In Vitro Method for Diagnosing Central Nervous System Injury
20220057411 · 2022-02-24
Inventors
Cpc classification
G01N2800/2871
PHYSICS
G01N2333/9121
PHYSICS
International classification
Abstract
The present invention provides a highly sensitive in vitro method for diagnosing injury to the central nervous system (CNS), such as a traumatic brain injury (TBI) or stroke. The method involves contacting a sample of blood from a subject suspected of suffering a CNS injury event with at least one antibody capable of detecting a proteolytic fragment of the biomarker Protein Kinase C, gamma isoform (PKCg or PKCγ), which fragment corresponds to a proteolytic fragment of PKCg formed in the excitotoxic environment resulting from neuronal damage. Also disclosed are novel anti-PKCg antibodies useful in the diagnostic methods of the invention to provide diagnosis of CNS injury with essentially 100% accuracy.
Claims
1. An in vitro method for diagnosing an injury involving the central nervous system (CNS) comprising: a) contacting a sample of blood from a subject suspected of having suffered a CNS injury with at least one antibody that binds a unique epitope of the gamma isoform of protein kinase C (PKCg) which epitope is retained in one or more proteolytic fragments of PKCg; and b) detecting the formation of a binding complex of said at least one antibody and PKCg or a proteolytic fragment thereof, wherein the presence of said binding complex formed in said sample indicates a CNS injury.
2. The method according to claim 1, wherein the sample is contacted with at least two different antibodies that each form a binding complex with a unique epitope of PKCg, which epitope is within the sequence of amino acids 395-697 of PKCg.
3. The method according to claim 1, wherein said CNS injury is a traumatic brain injury.
4. The method according to claim 1, wherein said CNS injury is a stroke.
5. The method according to claim 1, wherein said at least one antibody recognizes an epitope within the sequence of amino acids 395-697 of PKCg.
6. The method according to claim 1, wherein said at least one antibody recognizes an epitope within the sequence of amino acids 405-414 of PKCg.
7. The method according to claim 1, wherein said at least one antibody recognizes an epitope within the sequence of amino acids 673-697 of PKCg.
8. The method according to claim 1, wherein said blood sample is contacted with at least two antibodies capable of forming a binding complex with an epitope present on at least one proteolytic fragment of PKCg.
9. The method according to claim 8, wherein said at least one proteolytic fragment has a molecular weight selected from the group comprising: from 33 kDa to 36 kDa, from 42 kDa to 48 kDa, from 49 kDa to 52 kDa, and from 53 kDa to 60 kDa.
10. The method of claim 1 wherein the at least one antibody includes an antigen-binding portion comprising a set of six CDRs: CDR-1H1, CDR-1H2, CDR-1H3, CDR-L1, CDR-L2, and CDR-L3, selected from the group of CDR sets as follows: TABLE-US-00010 CDR Amino Acid CDR Set No. CDR Sequence SEQ. ID NO: 1 CDR-H1 GFSLNYYA SEQ ID NO: 3 CDR-H2 ITSDTT SEQ ID NO: 4 CDR-H3 ASGGSTTSPAL SEQ ID NO: 5 CDR-L1 QSVWSKNY SEQ ID NO: 6 CDR-L2 SAS SEQ ID NO: 7 CDR-L3 LGSYDCRSADCWT SEQ ID NO: 8 2 CDR-H1 GFSLSSYA SEQ ID NO: 9 CDR-H2 IISGGSA SEQ ID NO: 10 CDR-H3 ARAKSGTYTGDYFTL SEQ ID NO: 11 CDR-L1 ESIGNA SEQ ID NO: 12 CDR-L2 RAS SEQ ID NO: 13 CDR-L3 QSYVGSRSTGYNV SEQ ID NO: 14 3 CDR-H1 GFTLTTYW SEQ ID NO: 15 CDR-H2 ILTGSGST SEQ ID NO: 16 CDR-H3 ARYGGDATYNENL SEQ ID NO: 17 CDR-L1 QSVYNNNR SEQ ID NO: 18 CDR-L2 GVS SEQ ID NO: 19 CDR-L3 LGGYDCASADCYA SEQ ID NO: 20
11. The method of claim 1 wherein the at least one antibody comprises VH and VL domains selected from the group consisting of: TABLE-US-00011 SEQ amino acid sequence anti- ID 12345678901234567890- body domain NO. 12345678901234567890 PKC11 VH 21 METGLRWLLLVAVLKGVQCQSVEES GGRLVTPGTPLALTCTVSGFSLNYY AMNWVRQAPVKGLEWIGVITSDTTY YASWAKGRFTISKTSTTVELQITSP TTEDTATYFCASGGSTTSPALWGQG TLVTVSS VL 22 MDTRAPTQLLGLLLLWLPGATFAQ VLTQTPSPVSAAVGSTVTINCQA SQSVWSKNYLSWFQQKPGQPPKQ LIYSASTLASGVPSRFSGSGSGT QFTLTISDVQCDDAATYYCLGSY DCRSADCWTFGGGTEVVVK PKC13 VH 32 METGLRWLLLGAVLKGVQCQEQLKES GGGLVTPGGTLTLTCTVSGFSLSSYA MSWVRQAPGKGLEWIGIIISGGSAYY ATWAKGRFTISKTSTTVDLSITSPTT EDTATYFCARAKSGTYTGDYFTLWGQ GTLVTVSS VL 33 MDTRAPTQLLGLLLLWLPGARCAFEL TQTPASVEAAVGGTVTIKCQASESIG NALAWYQQKPGQPPKLLIYRASTLES GVPSRFKGSGSGTEFTLTISDLECAD AATYYCQSYVGSRSTGYNVFGGGTE VVVK PKC14 VH 25 METGLRWLLLVAVLKGVQCQSLEES GGDLVQPGASLTLTCTASGFTLTTY WICWVRQAPGKGLEWVACILTGSGS TYYASWVNGRFTISKTSSTTVTLQM TSLTAADTATYFCARYGGDATYNEN LWGQGTLVTVSS VL 26 MDTRAPTQLLGLLLLWLPGATFAQV LTQTPSSVSAAVGGTVTINCQASQS VYNNNRLSWYQQKPGQPPKRLIYGV STLYYGVSSRFKGSGSGTQFTLTIS GMQCDDAAIYYCLGGYDCASADCYA FGGGTEVVVK
12. (canceled)
13. An antibody, or antigen-binding portion thereof, capable of binding human PKCg, or a proteolytic fragment of PKCg, wherein the antigen-binding portion of the antibody comprises a set of six CDRs: CDR-H11, CDR-H12, CDR-H13, CDR-L1, CDR-L2, and CDR-L3, selected from the group of CDR sets as follows: TABLE-US-00012 CDR Set CDR Amino No. CDR Acid Sequence SEQ. ID NO: 1 CDR-H1 GFSLNYYA SEQ ID NO: 3 CDR-H2 ITSDTT SEQ ID NO: 4 CDR-H3 ASGGSTTSPAL SEQ ID NO: 5 CDR-L1 QSVWSKNY SEQ ID NO: 6 CDR-L2 SAS SEQ ID NO: 7 CDR-L3 LGSYDCRSADCWT SEQ ID NO: 8 2 CDR-H1 GFSLSSYA SEQ ID NO: 9 CDR-H2 IISGGSA SEQ ID NO: 10 CDR-H3 ARAKSGTYTGDYFTL SEQ ID NO: 11 CDR-L1 ESIGNA SEQ ID NO: 12 CDR-L2 RAS SEQ ID NO: 13 CDR-L3 QSYVGSRSTGYNV SEQ ID NO: 14 3 CDR-H1 GFTLTTYW SEQ ID NO: 15 CDR-H2 ILTGSGST SEQ ID NO: 16 CDR-H3 ARYGGDATYNENL SEQ ID NO: 17 CDR-L1 QSVYNNNR SEQ ID NO: 18 CDR-L2 GVS SEQ ID NO: 19 CDR-L3 LGGYDCASADCYA SEQ ID NO: 20
14. The antibody, or antigen-binding portion thereof, of claim 13 comprising VH and VL domains, selected from the group consisting of: TABLE-US-00013 SEQ amino acid sequence ID 12345678901234567890- antibody domain NO. 12345678901234567890 PKC11 VH 21 METGLRWLLLVAVLKGVQCQSVEESGGRLVTPG TPLALTCTVSGFSLNYYAMNWVRQAPVKGLEWI GVITSDTTYYASWAKGRFTISKTSTTVELQITS PTTEDTATYFCASGGSTTSPALWGQGTLVTVSS VL 22 MDTRAPTQLLGLLLLWLPGATFAQVLTQTPSPV SAAVGSTVTINCQASQSVWSKNYLSWFQQKPGQ PPKQLIYSASTLASGVPSRFSGSGSGTQFTLTI SDVQCDDAATYYCLGSYDCRSADCWTFGGGTEV VVK PKC13 VH 32 METGLRWLLLGAVLKGVQCQEQLKESGGGLVTP GGTLTLTCTVSGFSLSSYAMSWVRQAPGKGLEW IGIIISGGSAYYATWAKGRFTISKTSTTVDLSI TSPTTEDTATYFCARAKSGTYTGDYFTLWGQGT LVTVSS VL 33 MDTRAPTQLLGLLLLWLPGARCAFELTQTPASV EAAVGGTVTIKCQASESIGNALAWYQQKPGQPP KLLIYRASTLESGVPSRFKGSGSGTEFTLTISD LECADAATYYCQSYVGSRSTGYNVFGGGTEVV VK PKC14 VH 25 METGLRWLLLVAVLKGVQCQSLEESGGDLVQPG ASLTLTCTASGFTLTTYWICWVRQAPGKGLEWV ACILTGSGSTYYASWVNGRFTISKTSSTTVTLQ MTSLTAADTATYFCARYGGDATYNENLWGQGTL VTVSS VL 26 MDTRAPTQLLGLLLLWLPGATFAQVLTQTPSSV SAAVGGTVTINCQASQSVYNNNRLSWYQQKPGQ PPKRLIYGVSTLYYGVSSRFKGSGSGTQFTLTI SGMQCDDAAIYYCLGGYDCASADCYAFGGGTEV VVK
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
DETAILED DESCRIPTION OF THE INVENTION
[0046] The present invention describes a rapid and accurate method for detecting damage to the central nervous system caused by a traumatic or ischemic event. In particular, the present invention is directed to a novel in vitro method for diagnosing a traumatic brain injury (TBI) or stroke. Traumatic events in the central nervous system such as TBI or stroke lead to biochemical disruptions resulting from cellular damage. These biochemical disruptions include the appearance in the bloodstream of biomarkers that are indicative of an ischemic event involving the brain, which biomarkers may be detected and quantified as reliable indicators of an ischemic episode in the central nervous system.
[0047] The diagnostic target of the method of the present invention is the gamma isozyme of protein kinase C (PKCγ or PKCg), which is confined in the central nervous system under normal conditions but which appears outside the blood brain barrier after CNS insult, such as following a TBI or stroke. In addition, the CNS interstitial excitotoxic environment resulting from CNS injury causes full-length PKCg to break down into one or more proteolytic fragments which also appear in the peripheral blood of an individual suffering CNS injury. Such peripheral PKCg and proteolytic fragments of PKCg are detectable in a blood sample once the Blood Brain Barrier loosens, providing a potential diagnostic indicator of CNS injuries including TBI and Stroke if the PKCg fragments may be preferentially detected and distinguished from other isoforms of protein kinase C. The present invention proves that such a sensitive diagnostic method is possible and provides specific materials and methods for making completely accurate determinations of CNS injury from analysis of peripheral blood in vitro from a subject suspected of having suffered a CNS insult.
[0048] Accordingly, the detection of PKCg and PKCg proteolytic fragments in a peripheral blood sample is an early diagnostic indicator of a traumatic or ischemic event involving the central nervous system, making early detection and early treatment possible. Also, advantageously, the amount of PKCg and proteolytic fragments detected in the venous blood of an individual having suffered a TBI or stroke is proportional to the degree of tissue damage, and therefore an assay for quantitating the levels of PKCg/PKCg fragments in a sample of peripheral blood as described herein is indicative of the extent of the trauma sustained in the central nervous system.
[0049] As PKCg/PKCg proteolytic fragments enter the bloodstream as the result of an ischemic event, the in vitro method of the present invention is particularly advantageous in that it provides a quick and reliable diagnosis of TBI or stroke, particularly within the critical time period where early detection and treatment of CNS damage can prevent permanent damage. As such, preferably the blood sample is drawn from the subject suspected of having suffered a traumatic brain injury or stroke immediately following the ischemic event or as soon as possible thereafter, preferably within 6 to 24 hours of the time of the CNS injury, more preferably within 6-16 hours of the time of the CNS injury.
[0050] The present method may employ any technique known in the art for detecting/quantifying the presence of a protein in a biological sample. For example, a sandwich-type assay capable of detecting the presence of PKCg and one or more PKCg proteolytic fragment(s) in a blood sample may be used. According to the method, a biological sample from a patient suspected of having suffered a CNS injury is loaded into a detection vessel that separates and immobilizes the target PKCg protein and one or more of its proteolytic fragments. The immobilized target proteins/polypeptides are then contacted with a first anti-PKCg (primary) antibody raised against a unique epitope on the PKCg protein under conditions that facilitate the formation of PKCg/primary antibody binding complex. A subsequent wash step may be employed to remove any unbound protein/antibody from the rest of the sample mixture. A secondary detectably labeled antibody, e.g., conjugated with a fluorescent tag, capable of binding to the primary antibody, is then contacted with the target/primary antibody complex and the detectable label (e.g., fluorescent signal) is detected and the amount of PKCg and/or PKCg proteolytic fragment(s) present in the sample is calculated.
[0051] Any known in vitro method in the art for detecting the presence of a protein in a sample may be employed in the present method for diagnosing TBI or stroke. Preferably, PKCg is detected in a sample of blood from a mammalian subject by contacting the sample with a binding partner for PKCg, that is, a peptide, immunoglobulin, small molecule, or other moiety capable of forming an association complex with PKCg. Most preferably, the PKCg in a sample is detected using the anti-PKCg monoclonal antibodies as described herein to form a PKCg/anti-PKCg antibody binding complex. Detection and quantitation of the PKCg/anti-PKCg antibody binding complex may also be performed by methods well known in the art including, but not limited to, gas chromatography mass spectroscopy, thin layer chromatography, hydroxyl apatite chromatography, high pressure liquid chromatography, enzyme-linked immunosorbent assay, etc. Preferably, the blood sample is analyzed via a fluorescent assay or the chemiluminescent capillary assay method described below.
[0052] In another embodiment, the present invention is directed to a point of care assay kit for diagnosing a traumatic brain injury or stroke from the blood sample of a subject suspected of sustaining such a CNS injury. The point of care assay kit will include all materials necessary for a rapid immunoassay for diagnosis of TBI or stroke according to the method of the present invention. Materials include reagents, vessels, a handheld reader with wireless connection to a computer for rapid download of patient information, instruments, and/or instructions necessary for performing the method. A point of care assay kit is particularly suitable for use by emergency medical personnel to rapidly triage a patient based on a definitive diagnosis of an ischemic event such as TBI or stroke.
[0053] Examples illustrating the diagnostic methods of the present invention are set forth below. The examples are provided to demonstrate methods and reagents useful for practicing the invention and are intended to illustrate the invention without limiting the scope of the invention. In light of the present disclosure and the general level of skill in the art, practitioners will appreciate that numerous changes, modifications, and alterations can be employed without departing from the scope of the presently disclosed subject matter.
EXAMPLES
Example 1. Production of Anti-PKCg Monoclonal Antibodies in Rabbits
[0054] Monoclonal antibodies against PKCg were generated in New Zealand White rabbits. One New Zealand White rabbit was immunized with a 303-amino acid polypeptide comprising amino acids 395-697 of PKCg:
TABLE-US-00006 (SEQ ID NO:38) CTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYH IQQLGKFKEPHAAFYAAEIAIGLFFLIINQGIIYRDLKLDNVMLDAEGIIK ITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLY EMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKR LGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFT RAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM.
[0055] A second New Zealand White rabbit was immunized with two shorter peptides having unique sequences from the C3/C4 catalytic domain of PKCg comprising amino acids 405-414 (Peptide #1) comprising the amino acid sequence: LGGRGPGGRP (SEQ ID NO:35), and amino acids 673-697 (Peptide #2) comprising the amino acid sequence:
[0056] FTYVNPDFVHPDARSPTSPVPVPVM (SEQ ID NO:36). Peptides #1 and #2 were synthesized with an N-terminal cysteine residue that was used as a reactive site to link plural peptides to a keyhole limpet hemocyanin (KLH) carrier protein.
[0057] The immunizations of both rabbits followed a standard 78-day protocol (ImmunoPrecise Antibodies, Ltd, Victoria Vancouver Canada) as follows: Day 0: control serum collection/Pre-immune Bleed; Day 1: primary injection to immunize with 0.25 mg antigen in complete Freund's Adjuvant; Day 14: Boost with 0.1 mg antigen in Incomplete Freund's Adjuvant; Day 28: Serum Collection (25 ml per rabbit); Day 42: Second Boost with 0.10 mg antigen in Incomplete Freund's Adjuvant; Day 56: second serum collection (25 ml per rabbit) and Third booster with 0.10 mg antigen in Incomplete Freund's Adjuvant; Day 72: serum collection 50 ml per rabbit; Day 78: ELISA titration to verify antibody concentration in rabbits.
[0058] Prior to injection, each peptide (antigen) was mixed 1:1 in Complete Freund's Adjuvant (CFA) for primary immunization. Subsequent booster injections (described in 78-day protocol above) were carried out in a 1:1 mixture of antigen in Incomplete Freund's Adjuvant (ICFA). The mixture of peptide and adjuvant was split into 4 equal portions and injected subcutaneously at four sites in the fore and hind quarters of each rabbit.
[0059] Test bleeds were performed on Day 28, Day 56, and Day 72 for each rabbit and serum was tested by indirect ELISA. It was determined that the titres of both rabbits were suitable for rabbit monoclonal antibody testing procedures. Both rabbits showed similar titres in indirect ELISA. Indirect ELISA uses both types of antibodies to amplify the signals for better detection. Indirect ELISA technique was performed as follows: 96-well plates were incubated with antigens and washed to block non-specific binding. Primary antibodies were added and washed. Enzyme-linked secondary antibody was added and washed. The indirect antibody is enzyme-linked to a colorimetric end point which allows quantification of antibody bound to the plate using a spectrometer.
[0060] Approximately 30 ml of heparinized whole blood was drawn on each serum collection described above from each rabbit and pooled for B cell culturing. Peripheral blood mononuclear cells (PBMCs) were isolated from the whole blood of each rabbit and the supernatants were cultured in 40×96-well plates and were screened by indirect ELISA against PKCg on day 9. Antigen-positive wells were preserved in Invitrogen RNA lysis buffer (ThermoFisher) and stored at −80° C.
[0061] cDNA was synthesized from individual RNA samples and 2 rounds of PCR performed to prepare the antibody variable region cDNA for cloning. Rabbit IgG heavy chain cDNAs and rabbit IgG kappa light chain cDNAs were cloned into mammalian expression vectors. Expression constructs were co-transfected into HEK 293 cells and cell culture supernatants assayed by sandwich ELISA. Transfected cell culture supernatants were further tested using Multi-Antigen Print ImmunoAssay, MAPIA (Lyashchenko et al., J. Immunol. Methods, 242(1-2): 91-100 (2000)).
[0062] Cloning of the top ranked 28 positives proceeded to Phase III cloning. 22 clones, each in 1.5 ml of transfected supernatant were further tested. Five clones were selected for 50 ml scale expression/purification (see Table 1) using Chembio Diagnostic Systems Multi-Antigen Print ImmunoAssay (MAPIA) technique where cell culture supernatants are immobilized on nitrocellulose membranes followed by antibody detection using standard chromogenic immunodevelopment.
TABLE-US-00007 TABLE 1 Top five clones selected and yield of 50 mL scale expression/purification Clones Batch Conc. Clone (HC) (κC) number (mg/ml) Amount (mg) 1 1H1 1K1 1777 1.6 3.3 2 4H1 4K1 1778 1.7 0.7 3 7H1 7K3 1779 1.4 3.2 4 20H1 20K3 1780 1.9 1.4 5 5H1 5K1 1781 1.5 4.6
The DNA sequences of the five clones in Table 1 were determined.
DNA Sequence Analysis of Rabbit IgG Heavy and Light Antibody Chains
[0063] The rabbit IgG heavy chain was isolated and sequenced and is approximately 1200 bp. The rabbit kappa light chain was isolated and sequenced and is approximately 700 bp. It was determined that the heavy and light chain DNA sequences from each clone in Table 1 (1H1/1K1, 4H1/4K1, 7H1/7K3, 20H1/20K3, and 5H1/5K1) all have different sequences within the variable region. The variable region amino acid sequences for the five clones encoded by the isolated DNAs are set forth below in Table 2. The three heavy chain Complementarity Determining Regions (CDR-H1, CDR-H2, and CDR-H3) and the three light chain Complementarity Determining Regions (CDR-L1, CDR-L2, and CDR-L3) for each clone are underlined in Table 2.
TABLE-US-00008 TABLE 2 Variable Domain Amino Acid Sequences for Rabbit Anti-PKCγ Antibodies VH and SEQ amino acid sequences VL Variable ID 12345678901234567890- Clones Domain NO. 12345678901234567890 1H1 VH 21 METGLRWLLLVAVLKGVQCQSVEESG GRLVTPGTPLALTCTVSGFSLNYYAM NWVRQAPVKGLEWIGVITSDTTYYAS WAKGRFTISKTSTTVELQITSPTTED TATYFCASGGSTTSPALWGQGTLV TVSS 1K1 VL 22 MDTRAPTQLLGLLLLWLPGATFAQV LTQTPSPVSAAVGSTVTINCQASQS VWSKNYLSWFQQKPGQPPKQLIYSA STLASGVPSRFSGSGSGTQFTLTIS DVQCDDAATYYCLGSYDCRSADCWT FGGGTEVVVK 4H1 VH 23 METGLRWLLLVAVLKGVQCQSVEESG GRLVTPGTPLTLTCTVSGFSLSLSRNA VSWVRQAPGKGLEWTGIIFGDAKTYY ASWAKGRFTISKTATTVDLKITSLTT EDTATYFCVAGTGLWGQGTLVT VSS 4K1 VL 24 MDTRAPTQLLGLLLLWLPGATFA QVLTQTASPVSAAVGSTVTINCQ ASQSVYNKNRLSWYQQKPGQPPK RLIYSSSTLDSGVPLRFSGSGSG TQFTLTISGVQCDDAATYYCLGS YDCSSADCNAFGGGTEVVVK 7H1 VII 25 METGLRWLLLVAVLKGVQCQSLEESGGDLV QPGASLTLTCTASGFTLTTYWICWVRQAPGK GLEWVACILTGSGSTYYASWVNGRFTISKT SSTTVTLQMTSLTAADTATYFCARYGGDA TYNENLWGQGTLVTVSS 7K3 VL 26 MDTRAPTQLLGLLLLWLPGATFAQVLTQTP SSVSAAVGGTVTINCQASQSVYNNNRLSWYQ QKPGQPPKRLIYGVSTLYYGVSSRFKGSGSG TQFTLTISGMQCDDAAIYYCLGGYDCASA DCYAFGGGTEVVVK 20H1 VII 30 METGLRWLLLVAVLKGVQCQSVEESGGR LVTPGTPLTLTCTVSGIDLSSNAMNWVR QAPGKGLEWIGIIGFSGSTNYASWAKGRF TISKTSTTVDLKITSPTTEDTATYFC ARGGLNIGMNLWGQGTLVTVSS 20K3 VL 31 MDTRAPTQLLGLLLLWLPGATFAQVL TQTPSPVSAAVGGTVPISCQSSQSVY DNNWLAWYQQKPGQPPKLLVYYASTL ASGVPSRFKGSGSGTQFTLTINDLEC DDAATYYCAGGYGDTNGGASSFGGG TEVVVK 5H1 VII 32 METGLRWLLLGAVLKGVQCQEQLKESGG GLVTPGGTLTLTCTVSGFSLSSYAMSWVR QAPGKGLEWIGIIISGGSAYYATWAKGRF TISKTSTTVDLSITSPTTEDTATYFC ARAKSGTYTGDYFTLWGQGTLVTVSS 5K1 VL 33 MDTRAPTQLLGLLLLWLPGARCAFELT QTPASVEAAVGGTVTIKCQASESIGNA LAWYQQKPGQPPKLLIYRASTLESGV PSRFKGSGSGTEFTLTISDLECADAA TYYCQSYVGSRSTGYNVFGGGTEVVVK
[0064] The sequence data indicate that all the antibody clones recovered have different variable region sequences suggesting that all rabbit monoclonal antibodies recovered bind to different epitopes on the PKCg protein.
Cloning, Expression, and Purification of Five Monoclonal Antibodies
[0065] The rabbit IgG heavy chain DNA for each clone and the rabbit kappa light chain DNA for each clone were cloned separately into a CMV expression vector. Lymphocytes were fused with rabbit myeloma cells (240E-W) in the presence of polyethylene glycol. The resulting hybridoma clones were grown in tissue culture medium until mid-log growth was reached (ImmunoPrecise proprietary methods). Hybridomas were isotyped for IgG, IgM, and IgA; clones chosen expressed IgG isotype. Clones were probed against Proteintech Recombinant PRKCG (catalog ag5910) using a Multi-Antigen Print Immunoassay (MAPIA) developed by Chembio Diagnostic Systems Inc. (Lyashchenko et al., J. Immunol. Methods, 242(1-2): 91-100 (2000)). Anti-PKCg monoclonal antibodies made from the cloned heavy and light chains were tested for binding activity, and three high affinity anti-PKCg mAbs, designated PKC11 (1H1/1K1), PKC13 (5H1/5K1), and PKC14 (7H1/7K3), respectively, were selected for further testing.
Example 2. Analysis of Anti-PKCg Monoclonal Antibody Binding to PKCg Proteolytic Fragments in Diagnosing TBI from Human Plasma Samples
[0066] The three selected rabbit monoclonal antibodies referenced above, PKC11, PKC13, and PKC14 were used to detect the presence of PKCg and PKCg proteolytic fragments in samples of blood obtained from TBI or stroke patients. The results described below demonstrate that all three rabbit monoclonal antibodies display unique staining patterns for the clinical samples from normal human plasma (control) vs. plasma from TBI or stroke patients. In order to quantitate the different fragment staining profiles for each antibody and the effects seen for normal clinical plasma samples vs. TBI samples, the composite specific chemiluminescence signal was graphed for each sample stained (complexed) with the monoclonal antibodies. A capillary electrophoresis chemiluminescence immunoassay (Raybiotech, Norcross, Ga.) was used to generate the signal levels for a cohort of 33 TBI plasma samples and 12 normal human control plasma samples.
Analysis of Antibody/PKCg Binding Data by Receiver Operator Characteristic (ROC) Curves
[0067] For the present analysis of comparing the PKCg/PKCg proteolytic fragment binding profiles for the three monoclonal antibodies with the plasma of TBI and stroke patients vs. plasma from normal subjects (control), ROC curves compared the probabilities of overlap between Sensitivity and False Positive (1-Specificity) samples in the clinical cohorts described above. Sensitivity for this purpose was described as probability (P) that a positive test result overlapped with a positive disease (TBI or stroke) [P(Test+|Disease+). Similarly testing for the False Positives, we used the [P(Test+|Disease−), a condition where there is a positive test when there is no disease. An Excel pivot table application was used to count the number of healthy vs. disease samples. The Sensitivity was calculated using (=SUM individual disease samples)/total of all disease samples). False Positives were calculated using the (=SUM each individual healthy sample/total of all healthy samples). Specificity is defined as (1-False Positives). This statistical method maximizes sensitivity and identifies the probability of false positives. The cut-off point for each ROC curve between healthy and disease samples was calculated and then related to the total chemiluminescence signal that is represented by those probabilities. The cut-off for each sample cohort stained with PKC11, PKC13, and PKC14 antibodies are represented by a line in each graph below.
Analysis of Normal and TBI Samples by Chemiluminescence Capillary ELISA
[0068] All normal and TBI plasma samples were screened with each of the three anti-PKCg monoclonal antibodies for the presence of PKCg and PKCg proteolytic fragments via a chemiluminescence capillary ELISA assay. Advantageously, the chemiluminescent capillary ELISA utilizing the PKCg and PKCg fragment detection antibodies as immunoprobes according to the present disclosure, provides a highly sensitive method for detecting the presence of PKCg and/or PKCg proteolytic fragments present in a sample of venous blood of an individual following a possible traumatic brain injury or stroke.
Assaying TBI Samples
[0069] Briefly, to conduct the chemiluminescent capillary ELISA in this example, reagents and individual plasma from Normal vs. TBI clinical samples were loaded into an automated Western blot machine (using the Auto-Western service from RayBiotech Life, Inc). In the first step, sample is loaded into the capillary automatically. Proteins are then separated by size as they electophoretically migrate through a stacking and separation matrix. The separated proteins are then immobilized on the capillary wall via a proprietary photoactivated capture chemistry. Target proteins, i.e., PKCg and/or PKCg proteolytic fragments were identified using a primary antibody, e.g., the rabbit monoclonal antibodies described herein, and immunoprobed with an HRP-conjugated secondary goat anti-rabbit IgG antibody and chemiluminescent substrate. An electropherogram is produced which plots the baseline, molecular weight and quantitative chemiluminescence signal of each peak. The quantitative signal was derived for each molecular weight band in every electropherogram. Each quantitative chemiluminescence signal was generated using the following formula; (C2-C1/C1), where C2 equals Area Under the Curve and C1 equals the baseline for that sample. This specific chemiluminescence measure was used in comparisons of all normal human plasma compared to TBI or stroke plasma samples after staining with antibodies, i.e., PKC11, PKC13, or PKC14. Statistical comparisons were made using GraphPad Prism 8 software. The resulting specific chemiluminescence signal was detected and quantitated, with sensitivity down in the picograms/ml range, providing a direct measure of TBI biomarkers, i.e., PKCg, and/or PKCg proteolytic fragments.
[0070] A total of 201 human plasma samples were analyzed using the using the automated Western blot technology. Normal Human Plasma samples were stained (contacted) with PKC11 (n=13), PKC13 (n=13), and PKC14 (n=14). A minimum of 13 individual normal human plasma samples were analyzed with each rabbit monoclonal antibody. Accounting for repeated measures from comparisons on five separate dates, a total of 56 normal human plasma samples were analyzed via the capillary ELISA assay. Plasma from TBI patients were also analyzed against (contacted with) PKC11 (n=34), PKC13 (n=33), and PKC14 (n=33). A minimum of 33 individual samples were analyzed for each rabbit monoclonal antibody and monoclonal antibody combinations. A total of 145 TBI plasma samples were run and correlated from 5 separate dates.
[0071] All statistical comparisons were run using GraphPad Prism 8 software (GraphPad Software, La Jolla, Calif.). The chemiluminescence signals from a cohort of normal vs. a cohort of TBI samples were compared. An unpaired 2-tailed Student T-test was run assuming a parametric distribution. A Welch's correction was used to test for equal SD of both samples. P Values are significant at P<0.05. Mean and Standard Error of the mean were calculated at the 95% confidence level.
Composite Signal Comparison of TBI Vs. Normal Plasma Samples Stained with Anti-PKCg mAbs PKC11, PKC13, and PKC14
[0072] A Chemiluminescent Capillary Western Blot Analysis (RayBiotech, GA) was used to characterize the PKCg signal in PKC11, PKC13, and PKC14 stained samples of normal human plasma vs. Traumatic Brain Injury plasma. Statistical comparisons were made using a 2-Tailed, unpaired Student T-Test at the 95% confidence limit. For each of the three rabbit monoclonal antibodies tested there was a significantly higher chemiluminescence signal for TBI plasma samples when compared to normal plasma samples. The results are shown in
[0073] As seen in
[0074] Staining patterns for individual samples probed with the anti-PKCg mAbs are shown in
[0075] Staining patterns with PKC11, PKC13, and PKC14 are unique. High peaks in PKC11 TBI samples (T) include T130, T223, T247 vs. PKC13 peaks at T220, T233, T240, T265, T266, T293, T305 and PKC14 peaks at T079, T209, T258. A positive diagnosis of TBI was made for PKC11 in 91% of the samples (30/33 TBI samples above the background), 91% of the samples for PKC13 (31/34 TBI samples positive) and 91% of the samples for PKC14 (30/33 TBI samples positive).
Multiplex Analysis of TBI Samples
[0076] As demonstrated below, it was discovered that by combining (also referred to herein as “multiplexing”) the chemiluminescent binding results for two monoclonal antibodies for PKCg leads to a marked improvement in the accuracy and reliability of TBI diagnosis. The results of multiplexing the PKCg binding results of antibodies PKC11 and PKC13 for the TBI samples are shown in
[0077] PKC11 and PKC13 were multiplexed to determine the resulting effects on a positive diagnosis of TBI. Combining the chemiluminescent results for PKC11 and PKC13 improved the TBI-positive diagnosis from 91% when antibodies were assessed individually to 100% TBI-positive for the combined antibodies (34/34 TBI(+) samples at or above the background line). Multiplexing with PKC14 did not further improve this (100% accurate) diagnosis (data not shown).
[0078] PKC11 and PKC13 antibody stains of normal human plasma vs. TBI plasma samples were plotted concurrently illustrating the differences in staining between the two antibodies. For some samples, e.g., T022, T130, and T223, the mAb PKC11 chemiluminescent signal exceeded the mAb PKC13 signal; but for TBI samples T265 and T266, a very high signal was shown, as compared with a low signal for the same samples stained with mAb PKC11. The horizontal cut-off (line) in
Analysis of TBI Vs. Normal Plasma Samples Stained with Anti-PKCg mAbs
[0079] Plasma samples from normal and TBI patients were stained with the PKC11, PKC13, or PKC14 monoclonal antibodies and analyzed for the presence of PKCg and PKCg proteolytic fragments by the chemiluminescence assay described above. The ROC Curve results for TBI vs. normal plasma samples are shown in
[0080] The results shown in
[0081] The consequence to a patient showing a false positive probability is the patient would need to undergo additional blood draw and re-testing of the PKCg assay to confirm the PKCg levels in the sample. This is a significant factor in a diagnosis setting where time is of the essence for prescribing effective treatment to attenuate the effect of CNS injury. With further indication of higher than normal levels of PKCg, the patient would undergo neurological and interventional radiology testing to identify additional clinical concerns for the patient. The clinical benefit of rapid and accurate diagnosis of TBI is lost if the incidence and probability of false positives is high. This makes TBI diagnostic assays of improved sensitivity highly desirable.
Detection of PKCg/PKCg Proteolytic Fragments by Antibodies PKC11, PKC13, and PKC14
[0082] A statistical comparison of chemiluminescent signals of normal and TBI samples stained with PKC11, PKC13, and PKC14 was conducted. The results are shown in
[0083] The PKC11 antibody shows a significant increase in the signal for TBI plasma compared to normal plasma for the 49-52 kDa fragment, and PKC11 shows the highest signal for full-length PKCg (63-73 kDa) in TBI plasma compared against samples of normal plasma.
[0084] The PKC13 antibody shows the greatest signal response to binding PKCg/PKCg fragment targets. PKC13 has a significant signal increase for the 42-48 kDa, 49-52 kDa, and 53-60 kDa fragments, which improves the TBI(+) diagnosis.
[0085] The PKC14 antibody has a significant signal increase for detection of the 49-52 kDa fragment. The highest signal was for the 53-60 kDa fragment, but the signal for the 42-48 kDa fragment was not significantly different for the normal vs. TBI samples.
Comparison of Antibody Stained Bands in Normal Vs. TBI Plasma Samples
[0086]
[0087] The results in
Receiver Operator Curve (ROC) Fragment 49-52 KD Stained with PKC11, PKC13, and PKC14
[0088] ROC Curves were generated for the PKCg 49-52 kDa fragment stained with rabbit monoclonal antibodies PKC11 (A), PKC13 (B), and PKC14 (C). The results are shown in
[0089] The black circles in
[0090] In
[0091]
[0092]
Conclusions for TBI
[0093] The data presented above demonstrate that the novel in vitro method of the present invention provides a simple, quick, and reliable tool for diagnosing a traumatic brain injury from a sample of venous blood. Using a standard assay, such as the capillary chemiluminescence assay described above, it has been demonstrated that all of the three rabbit monoclonal antibodies described above, PKC11, PKC13, and PKC14, recognize unique epitopes on the PKCg/PKCg proteolytic fragment biomarkers for CNS injury, and each antibody displays a unique staining pattern for these biomarkers and thereby, when used individually or in combination, provide a reliable diagnostic tool for determining the occurrence and severity of a traumatic brain injury.
[0094] The results also demonstrate that the 49-52 kDa fragment is usually found only in TBI(+) samples and as such the PKCg or PKCg fragment improves the diagnosis of TBI in subjects tested according to the method of the invention. The Sensitivity of the 49-52 kDa fragment analyzed by ROC Curves is greater than probability P=0.91 for all three monoclonal antibodies studied, making it an ideal amplifier of the diagnosis of clinical TBI.
[0095] Additional fragments, such as the 33-36 kDa, 42-48 kDa, 53-60 kDa fragments have a lower Sensitivity than the 49-52 kDa fragment by ROC analysis (P=<0.9) with corresponding elevated probabilities of False Positives. These additional fragments therefore enhance the diagnosis of TBI to a lesser degree in samples stained with the three monoclonal antibodies but still provide a useful and reliable indicator of TBI. Furthermore, the combination of any two of the anti-PKCg antibodies recognizing one or more typical PKCg proteolytic fragments improves the accuracy of the diagnosis to 100%.
Example 3. Analysis of Anti-PKCg Monoclonal Antibody Binding to PKCg Proteolytic Fragments in Diagnosing Stroke from Human Plasma Samples
[0096] Plasma samples from subjects having been diagnosed as suffering a stroke were analyzed for the presence of PKCg and PKCg proteolytic fragments by staining with mAbs PKC11, PKC13, and PKC14 according to the chemiluminescence capillary ELISA assay as described above. The results demonstrate that the novel method of the present invention provides a quick and reliable diagnostic method for detecting stroke in patients suspected of suffering therefrom.
Detection of PKCg in Normal Vs. Stroke Plasma Samples
[0097] Staining of the stroke samples with PKC11, PKC13, and PKC14 using the chemiluminescence capillary assay showed significantly higher levels of PKCg in stroke vs. normal human plasma samples.
Detection of PKCg using Multiplexed Antibodies
[0098] Plasma samples from the stroke patients were analyzed for the presence of PKCg and PKCg proteolytic fragments by staining with the PKC11 and PKC13 monoclonal antibodies individually and multiplexed (both PKC11 and PKC13) according to the chemiluminescence capillary ELISA assay as described above. The results are shown in
[0099] The results demonstrate that the novel method of the present invention provides a quick and reliable diagnostic method for detecting the occurrence of a stroke in patients having suffered a stroke event. Further, the results again indicate that multiplexing with anti-PKCg antibodies having different PKCg fragment specificities improves the certainty of this diagnosis.
[0100] PKC11 staining of individual samples of normal human plasma compared against plasma samples of stroke victims in
Detection of PKCg Fragments in Normal Vs. Stroke Plasma Samples
[0101] A statistical comparison of chemiluminescent signals of normal and stroke plasma samples stained with PKC11, PKC13, and PKC14 was conducted. The results are shown in
[0102]
[0103]
[0104]
Detection of the PKCg 49-52 kDa Fragments in Normal Vs. Stroke Plasma Samples
[0105]
[0106] The ROC curve analysis shows high Sensitivity of individual 49-52 kDa fragments from normal vs. stroke plasma samples stained with PKC11, PKC13, and PKC14, which confirms the enhanced diagnostic utility of the assaying for the PKCg 49-52 kDa proteolytic fragment for diagnosing stroke. The analysis shown in
[0107] For PKC13 staining of the 49-52 kDa fragment, shown in
[0108] The results for PKC14 staining of the 49-52 kDa fragment, shown in
Detection of PKCg Alternate Fragments in Normal Vs. Stroke Plasma Samples
[0109] An analysis of stroke samples compared with normal human plasma samples illustrates the degree that PKCg fragments can contribute to a stroke-positive diagnosis. The ROC analysis of the PKCg 33-36 kDa, 42-48 kDa, and 53-60 kDa fragments stained with PKC11, PKC13, and PKC14 do not reach the Sensitivity seen for the 49-52 kDa fragment (P>0.9) and as such contribute varying degrees of enhancement to the diagnosis of stroke. The results are shown in Table 3 (below).
[0110] For example, PKC13 staining shows Sensitivity in the range of P=0.7 to P=0.8 with False Positives less than or equal to P=0.2 and Specificity P=0.8 to P=1.0. The contributions to the signal for the 42-48 kDa and 53-60 kDa fragments are greater than 2200 chemiluminescence units with the probability of false positives at a low level (20%).
[0111] Another example from Table 3 shows that the major contribution of stroke diagnosis for the 63-73 kDa fragment is from PKC11 with Sensitivity at P=0.5, False Positives at P=0.3 and Specificity at P=0.7. In contrast, PKC13 shows no response for the 63-73 kDa fragment. (See, Table 3). PKC14 shows a response for the 63-73 kDa fragment with a signal of 688 chemiluminescence units but lower Sensitivity and higher False Positives (Sensitivity P=0.5 and False Positives P=0.5).
TABLE-US-00009 TABLE 3 ROC Analysis of Various PKCg Fragments in Stroke vs. Normal Human Plasma PKCg Fragment Sensitivity False Positive Signal Antibody (Name) P = P = Chemiluminescence PKC11 33-36 kDa 0.75 0.2 126 42-48 kDa 0.33 0.6 637 53-60 kDa 0.33 0.54 1545 63-73 kDa 0.5 0.33 1770 PKC13 33-36 kDa 0.71 0.2 319 42-48 kDa 0.8 0 2213 53-60 kDa 0.78 0.2 3348 63-73 kDa No Response PKC14 33-36 kDa 0.78 0.42 230 42-48 kDa 0.88 0.33 633 53-60 kDa 0.6 0.36 654 63-73 kDa 0.5 0.5 866 95-105 0.63 0.33 443
[0112] Therefore, signals from the PKCg fragments with high Sensitivity, High Specificity, and Low False Positives, are shown to enhance the stroke(+) diagnosis.
ROC Curve for the PKCg 42-48 kDa Fragment in Normal Vs. Stroke Plasma Samples Stained with mAb PKC13
[0113]
CONCLUSIONS
[0114] All rabbit monoclonal antibodies recovered have different variable region sequences and bind to different epitopes on the PKCg protein. Three of the rabbit monoclonal antibodies cloned, i.e., PKC11, PKC13, and PKC14, were analyzed for the ability to detect PKCg and PKCg proteolytic fragments in plasma samples of patients diagnosed as having suffered a TBI and patients diagnosed with having suffered a stroke, compared with plasma samples from normal (control) subjects, using quantitative chemiluminescence capillary Western blot techniques.
[0115] Rabbit monoclonal antibodies PKC11, PKC13, and PKC14 can bind to unique epitopes present on the full-length PKCg protein. In addition, all three rabbit monoclonal antibodies recognize epitopes present on the PKCg proteolytic fragments of 32-36 kDa, 42-48 kDa, 49-52 kDa, and 53-60 kDa that develop as a result of CNS injury and transport across the BBB in peripheral circulation.
[0116] PKC11 and PKC13 show strong signals (binding to) for full-length PKCg and the PKCg proteolytic fragments. Multiplexing of PKC11 and PKC13 antibodies for the PKCg proteolytic fragments greatly enhances the diagnosis of TBI or stroke in plasma samples. Analysis of the proteolytic fragments of PKCg combined from PKC11, PKC13, and PKC14 staining can improve the detection rate (diagnosis) to varying degrees of both TBI and stroke in the clinical samples tested. In particular, the presence of the PKCg 49-52 kDa fragment in a sample greatly enhances the diagnosis of both TBI(+) and stroke(+) because it is rarely found in normal human plasma and presents with high Sensitivity, low False Positives, and high Specificity in both TBI and stroke samples.
[0117] Therefore, as described above, the novel in vitro method of the present invention for detecting and quantifying the presence of PKCg proteolytic fragments and PKCg from a venous blood sample is capable of rapidly and reliably diagnosing the occurrence of a CNS injury such as traumatic brain injury or stroke in an affected individual. The present invention also provides unique monoclonal antibodies particularly suited for use in the novel in vitro methods for diagnosing TBI and stroke, which antibodies recognize (and form a detectable binding complex with) at least one epitope present on the full length PKCg protein and recognize (and form a binding complex with) at least one unique epitope present on at least one of the PKCg proteolytic fragments described above, which binding complexes may be detected by any process known in the art for detecting biomarkers in a biological sample.
[0118] The publications, patent applications, patents, and other documents cited herein are incorporated by reference in their entirety. The examples set forth above are illustrative only and are not intended to be limiting. Obvious variations to the disclosed methods and alternative embodiments of the invention will be apparent to those skilled in the art in view of the foregoing disclosure. All such obvious variants and alternatives are considered to be within the scope of the invention as described herein.