untreated 37.4 41.7 19.0 0.1 9.4 IFNα2 30.1 45.6 19.2 1.2 19.0 Anti-CD138-IFNα2 25.6 49.0 20.5 1.5 17.9 Anti-CD138-IFNα2.sup.YNS 23.8 50.3 20.5 0.0 24.2 IFNβ 21.8 54.2 19.0 0.0 29.5 ANBL-6 Untreated 51.8 25.3 10.1 4.6 11.3 IFNα2 64.8 14.3 17.0 0.0 19.8 Anti-CD138-IFNα2 63.6 14.0 18.0 0.0 19.6 Anti-CD138-IFNα2.sup.YNS 64.1 14.7 17.7 0.0 10.8 IFNβ 60.5 15.4 18.8 0.0 26.1 NCI-H929 Untreated 62.1 21.4 11.9 2.7 1.8 IFNα2 41.5 21.7 25.4 7.6 21.2 Anti-CD138-IFNα2 41.9 21.0 24.3 8.2 18.9 Anti-CD138-IFNα2.sup.YNS 43.0 18.0 26.6 8.0 30.4 IFNβ 41.2 22.1 23.4 7.8 37.4 MM1-144 Untreated 48.5 29.4 13.9 7.0 5.1 IFNα2 21.0 31.5 34.2 11.6 10.3 Anti-CD138-IFNα2 22.6 29.9 34.3 11.2 11.3 Anti-CD138-IFNα2.sup.YNS 27.7 30.0 30.7 9.4 11.9 IFNβ 29.0 33.7 26.7 8.6 11.7
(246) Phosphorylated retinoblastoma protein (ppRB), which is regulated by interactions between cyclin D and cyclin-dependent kinases, is an indicator of cell cycle progression. Since cell cycle progression was blocked in some HMCLs, we determined the levels of ppRB by Western blotting (
(247) Cell cycle arrest may be an indicator of replicative senescence. Although this arrest has been described to occur in G.sub.0/G.sub.1 (reviewed in Kong et al. (2011) J. Aging Res., 2011: 963172), G.sub.2 arrest has also been reported (Mao et al. (2012) Aging, 4: 431; Olsen et al. (2002) Oncogene, 21: 6328; Wada et al. (2004) Nat. Cell Biol., 6: 215-226; Zhu et al. (1998) Genes Dev., 12: 2997-3007). IFNα2 has been reported to induce senescence in endothelial cells (Pammer et al. (2006) Lab. Invest. 86: 997-1007), but no such activity has yet been reported in myeloma. One marker for senescence is β-gal activity at pH 6, which is a barometer of increased lysosomal content in the cells undergoing senescence. To assay for senescence, HMCLs were treated for 3 days with IFNα2, anti-CD138, anti-CD138-IFNα2, or anti-CD138-IFNα2.sup.YNS and β-gal activity detected by flow cytometry (
(248) Ki-67 protein is present during all active phases of the cell cycle but is absent from cells that have ceased dividing, including senescent cells. To quantify the number of non-dividing cells, HMCLs were treated for 3 days and Ki-67 expression was determined by flow cytometry. The percentage of Ki-6T (non-dividing) cells are shown in
(249) Expression of the transcription factor IFN regulatory factor-4 (IRF-4) has been shown to be required for survival of multiple myeloma cells regardless of their genetic etiology, with even small changes to IRF-4 levels resulting in cell death (Shaffer et al. (2008) Nature, 454: 226-231). Therefore, we wanted to determine if treatment resulted in changes to IRF-4 levels. While IRF-4 levels were unchanged in NCI-H929, MM1-144, OCI-My5 and ANBL-6 (data not shown), there was a decrease in IRF-4 expression in U266 after treatment with IFNα2 and fusion proteins (
(250) Fusion Proteins are Effective in Murine Xenograft Models of Multiple Myeloma
(251) To determine if the fusion proteins are protective against multiple myeloma in vivo, we used xenograft models of OCI-My5 and U266 tumors. In the OCI-My5 model, tumors were established in scid mice, which lack mature T and B cells. Mice were treated on days 14, 16 and 18. To treat the mice, we used unfused anti-CD138, an untargeted fusion protein with an irrelevant specificity for the hapten dansyl (DNS; anti-DNS-IFNα2), untargeted anti-CD20-IFNα2.sup.YNS, or targeted anti-CD138-IFNα2 and anti-CD138-IFNα2.sup.YNS. We would not expect anti-CD20-IFNα2.sup.YNS to target to any cells in the mice since it is specific for human CD20. Survival and tumor size were monitored (
(252) In the U266 tumor model, NSG mice were used. NSG mice are severely immunocompromised, lacking mature T and B cells, functional NK cells and are deficient in cytokine signaling. Mice were treated on days 14, 16 and 18 as described above. All treatment groups, including anti-CD138 and untargeted IFNα2 fusion proteins, showed significant improvements in survival when compared with the untreated PBS control (p≦0.0003;
(253) Fusion Proteins are Effective Against Primary Multiple Myeloma Cells from Patients
(254) To determine if the fusion proteins are effective against primary tumors, multiple myeloma patient cells were treated with anti-CD138, anti-CD138-IFNα2 or anti-CD138-IFNα2.sup.YNS for 72 hours and the percentage of viable recovered cells compared to untreated cells was determined by trypan blue exclusion. As expected, untreated primary cells demonstrated no increase in cell number during this time as freshly obtained primary multiple myeloma cells do not proliferate ex vivo. Not surprisingly, there was some variability in response among the seven patients' cells when the proteins were tested at 25 nM (
(255) Discussion
(256) IFNα therapy has been used for treatment of multiple myeloma, but disagreement exists as to its efficacy. However, meta-analysis of 17 trials including 2333 patients who received combination IFNα-chemotherapy or chemotherapy alone showed significantly superior outcomes in IFNα treated patients for relapse-free and overall survival; similarly, meta-analyses of maintenance treatments also showed significantly better outcomes in the IFNα treatment arms than in untreated controls (Fritz et al. (2000) Ann. Oncol., 11: 1427-1436), underscoring the fact that IFNα can be an effective therapeutic against multiple myeloma. Some of the major problems for IFNα2 therapy are systemic toxicity and short in vivo half-life. Our approach to circumventing these problems was to fuse IFNα2 to anti-CD138 IgG1 to increase its half-life and by targeting, deliver an effective dose of IFNα2 to the tumor site without systemic toxicity. We have previously used this approach successfully in the treatment of human B cell lymphoma using an anti-CD20-IFNα2 fusion protein and have shown that it is significantly more effective than anti-CD20 antibody alone or the combination of anti-CD20 and IFNα2 in mice (Xuan et al. (2010) Blood, 115: 2864-2871).
(257) Multiple myeloma is characterized by significant heterogeneity and indeed our studies have shown heterogeneity in the response of different HMCLs to treatment with IFNα and fusion proteins. Our studies as well as others (Crowder et al. (2005) Blood., 105: 1280-1287; Gomez-Benito et al. (2005) FEBS Lett., 579: 6217-6222) have shown that not all multiple myeloma cells are responsive to treatment with IFNα; the responsiveness of HMCLs does not always correlate with the level of IFNAR expression (Gomez-Benito et al. (2005) FEBS Lett., 579: 6217-6222). For HMCLs that were sensitive, fusion proteins containing wildtype IFNα2 or mutant IFNα2.sup.YNS were comparable to or better than IFNα alone in all of the in vitro assays, suggesting that targeting via anti-CD138 enhances efficacy. The inhibition of proliferation observed resulted at least in part from the induction of apoptosis, alterations in cell cycle and senescence.
(258) Replicative senescence is recognized as a potential mechanism to prevent tumorigenesis and cancer progression. In vitro, senescent cells do not divide but are viable and metabolically active. IFNα has been shown to induce senescence in endothelial cells (Pammer et al. (2006) Lab. Invest. 86: 997-1007), and IFNβ has been shown to induce senescence in human papilloma virus-transformed keratinocytes (Chiantore et al. (2012) PLoS One, 7: e36909), biliary epithelial cells (Sasaki et al. (2008) Free Radic. Res., 42: 625-632), and human fibroblasts (Moiseeva et al. (2006) Mol. Biol. Cell, 17: 1583-1592). However, IFNα-induced senescence in multiple myeloma has not been reported to date. One novel finding from our studies is that IFNα2 and fusion proteins can induce cellular senescence in some HMCLs as indicated by increases in senescence-associated β-gal activity and decreases in Ki-67 levels. These changes were observed in NCI-H929 and MM1-144 cells when treated with IFNα2, anti-CD138-IFNα2 and anti-CD138-IFNα2.sup.YNS, while OCI-My5 displayed such changes only when cells were treated with anti-CD138-IFNα2.sup.YNS. Alternations in cell cycle caused by IFNα have been reported (Crowder et al. (2005) Blood., 105: 1280-1287; Gomez-Benito et al. (2005) FEBS Lett., 579: 6217-6222; Arora et al. (1998) J. Biol. Chem., 273: 11799-11805; Arulampalam et al. (2011) Exp. Cell Res., 317: 9-19; Minami et al. (2000) Exp. Hematol., 28: 244-255), and in our study, NCI-H929 and MM1-144 were blocked at the G.sub.2/M phase. Although most studies have found accumulation of senescent cells in G.sub.1, G.sub.2-arrested senescent cells have also been reported (Mao et al. (2012) Aging, 4: 431; Olsen et al. (2002) Oncogene, 21: 6328; Wada et al. (2004) Nat. Cell Biol., 6: 215-226; Zhu et al. (1998) Genes Dev., 12: 2997-3007). HMCLs in which senescence was detected also had populations of apoptotic cells in response to treatment. Since senescent cells are thought to be resistant to apoptosis, it may be that subpopulations of cells are responding to IFNα2 differentially. Indeed, a growing hypothesis is that low doses of chemotherapeutic drugs induce senescence while high doses trigger apoptosis (Rebbaa et al. (2003) Oncogene, 22: 2805-2811; Zheng et al. (2004) Cancer Res. 64: 1773-1780). The observation of both senescence and apoptosis in these HMCLs may also reflect heterogeneity of the uncloned cell lines.
(259) Expression of IRF-4 is associated with many lymphoid malignancies. IRF-4 acts as a master regulator of an aberrant, malignancy-specific regulatory network which influences metabolism, membrane biogenesis, cell cycle progression, cell death and transcriptional regulation in myeloma cells (Verdelli et al. (2009) Hematol. Oncol. 27: 23-30). IRF-4 inhibition has been found to be toxic to myeloma cell lines regardless of the transforming oncogenic mechanism (Shaffer et al. (2008) Nature, 454: 226-231). We found that IFNα2, anti-CD138-IFNα2 and anti-CD138-IFNα2.sup.YNS treatment results in decreased expression of IRF-4 in U266 but not in the other HMCLs tested. Thus decreased expression of IRF-4 may contribute to the anti-tumor effects seen in U266.
(260) One of the major challenges in translational research is to determine if in vitro assays are predictive of in vivo outcome. As was observed in vitro, targeting improved the efficacy of IFNα in two in vivo models with anti-CD138-IFNα2 always more effective than untargeted anti-DNS-IFNα2 and anti-CD138-IFNα2.sup.YNS always more effective that untargeted anti-CD20-IFNα2.sup.YNS. However, other interesting and unexpected effects were also observed in vivo. Surprisingly, in the OCI-My5 model the untargeted anti-CD20-IFNα2.sup.YNS was more effective than the targeted anti-CD138-IFNα (but less effective than targeted anti-CD138-IFNα2.sup.YNS) even though in in vitro studies, anti-CD138-IFNα2 was more effective than anti-CD20-IFNα2.sup.YNS with IC.sub.50 of 8.4×10.sup.−4 pM versus 2.3×10.sup.−3 as calculated from the MTS assay (
(261) Targeting also increased the anti-tumor effects against U266 tumors in NSG mice with anti-CD138-IFNα2 more effective than anti-DNS-IFNα2 and anti-CD138-IFNα2.sup.YNS more effective than anti-CD20-IFNα2.sup.YNS. However, in contrast to what was observed with OCI-My5, the effects of anti-CD138-IFNα2 and anti-CD138-IFNα2.sup.YNS were comparable in the U266 in vivo model. This was unexpected given that in vitro, anti-CD138-IFNα2.sup.YNS was more effective than anti-CD138-IFNα2 against U266 cells in the MTS assay and in the apoptosis assay at high concentration. However, at low concentrations, anti-CD138-IFNα2 and anti-CD138-IFNα2.sup.YNS had comparable ability to induce apoptosis (
(262) Taken as a whole, our data suggest that targeting of IFNα2 via the anti-CD138 moiety can be an effective strategy in the treatment of multiple myeloma. Both anti-CD138-IFNα2 and anti-CD138-IFNα2.sup.YNS were effective against HMCLs in vitro and were able to prolong survival in mice. The higher affinity anti-CD138-IFNα2.sup.YNS showed greater activity than anti-CD138-IFNα2 against some HMCLs, primary myeloma cells, and in the OCI-My5 xenograft model, suggesting that IFNs with increased affinity may be more effective. The fusion proteins may prove to be even more effective in the treatment of human patients since the immunomodulatory activities of human IFNα2 and effector functions such as complement-dependent cytotoxcity and ADCC associated with the human IgG Fc region are not fully functioning in mice. Moreover, fusion of IFNα2 to anti-CD138 should increase the half-life while decreasing the systemic cytotoxicity of IFNα2, making for a more effective therapeutic against multiple myeloma.
(263) Supplemental Methods
(264) Construction of Expression Vectors
(265) The anti-CD138 heavy (H) and light (L) chain variable (V) region amino acid sequences were obtained from US Patent Publication No: 2009/0175863 (U.S. Ser. No. 12/342,285) also published as PCT Publication No: WO2009080829A1 entitled “Agents targeting CD138 and uses thereof” which is incorporated herein by reference for the antibody sequences provided herein.
(266) TABLE-US-00018 VH sequence: (SEQ ID NO: 58) MGWSYIILFLVATATGVHSQVQLQQSGSELMMPGASVKISCKATGYT FSNYWIQRPGHGLEWIGEILPGTGRTIYNEKFKGKATFTADISSNTV QMQLSSLTSEDSAVYYCARRDYYGNFYYAMDYWGQGTSVTVSS. VL sequence: (SEQ ID NO: 59) MKSQTQVFIFLLLCVSGAHGDIQMTQSTSSLSASLGDRVTISCSASQ GINNYLNWYQQKPDGTVELLIYYTSTLQSGVPSRFSGSGSGTDYSLT ISNLEPEDIGTYYCQQYSKLPRTFGGGTKLEIK
(267) The DNA sequence encoding a signal peptide was added 5′ of the H chain and L chain V regions
(268) TABLE-US-00019 (SEQ ID NO: 60) (MGWSYIILFLVATATGVHS
and
(269) TABLE-US-00020 (SEQ ID NO: 61) MKSQTQVFIFLLLCVSGAHG,
respectively) as well as the nucleotide sequence containing a Kozak ribosomal recognition site
(270) TABLE-US-00021 (5′-GGATATCCACC-3′, SEQ ID NO: 62).
To facilitate downstream cloning, the sequence
(271) TABLE-US-00022 (SEQ ID NO: 3) 5′-GCTAGCC-3′
was added 3′ of the H chain V region, and the sequence
(272) TABLE-US-00023 (SEQ ID NO: 64) 5′-CGTAAGTCGACG-3′
was added 3′ of the L chain V region. The DNA sequence was synthesized using codons optimized for CHO expression (DNA2.0).
(273) The L chain V region flanked by EcoR V and Sal I restriction sites was sequence-verified before cloning into an expression vector containing the human κ L chain constant region. The H chain V region flanked by EcoR V and Nhe I restriction sites was sequence-verified and cloned into an expression vector containing the human γ1 H chain constant region to produce anti-CD138 IgG1. To produce the fusion protein, the anti-CD138 V.sub.H was cloned into an expression vector containing the human γ1 H chain, a Gly-Ser linker (SGGGGS, SEQ ID NO:8), followed by human IFNα2. This expression vector was named pAH6905.
(274) To construct the DNA vector for the expression of anti-CD138-IFNα2.sup.YNS, nested PCR was used to introduce three amino acid mutations—H57Y, E58N, and Q61S. The first round of PCR was done using the forward primer
(275) TABLE-US-00024 (SEQ ID NO: 65) 5′-CGC GGA TCC TGT GAT CTG CCT CAA ACC CAC-3′
and reverse primer
(276) TABLE-US-00025 (SEQ ID NO: 66) 5′-CCT CTA GAA TCA TTC CTT ACT TCT TAA ACT-3′.
The nested PCR was done using forward primer
(277) TABLE-US-00026 (SEQ ID NO: 67) 5′-CTC TAC AAT ATG ATC TCA CAG ATC-3′
and reverse primer
(278) TABLE-US-00027 (SEQ ID NO: 68) 5′-GAT CTG TGA GAT CAT ATT GTA GAG-3′,
which contain the mutations to IFNα2. The insert was cloned into pCR2.1-TOPO vector (Invitrogen) and the DNA sequence was verified. The Xba I/BamH I fragment containing the mutant IFNα2.sup.YNS sequence was cloned into an intermediate human γ1 H chain vector and named pAH11015. The BamH I/Avr II fragment from pAH11015 containing the mutations to IFNα2 was then used to replace the wildtype IFNα2 sequence from expression vector pAH6905 (see above).
(279) Protein Production and Purification
(280) Fusion proteins were produced in CHO cells by transfection of H and L chain expression vectors. Stably transfected cells were selected with 1 mM histidinol. To produce IgG and fusion proteins, cells were seeded into roller bottles. At confluency, cells were expanded to 100 mL with IMDM+1% Fetal Clone (Thermo Fisher). The supernatant was removed every 2-3 days and replaced with fresh medium. Cell free culture supernatants were then passed through a protein A-Sepharose 4B fast flow column (Sigma) and the bound protein eluted with 0.1 M citric acid, pH 3.5. Eluted fractions were neutralized immediately with 2 M Tris-HCl pH 8.0. Fractions were run on SDS PAGE gels and stained with Coomassie blue to verify protein purity and integrity. Protein concentrations were determined using the BCA assay (Pierce). Anti-CD20-IFNα2, anti-CD20-IFNα2.sup.YNS and anti-dansyl (DNS)-IFNα2 used as untargeted control proteins were produced as described previously.sup.12.
(281) MTS Assay to Determine Metabolic Activity
(282) HMCLs were seeded in 96-well plates and incubated with 0.00002 pM-25 nM of IFNα2, IFNβ, anti-CD138, anti-CD20-IFNα2, anti-CD20-IFNα2.sup.YNS, anti-CD138-IFNα2 or anti-CD138-IFNα2.sup.YNS at 37° C. for 3, 4 or 7 days. Metabolic activity was determined using MTS solution (Promega) by measuring absorbance at 490 nm using a Synergy HT Multi-Detection Microplate Reader (BioTek Instruments Inc.) with untreated cells being 100%. GraphPad Prism (GraphPad Software Inc.) was used to analyze data by non-linear regression with the log (inhibitor) versus the response with a variable slope. Data are expressed as a percentage of maximum metabolic activity. The experiments were performed in triplicate.
(283) Apoptosis Assay
(284) Cells were incubated with 500 pM of IFNα2, anti-CD138-IFNα2 or anti-CD138-IFNα2.sup.YNS for 3 days at 37° C. Cells were stained with Alexa Fluor 488-labeled Annexin V and propidium iodide (PI) using the Vybrant Apoptosis Kit #2 (Molecular Probes) as per manufacturer's instructions and analyzed by flow cytometry.
(285) Senescence Induced β-galactosidase Activity
(286) Intracellular β-galactosidase (β-gal) activity was measured as an indicator for replicative senescence. Cells were treated with 1 nM of anti-CD138, anti-CD138-IFNα2 or anti-CD138-IFNα2.sup.YNS for 3 days at 37° C. After treatment, cells were incubated with 100 nM bafilomycin A1 (Sigma) for 1 hour to induce lysosomal alkalinization. Then cells were incubated for 30 minutes with the 33 μM of β-gal substrate dodecanoylaminofluorescein di-β-D-galactopyranoside (C.sub.12FDG; Invitrogen), which becomes fluorescent after cleavage to C.sub.12-fluorescein. After washing twice with cold PBS, cells were resuspended in cold PBS containing 1 mM phenylethyl thiogalactoside (PETG), a β-gal inhibitor, and analyzed by flow cytometry for C.sub.12-fluorescein.
(287) Ki-67 Stain
(288) Cells were treated with 500 pM of IFNα2, anti-CD138-IFNα2 or anti-CD138-IFNα2.sup.YNS for 3 days at 37° C. After treatment, cells were fixed with methanol on ice and then incubated with anti-Ki-67 rabbit IgG (Abcam). Cells were then stained with anti-rabbit IgG-FITC (Sigma) and analyzed by flow cytometry.
(289) Western Blot Analysis of ppRb and IRF-4
(290) Cells were treated for 48 hours with 1 nM IFNα2, anti-CD138, anti-CD138-IFNα2, or anti-CD138-IFNα2.sup.YNS. Cells were lysed using RIPA buffer (50 mM Tris-HCl pH 8, 150 mM NaCl, 1% NP-40, 0.5% sodium deoxycholate, 0.1% SDS) containing a protease inhibitor cocktail (Roche Applied Science). The cytosolic fractions were reduced with β-mercaptoethanol and separated by SDS PAGE. Following transfer to nitrocellulose membrane (Whatman) and blocking, samples were incubated with the following primary rabbit antibodies: anti-IRF-4 (Epitomics), anti-glyceraldehyde-3-phosphate dehydrogenase (GAPDH; Sigma), or anti-ppRb Ser807/811 (Santa Cruz Biotechnology). Secondary anti-rabbit IgG-HRP (GE Healthcare) was used and the blots were developed using enhanced chemiluminescence (ECL; Thermo Scientific). Films were imaged using a Multilmage™ Light Cabinet (Alpha Innotech Corp.) and analyzed using NIH Image J. Bands were normalized to a GAPDH loading control and expressed as percentage band intensity of untreated cells.
Example 3
Additional Data
(291) There are 12 different human IFNαs with different biologic activities (see, e.g., Lavoie et al. (2011) Cytokine 56: 82). We have now made an anti-CD138 fused to human IFNα14 (anti-CD138-IFNα14) and examined its activity. The anti-CD138 was fused to the INFα14 by a SGGGGS (SEQ ID NO:8) linker. The amino acid sequence of Human interferon alpha 14 (IFNα14) is given in UniProtKB/Swiss-Prot: P01570.3 as:
(292) TABLE-US-00028 (SEQ ID NO: 69) 1 MALPFALMMA LVVLSCKSSC SLGCNLSQTH SLNNRRTLML MAQMRRISPF SCLKDRHDFE 61 FPQEEFDGNQ FQKAQAISVL HEMMQQTFNL FSTKNSSAAW DETLLEKFYI ELFQQMNDLE 121 ACVIQEVGVE ETPLMNEDSI LAVKKYFQRI TLYLMEKKYS PCAWEVVRAE IMRSLSFSTN 181 LQKRLRRKD
(293) It is noted that MALPFALMMA LVVLSCKSSC SLG (SEQ ID NO:70) constitutes the hydrophobic leader sequence and was not included in the fusion protein
(294)
(295)
(296)
(297) The ovarian cancer OVCAR3 expresses low levels of CD138.
(298) The proteasome inhibitor bortezomib (VELCADE® (bortezomib)) is an approved therapeutic for the treatment of myeloma. We tested for potential synergy of VELCADE® with anti-CD138 fusion proteins.
(299)
(300) Lenalidomide, an analog of thalidomide, is FDA approved for the treatment of multiple myeloma. We also found evidence of synergy between anti-CD138-mutIFNα and lenalidomide (
(301) It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.