Glycan markers as measure of disease state of hepatic diseases
09796761 · 2017-10-24
Assignee
- National Institute Of Advanced Industrial Science And Technology (Tokyo, JP)
- Public University Corporation Nagoya City University (Aichi, JP)
- National Center For Global Health And Medicine (Tokyo, JP)
- GLYCOBIOMARKER LEADING INNOVATION CO., LTD. (Ibaraki, JP)
Inventors
- Hisashi Narimatsu (Ibaraki, JP)
- Jun Hirabayashi (Ibaraki, JP)
- Yuzuru Ikehara (Ibaraki, JP)
- Takashi Angata (Ibaraki, JP)
- Hiroyuki Kaji (Ibaraki, JP)
- Atsushi Kuno (Ibaraki, JP)
- Takashi Ohkura (Ibaraki, JP)
- Toshihide Shikanai (Ibaraki, JP)
- Maki Sogabe (Ibaraki, JP)
- Akira Togayachi (Ibaraki, JP)
- Makoto Ochou (Ibaraki, JP)
- Yasuhito Tanaka (Aichi, JP)
- Masashi Mizokami (Chiba, JP)
Cpc classification
C07K9/00
CHEMISTRY; METALLURGY
G01N2800/085
PHYSICS
International classification
C40B30/04
CHEMISTRY; METALLURGY
C07K9/00
CHEMISTRY; METALLURGY
Abstract
The present invention is directed to developing a glycan markers capable of detecting a hepatic disease, and more specifically to developing a glycan marker indicating a hepatic disease-state. Furthermore, the present invention is also directed to developing a glycan marker capable of distinguishing hepatic disease-states with the progress of hepatocarcinoma. The present inventors identified, among the serum glycoproteins, glycopeptides and glycoproteins in which a glycan structure specifically changes due to a hepatic diseases including hepatocarcinoma and provide these as novel glycan markers (glycopeptide and glycoprotein) specific to hepatic disease-states.
Claims
1. A method for detecting hepatocarcinoma in a subject, comprising analyzing a glycosylation change associated with the progress of hepatocarcinoma in at least one hepatic disease-state-indicating glycan marker glycoprotein in a specimen taken from the subject, wherein the hepatic disease-state-indicating glycan marker glycoprotein is protein CSF1R having a glycosylation change including fucosylation; wherein the analyzing comprises measurement of an amount of the hepatic disease-state-indicating glycan marker glycoprotein in combination with measurement of LCA binding the hepatic disease-state-indicating glycan marker glycoprotein or AAL binding the hepatic disease-state-indicating glycan marker glycoprotein, wherein elevated hepatic disease-state-indicating glycan marker glycoprotein in combination with elevated LCA binding the hepatic disease-state-indicating glycan marker glycoprotein or AAL binding the hepatic disease-state-indicating glycan marker glycoprotein is indicative of hepatocarcinoma in the subject, provided that the hepatocarcinoma is not one arisen from metastasis.
2. A method for detecting hepatocarcinoma in a subject, comprising analyzing a glycosylation change associated with the progress of hepatocarcinoma in CSF1R in a specimen taken from the subject, wherein the analyzing comprises measurement of an amount of CSF1R binding to a lectin selected from a group consisting of AOL, AAL, ECA, ABA and WFA, wherein increased CSF1R binding to a lectin selected from a group consisting of AOL, AAL, ECA, ABA and WFA is indicative of hepatocarcinoma in the subject.
3. A method for determining progress of fibrosis in a subject, comprising analyzing a glycosylation change associated with the progress of fibrosis in CSF1R in a specimen taken from the subject, wherein the analyzing comprises measurement of an amount of CSF1R binding to LCA or AAL in the specimen taken from the subject and in a specimen from a healthy subject, and comparing the amount of CSF1R binding to LCA or AAL in the specimen from the subject and the specimen from the healthy subject, wherein increased CSF1R binding to LCA or AAL in the specimen taken from the subject is indicative of progress of fibrosis in the subject.
4. A method for determining progress of fibrosis, detecting hepatic cirrhosis, or predicting incidence and recurrence of hepatocarcinoma in a subject comprising analyzing a glycosylation change associated with the progress of fibrosis, hepatic cirrhosis, or hepatocarcinoma in CSF1 R in a specimen taken from the subject, wherein the analyzing comprises measurement of an amount of CSF1 R binding to WFA in the specimen taken from the subject and in a specimen from a healthy subject, and comparing the amount of CSF1 R binding to WFA in the specimen from the subject and the specimen from the healthy subject, wherein increased CSF1 R binding to WFA in the specimen taken from the subject is indicative of progress of fibrosis, hepatic cirrhosis, or predicting incidence and recurrence of hepatocarcinoma in the subject.
5. A method for detecting hepatocarcinoma in a subject, comprising analyzing a glycosylation change associated with the progress of hepatocarcinoma in at least one hepatic disease-state-indicating glycan marker glycoprotein in a specimen taken from the subject, wherein the hepatic disease-state-indicating glycan marker glycoprotein is protein CSF1R having a glycosylation change including fucosylation; wherein the analyzing comprises measurement of an amount of the hepatic disease-state-indicating glycan marker glycoprotein in the specimen taken from the subject in combination with measurement of LCA binding the hepatic disease-state-indicating glycan marker glycoprotein or AAL binding the hepatic disease-state-indicating glycan marker glycoprotein in the specimen taken from the subject wherein an elevated amount of the hepatic disease-state-indicating glycan marker glycoprotein in the specimen taken from the subject in combination with elevated LCA binding the hepatic disease-state-indicating glycan marker glycoprotein or AAL binding the hepatic disease-state-indicating glycan marker glycoprotein in the specimen taken from the subject is indicative of hepatocarcinoma in the subject.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1) The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
(2)
(3)
(4)
(5)
(6)
(7) Disappearance of a normal structure and function for homeostatic activity are observed at this time and simultaneously, a pathological structure characterized by fibrosis appears. It is known that the hepatocellular carcinoma cells in the early stage develop into the classical hepatocellular carcinoma cells, and the feature of cells changes. When the size of carcinoma cells exceeds 2 cm, classical hepatocellular carcinoma cells appear in early-stage hepatocellular carcinoma.
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30) Vertical axis AAL % indicates the ratio of the protein amount of target molecule A contained in a bound fraction of AAL column chromatography for that in the serum before chromatographic treatment (100%). LCA % is also similarly defined. As a result, the amount of CPB2 present in an AAL-bound fraction (AE), the amount of pIgR in an LCA-bound fraction (LE), the amount of pIgR present in the AAL-bound fraction (AE), the amount of CSF1R present in the LCA-bound fraction (LE), the amount of CSF1R in the AAL-bound fraction (AE), etc. were significantly high in hepatocellular carcinoma patients. By quantitation or comparison of glycan alteration on these molecules (molecule complex), especifically for LCA- or AAL-bound glycans, the disease state of the liver, in particular, hepatocellular carcinoma, is expected to be predictable.
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
DESCRIPTION OF EMBODIMENTS
(40) 1. Current Situation of Chronic Hepatic Disease
(41) 1-1. Disease-State of Hepatic Disease
(42) When a person is infected with hepatitis B virus or hepatitis C virus, the person suffers an acute-stage inflammation, which proceeds into a chronic-stage inflammation over 5 to 15 years. Particularly, hepatitis C once enters the chronic-stage is rarely cured naturally, with the result that deterioration of the liver function proceeds and hepatic cirrhosis occurs. The disease-states from chronic hepatitis to hepatic cirrhosis are defined pathomorphologically based on fibrous change observed in the Glisson region of the liver and the liver lobules and classified into a mild phase (F1), a moderate phase (F2), a severe phase (F3) and a hepatic cirrhosis phase (F4). Progression of fibrosis is correlated with an increase of risk of developing hepatocarcinoma. The cancer incidence in F1 or F2 is 1% or less per year, whereas, the incidence increases to 3-4% per year in F3. In the hepatic cirrhosis (F4) diagnosed based on observation of a tissue image where the degree of fibrosis is more advanced, hepatocarcinoma occurs with a probability of about 7% per year. Therefore, to efficiently find hepatocarcinoma and treat it, it is important to screen patients particularly in F3 and F4 stages in a simple manner and follow them up as subjects to be placed under detailed examination.
(43) The medical benefit system for hepatitis B and hepatitis C patients in Japan is exclusively directed to patients of F1 to F3 degrees of fibrosis, determined based on histopathological diagnosis on a liver biopsy specimen. In contrast, patients diagnosed as F4 are classified into hepatic cirrhosis. Therefore, only a part of them are treated as aid recipients for interferon therapy by the medical benefit system for hepatitis B and hepatitis C patients; however satisfactory therapeutic results have not yet been obtained.
(44) 1-2. Evaluation of Fibrosis Suppression by Antiviral Therapy
(45) To chronic hepatitis C, a PEG-IFN+RBV therapy is applied, whereas single administration of interferon is applied to hepatic cirrhosis C compensation phase. On the other hand, hepatitis B (chronic hepatitis, hepatic cirrhosis) is primarily treated with a nucleic-acid analogue. Thus, it seems to be essential to use markers for evaluating inflammation and fibrosis. Particularly, a serum biomarker is expected to be clinically applied for a wide variety of diagnostic and evaluate purposes.
(46) 1-3. Hepatocarcinoma
(47) It has been considered that a microbiological factor such as infection with hepatitis B virus or hepatitis C virus and an environmental factor significantly and alternately work on the onset of hepatocarcinoma. In Japan, it is known that about nine out of ten hepatocarcinoma patients are previously infected with hepatitis B or C virus and hepatocarcinoma occurs in chronic hepatitis and hepatic cirrhosis patients. As a risk factor of developing hepatocarcinoma, other than the viruses, male, advanced age, heavy use of alcohol, tobacco, mycotoxin such as aflatoxin, etc., are pointed out (hepatoma medical care guideline, the International Medical Information Center foundation).
(48) 1-4. Early Diagnosis of Hepatocarcinoma
(49) In detection of hepatocarcinoma, measurement of a hepatoma marker such as AFP and PIVKA-II in the serum sample taken from a subject and diagnostic imaging primarily represented by ultrasonographic examination (echo check) are mostly used at present. As the check by diagnostic imaging, first, ultrasonographic examination or CT is used. If any abnormality is found in the first check, usually MRI and angiography are further carried out.
(50) 1-5. Capturing High Carcinogenic Risk Group in View of Hepatocarcinoma Prevention
(51) In Japan, about nine out of ten hepatocarcinoma patients are derived from patients with hepatitis due to infection with hepatitis B virus or hepatitis C virus. Therefore, it is possible to catch patients to be placed under detailed examination by using viral infection and deterioration of the liver function as an indicator.
(52) However, even for a hepatic cirrhosis patient (F4) who may have hepatocarcinoma with a probability of about 7% per year, taking expensive and highly invasive detailed examination repeatedly every three months for finding and treating early-stage cancer, is inevitably a large burden economically and physically. Needless to say, the same is true in a patient with F3 having a cancer incidence of 3-4% per year. Furthermore, in consideration that a successful virus treatment rate of hepatitis C with interferon is about five out of ten, a great many chronic hepatitis patients remain unsuccessfully treated with interferon. It is therefore necessary to inform exactly where the chronic hepatitis patients are positioned in the process leading to hepatic cirrhosis and hepatocarcinoma and clinically follow them up. In other words, in present treatment for a disease process from hepatitis to hepatocarcinoma, it is necessary to weigh a carcinogenic risk in hepatitis to hepatic cirrhosis patients by a simple test such as a blood test and apply a diagnostic treatment of hepatocarcinoma in accordance with the carcinogenic risk.
(53) The degree of fibrosis is clinicopathologically correlated with risks of developing into hepatic cirrhosis and hepatocarcinoma. Therefore, we consider that if a testing technique is developed for serologically and quantitatively measuring the progress of fibrosis, such a problem can be solved.
(54) 2. Acquisition of Novel Hepatic Disease-State-Indicating Glycan Marker Represented by a Novel Glycan Marker for Hepatocarcinoma
(55) 2-1. Novel Hepatic Disease-State-Indicating Glycan Marker Including a Glycanmarker for Hepatocarcinoma
(56) The glycan marker for hepatocarcinoma of the present invention is sometimes described as a glycan related tumor marker or a tumor-specific glycan marker. Either one refers to a hepatocarcinoma specific glycan structure of a glycoprotein. Glycoproteins having such glycans are included.
(57) The composition and structural diversity of a glycan on a protein secreted from a cell are controlled on the basis of expression balance of several hundreds of glycan related genes and varied depending upon the degree of cell differentiation and development of cancer. The glycoprotein whose glycan structure varies can be used as a disease-state-indicating marker including a tumor marker. Then, a glycan related tumor marker has been searched by using proteomics as a base. In a marker search pipeline based on proteomics, candidate molecules are identified by a large-scale analysis in Phase-1. In Phase-2, the candidate molecules are verified and narrowed by quantitative analysis. Further, in Phase-3, a validation test is carried out. A glycan related marker is similarly searched based on glycoproteomics basically through the above pipeline.
(58) Furthermore, the present invention includes a novel hepatic disease-state-indicating glycan marker. Of the aforementioned glycan markers for hepatocarcinoma, a glycanmarker showing a change, which characterizes onset of a disease caused by viral infection, chronic hepatitis, hepatic cirrhosis and hepatocarcinoma developed therefrom, is found as a candidate. Such a marker which can specifies a hepatic disease-state based on a glycan change with the progress of the disease-state of a viral hepatic disease refers to a hepatic disease-state-indicating glycan marker.
(59) The novel hepatic disease-state-indicating glycan marker of the present invention is pathognomonic to each disease-state of a viral hepatic disease, more specifically, hepatocarcinoma, hepatic cirrhosis, hepatic fibrosis (F3 and F4 markers) or chronic hepatitis, and effectively distinguishes individual diseases.
(60) Furthermore, the novel hepatic disease-state-indicating glycan marker of the present invention includes a hepatic disease-state-indicating glycan marker glycopeptide and a hepatic disease-state-indicating glycan marker glycoprotein. For example, a glycopeptide specifically identified in a specimen of a hepatocarcinoma patient or a hepatic-disease patient, or a cancer cell-line and a healthy volunteer's specimen by the lectin catch IGOT method, is determined as a candidate glycopeptide for a hepatocarcinoma marker or a hepatic disease-state-indicating glycan marker. This glycopeptide is validated by a glycopeptide comparative glycan analysis technique, represented by comparative glycoproteomics method for a stable isotope introduced glycopeptide, using 100 patient specimens (or patient specimens corresponding to individual stages of a disease (20 samples for each stage)) versus 100 healthy volunteer's specimens. In the validation, a glycopeptide whose efficacy is strongly suggested can be determined as the marker glycopeptide. Furthermore, a glycoprotein containing the sequence of a hepatic disease-state-indicating glycan marker candidate glycopeptide is validated by a comparative glycan analysis technique represented by an antibody overlay lectin microarray method. In the validation, the glycoprotein whose efficacy is strongly suggested can be determined as the marker glycoprotein.
(61) 2-2. Method for Acquiring Hepatic Disease-State-Indicating Glycanmarker
(62) 2-2-1. Large-Scale Identification of Glycoprotein
(63) Large-scale selective collection and concentration methods of glycopeptides to be used herein are roughly divided into (i) a method of using a probe having affinity for a glycan, (ii) a method for using a chemical reaction with a glycan (Zhang H. et al. Nat Biotechnol 21, 660-666 (2003)) and (iii) a method for introducing an affinity tag into a glycan. Any one of the methods can be used. Preferably, a method of using a probe can be used. Now, the method of using a probe will be more specifically described below.
(64) (1) Collection by probe: As the probe, a lectin and an anti-glycan antibody can be used. To describe more specifically, first, from the supernatant of a medium culturing a cell-line derived from hepatocarcinoma, a glycoprotein is collected with a probe lectin or an antibody probe. Then, from the serum of a healthy volunteer, a glycoprotein is collected with the probe lectin or the antibody probe; at the same time, glycoproteins are exhaustively collected by lectins except a probe lectin.
(65) (2) The probe lectin can be selected principally through statistical analysis of glycan profile by using the aforementioned lectin microarray. Alternatively, the probe lectin can be selected in consideration of an expression profile (results of real time quantitative PCR) of a glycan gene and literature information (information based on which the probe lectin to be used can be predicted such as acceleration of fucosylation with cancerous change). Basically, the probe lectin is selected through the statistical analysis of a profile and adequacy of the selected lectin is determined based on the binding specificity. When hepatocarcinoma is targeted, for example, a lectin (AAL) derived from Aleuria aurantia capable of detecting fucosylation and lectin (DSA) derived from Datura stramonium capable of detecting a hyperbranch of a glycan can be used.
(66) An antibody probe may be prepared after the structure of an antigen (glycan) is elucidated; but the structural determination is not a requisite condition. Thus, the antibody probe may be prepared without determining the structure of an antigen glycan (or a glycopeptide).
(67) (3) Lectins for use in exclusive collection vary depending upon the distribution of a glycan structure in a target specimen in narrowing biomarkers. For example, when the serum is used as a target, most of the glycans on the serum glycoprotein have been known to be sialylated bi-antennary glycans. Because of this, if treated with sialidase, it is considered that most of the serum glycoproteins (peptides) are exhaustively collected with lectins (RCA120) derived from Ricinus communis. Thus, RCA120 can be used. Note that a lectin recognizing sialic acid is not used. This is to avoid effect produced by elimination of sialic acid by man-made operation and deterioration of a specimen with the passage of time. When a target specimen is not the serum, for example, is other body fluid, other lectins can be selected. Furthermore, glycoproteins can be exhaustively collected by hydrophilic interaction chromatography and gel filtration in place of a lectin.
(68) 2-2-2. Identification of Glycopeptide or Glycoprotein
(69) The collected glycoproteins are analyzed, for example, by Lectin-IGOT-LC/MS method to identify the candidate glycopeptides as described in JP Patent Publication (Kokai) No. 2004-233303 A (JP Patent No. 4220257); and Kaji H, et al., Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site-specific stable isotope tagging, Nature Protocols 1, 3019-3027 (2006).
(70) (1) Glycan Excision and Stable Isotope Tagging of the Glycosylated Sites
(71) The glycopeptide subsets of specimens are recollected from the protease digests of the glycoproteins captured with a probe using the same probe; or directly collected using the probe from a protease digest (peptide mixture) of crude specimen without any protein separation. The obtained glycopeptides are treated with an enzyme such as glycopeptidase to remove glycans in water labeled with a stable isotope oxygen (18O). Owing to the treatment, asparagine at a glycosylated site is converted to aspartic acid. Then, isotopic oxygen atom (18O) of water is incorporated into the peptide. This method to label glycosylated site with stable isotope is called “isotope-coded glycosylation site-specific tagging (IGOT)”.
(72) (2) LC/MS Shotgun Analysis of Labeled Peptides
(73) The peptides labeled by IGOT method are separated by LC and introduced into MS to perform tandem mass spectrometry. In this manner, the sequences of the peptides are comprehensively identified.
(74) (3) Identification of Peptide
(75) Database search (MS/MS ion search method) can be made for the obtained MS/MS measurement results (spectra) of the peptide mixture, in which obtained MS/MS spectra are compared with those in the database; as described in the Standard Technology Collection (edited by Japan Patent Office), mass spectrometry, 3-6-2-2 amino acid sequence analysis. In the search, the following modifications of an amino acid are taken into consideration (oxidation of methionine residue side-chain, deamination or cyclization of amino-terminal glutamine, deamination of an amino terminal carbamidomethylcysteine, deamidation of asparagine residue side-chain (however, a stable isotope oxygen is incorporated therein)).
(76) (4) Identification of Glycosylated Site
(77) Among the peptides identified by the MS/MS ion search method, peptides having both deamidated asparagine residue(s) incorporating a stable isotope oxygen and consensus sequence(s) for N-glycosylation (Asn-Xaa-[Ser/Thr], but Xaa is not Pro) are employed as candidate glycopeptide (in the case where Xaa is Lys/Arg and an identified peptide sequence is cleaved at this site, if the next residue to Xaa can be confirmed to be [Ser/Thr], referring to the entire amino acid sequence of the protein, this peptide is included). Then the asparagine residue of the consensus sequence of the glycopeptide is defined as a glycosylated site. In the case there are multiple consensus sequences in a peptide and the number of deamidated (stable isotope lebeled) asparagine is less than that of consensus sequence, and the position of deamidated asparagine cannot be specified by the MS/MS spectrum, all sites (consensus sites) are described together and noted with the fact that they could not be distinguished.
(78) (5) Notation System of Glycopeptide
(79) The peptides listed in Table 1 of the claims and Table 1 below are based on the results identified by the IGOT-LC/MS method in consideration of the presence or absence of modification in the identification process by this method described in the above section (3). Accordingly, the marker glycopeptide is not only defined simply by an amino acid sequence but also defined in consideration of modification of a functional group actually contained in a peptide. The actual status of modifications is described by a digit sequence, as follows. (1) The amino acid sequence of a peptide moiety is described by an array of single-letter abbreviations of amino acids. (2) The position and type of modifications are expressed by a digit sequence.
(80) The initial position of a digit sequence represents the terminal amino group of a peptide and the end position thereof represents the terminal carboxyl group. The digits between them represent positions of individual side chain of each amino acid residue. Furthermore, numerical values represent types of modifications. “0” means not modified; “1” represents deamination or cyclization of an amino-terminal glutamine residue; “2” represents oxidation of a methionine residue side-chain; “3” represents deamination or cyclization of the amino-terminal carbamidomethylated cysteine residue and “4” represents deamidation of an asparagine residue (IGOT label), more specifically represents a glycosylated site. Note that the sequence list was prepared based on Table 1 below.
2-2-3. Further Selection of the Candidate Glycopeptides of Hepatic Disease-State-Indicating Glycan Markers
(81) The candidate glycopeptides of hepatic disease-state-indicating glycan markers are collected with a cancer probe (a lectin) from (i) a hepatoma-derived cell-line culture medium and (ii) the serum of hepatocellular carcinoma patient (taken before and after a surgery of the cancer) and identified by the large-scale glycopeptide identification methods described in the above sections 2-2-1 and 2-2-2. The identified glycopeptide can be defined as an initial candidate of the glycan marker.
(82) Next, glycopeptides collected from (iii) sera of healthy volunteers with the same probe lectin and with other lectin enabling comprehensive identification, are identified by the same procedure and used as a reference for selection of a marker candidate glycopeptide. More specifically, among candidate glycopeptides, the peptides identified from the healthy volunteer's serum using the cancer probe are ranked lower. On the contrary, the peptides identified with lectin for comprehensive identification are thought to be relatively abundant in the serum and thus evaluated as easily detectable candidates.
(83) Furthermore, glycopeptides identified from (iv) sera taken from hepatocellular carcinoma patients after surgery, using the probe lectin and other lectins in the same manner, are used as a reference to select marker candidates for distinct stage of the hepatic disease. To describe more specifically, the glycopeptide identified from the specimen before the surgery but not identified from the sera of a post-operative patients and healthy volunteers can be regarded as a marker implicating the presence of hepatocellular carcinoma; whereas, a glycopeptide identified from the patients' sera regardless before and after surgery but not identified from the healthy volunteers' sera can be regarded as a marker candidate for background underlying hepatocellular carcinoma (namely, hepatitis and fibrosis leading to hepatic cirrhosis). At this time, an approximate amount of glycoprotein in the serum and a change thereof can be estimated based on comparison of signal intensity of the labeled peptides in LC/MS analysis.
(84) The marker candidate glycopeptides thus selected can be used as candidate glycopeptides of hepatic disease-state-indicating glycan marker through verification tests. Furthermore, a glycoprotein containing the peptide sequence can be used as a glycan biomarker indicating hepatic disease-state through verification tests performed in the state of protein.
(85) 2-2-4. Candidate Glycopeptides for a Glycan Biomarker Indicating Hepatic Disease-State
(86) The candidate glycopeptides for a glycan biomarker indicating hepatic disease-state, which are selected by the aforementioned steps, are shown in Table 1 below.
(87) TABLE-US-00001 TABLE 1 Hepatic disease-state indicating marker glycopeptide Peptide sequence and modification information The initial position of a sequence of numbers represents the terminal amino group and the end position thereof represents the terminal carboxyl group. The numerals between them represent modification states of residue side-chains. “0“ means not modified: “1“ SEQ. represents deamidation or cyclization of an N-terminal Gln: “2“ represents oxidation of ID. Peptide a Met side-chain: “3“ represents deamidation or cyclization of an N-terminal No.: No. carbamidemethylated Cys: “4“ represents a glycosylation site (Asn label) 1 1 FNSSYLQGTNQITGR/00400000000000000 2 2 VSNVSCQASVSR/00040000000000 3 3 GTAGNALMDGASQLMGENR/000000000000000000400 4 4 HEEGHMLNCTCFGQGR/000000204000000000 5 5 RHEEGHMLNCTCFGQGR/0000000004000000000 6 6 VNFTEIQK/0040000000 7 7 LYLGSNNLTALHPALFQNLSK/00000004000000000040000 8 8 GLNVTLSSTGR/0004000000000 9 9 MDGASNVTCINSR/020000400000000 10 10 HEEGHMLNCTCFGQGR/000000004000000000 11 11 QVFPGLNYCTSGAYSNASSTDSASYYPLTGDTR/00000000000000004000000000000000000 12 12 DQCIVDDITYNVNDTFHK/00000000000004000000 13 13 GAFISNFSMTVDGK/0000004000000000 14 14 GAFISNFSMTVDGK/0000004002000000 15 15 GFGVAIVGNYTAALPTEAALR/00000000040000000000000 16 16 LGACNDTLQQLMEVFKFDTISEK/0000040000002000000000000 17 17 LKELPGVCNETMMALWEECKPCLK/00000000040000000000000000 18 18 QLVEIEKVVLHPNYSQVDIGLIK/0000000000000400000000000 19 19 TLFCNASKEWDNTTTECR/00000400000040000000 20 20 IIVPLNNRENISDPTSPLR/000000000040000000000 21 21 MEACMLNGTVIGPGK/00000204000000000 22 22 CGNCSLTTLKDEDFCK/000400000000000000 23 23 ITYSIVQTNCSKENFLFLTPDCK/0000000004000000000000000 24 24 AVLVNNITTGER/00000040000000 25 25 AREDIFMETLKDIVEYYNDSNGSHVL0GR/0000000200000000000004000000000 26 26 FQSPAGTEALFELHNISVADSANYSCVYVDLKPPFGGSAPSER/0000000000000004000000040000000000000000000 27 27 QNQCFYNSSYLNVQR/10000004000000000 28 28 SLEAINGSGLQMGLQR/000000400000200000 29 29 AHLNVSGIPCSVLLADVEDLIQQQISNDTVSPR/00004000000000000000000000040000000 30 30 FTKVNFTEIQK/0000040000000 31 31 RHEEGHMLNCTCFGQGR/0000000204000000000 32 32 DIVEYYNDSNGSHVLQGR/00000004004000000000 33 33 TLYETEVFSTDFSNISAAK/000000000000004000000 34 34 QDQCIYNTTYLNVQR/10000004000000000 35 35 QDQCIYNTTYLNVQRENGTISR/100000040000000004000000 36 36 FLNDTMAVYEAK/00040020000000 37 37 TLNQSSDELQLSMGNAMFVK/0004000000000200020000 38 38 FEVDSPVYNATWSASLK/0000000004000000000 39 39 SPYYNVSDEISFHCYDGYTLR/00000400000000000000000 40 40 LGACNDTLQQLMEVFKFDTISEK/0000040000000000000000000 41 41 YTGNASALFILPDQDKMEEVEAMLLPETLKR/000040000000000000000000000000000 42 42 VLTLNLDQVDFQHAGNYSCVASNVQGK/00000000000000004000000000000 43 43 ELPGVCNETMMALWEECKPCLK/000000040002000000000000 44 44 TLNQSSDELQLSMGNAMFVK/0004000000000000020000 45 45 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK/00000000000040000000000000000000000 46 46 YTGNASALFILPDQDKMEEVEAMLLPETLKR/000040000000000002000000000000000 47 47 NISDGFDGIPDNVDAALALPAHSYSGR/04000000000000000000000000000 48 48 HGIQYFNNNTQHSSLFMLNEVKR/0000000040000000020000000 49 49 SHEIWTHSCPQSPGNGTDASH/00000000000000040000000 50 50 NPPMGGNVVIFDTVITNQEEPYQNHSGR/000020000000000000000000400000 51 51 QIGLYPVLVIDSSGYVNPNYTGR/0000000000000000000400000 52 52 TLNQSSDELQLSMGNAMFVK/0004000000000200000000 53 53 LSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNR/00000000000004000000000000000000000400 54 54 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK/0000000000004000000000000000000000 55 55 GLKFNLTETSEAEIHQSFQHLLR/0000040000000000000000000 56 56 SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK/00000040000000000000000000000000000 57 57 DIVEYYNDSNGSHVLQGR/00000004000000000000 58 58 EHEAQSNASLDVFLGHTNVEELMK/00000004000000000000000000 59 59 DVQIIVFPEDGIHGFNFTR/000000000000000040000 60 60 WNNTGCQALPSQDEGPSK/00400000000000000000 61 61 MEACMLNGTVIGPGK/02000204000000000 62 62 HGIQYFNNNTQHSSLFMLNEVK/000000004000000000000000 63 63 SVQEIQATFFYFTPNKTEDTIFLR/00000000000000040000000000 64 64 DLQSLEDILHQVENK/00000000000000400 65 65 FLNDSIVDPVDSEWFGFYR/000400000000000000000 66 66 FLSSSPHLPPSSYFNASGR/000000000000000400000 67 67 GGNSNGALCHFPFLYNNHNYTDCTSEGR/000000000000000000040000000000 68 68 GLLHLENASYGIEPLQNSSHFEHIIYR/00000004000000000400000000000 69 69 NELVQLYQVGEVRPFYYGLCTPCQAPTNYSR/000000000000000000000000000040000 70 70 NMTFDLPSDATVVLNR/040000000000000400 71 71 NMTFDLPSDATVVLNR/042000000000000400 72 72 TNINSSRDPDNIAAWYLR/00004000000000000000 73 73 TNSTFVQALVEHVK/0040000000000000 74 74 VAAANVSVTQPESTGDPNNMILLAEEAR/000004000000000000040000000000 75 75 VAAANVSVTQPESTGDPNNMTLLAEEARK/0000040000000000000400000000000 76 76 VAQPGINYALGINVSYPNNUR/000000000000040000000000 77 77 VLNASTLALALANLNGSR/00040000000000040000 78 78 QNQCFYNSSYLNVQRENGTVSR/000000040000000004000000 79 79 EHEGAIYPDNUDFQRADDK/0000000000400000000000 80 80 ENGTDTVQEEEESPAEGSK/004000000000000000000 81 81 GENFTETDVK/000400000000 82 82 GIGNYSCSYR/000040000000 83 83 GNETIVNLIHSTR/004000000000000 84 84 ILLTCSLNDSATEVTGHR/00000000400000000000 85 85 LDVDQALNRSHEIWTHSCPQSPGNGTDASH/00000000400000000000000040000000 86 86 NCQDIDECVTGIHNCSINETCFNIQGGFR/0000000000000040004000000000000 87 87 NRTPMGHMK/04000200000 88 88 QYNSTGDYR/00040000000 89 89 SHTNTSHVMQYGNK/0000400002000400 90 90 SLSCQMAALQGNGSER/000000000000400000 91 91 SLSCQMAALQGNGSER/000000200000400000 92 92 TYNGTNPDAASR/00040000000000 93 93 VAAANVSVTQPESTGDPNNMTLLAEEAR/000004000000000000042000000000 94 94 VCEIHEDNSTR/0000000040000 95 95 VVDDVSNQTSCR/00000004000000 96 96 HTGNVVITNCSAAHSR/000000000400000000 97 97 INLAGDVAALNSGLATEAFSAYGNK/000000000000000000000000400 98 98 QQQHLFGSNVTDCSGNFCLFR/10000000040000000000000 99 99 QVFPGLNYCTSGAYSNASSTDSASYYPLTGDTR/10000000000000004000000000000000000 100 100 SAEFFNYTVR/000000400000 101 101 SDLNPANGSYPFKALR/000000040000000000 102 102 TVSCQVQNGSETVVQR/000000004000000000 103 103 VISVDELNDTIAANLSDTEFYGAK/00000000400000400000000000 104 104 VYSLPGRENYSSVDANGIQSQMLSR/000000000400000000000020000 105 105 YRGTAGNALMDGASQLMGENR/00000000000000000200400 106 106 YSSNHTEHSQNLR/000040000000000 107 107 YYNYTLSINGK/0004000000000 108 108 SLTFNETYQDISELVYGAK/000004000000000000000 109 109 AFENVIDLQWLILDHNLLENSK/000040000000000000000000 110 110 CRNLSGQTDK/000400000000 111 111 DFTLNETVNSIFAQGAPR/00000400000000000000 112 112 DNYTDLVAIQNK/00400000000000 113 113 ELHHLQEQNVSNAFLDKGEFYIGSKYK/00000000040000000000000000000 114 114 EPGSNVTMSVDAECVPMVR/000004000000000000000 115 115 FLNDVKTLYETEVFSTDFSNISAAK/000000000000000000004000000 116 116 FSLLGHASISCTVENETIGVWRPSPPTCEK/00000000000000040000000000000000 117 117 GNEANYYSNATTDEHGLVQFSINTINVMGTSLTVR/0000000004000000000000040000200000000 118 118 GNESALWDCKHDGWGK/004000000000000000 119 119 GNETLHYETFGK/00400000000000 120 120 HLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQNK/0000200000000000000000002000000000000400 121 121 HNNDTQHIWESQSNEFSVIADPR/0004000000000000000000000 122 122 HYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTR/0000000000000000000000000400000000000000000 123 123 IDGSGNFQVLLSDRYFNK/00000000000000000400 124 124 ISNSSDTVECECSENWK/0004000000000000000 125 125 KAENSSNEEETSSEGNMR/00004000000000000000 126 126 KTTCNPCPLGYKEENNTGECCGR/0000000000000004000000000 127 127 LDAPTNLQFVNETDSTVLVR/0000000000040000000000 128 128 LEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTR/0000000000200000000000040000000000000 129 129 LNAENNATFYFKIDNVK/0000004000000000000 130 130 LQQDVLQFQKNQTNLER/0000000000040000000 131 131 LSHNELADSGIPGNSFNVSSLVELDLSYNK/00000000000000000400000000000000 132 132 LSNISHLNYCEPDLR/00040000000000000 133 133 LTDTICGVGNMSANASDQER/0000000000400040000000 134 134 REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR/000000000000000000000000000040000000 135 135 SGPKNMTFDLPSDATVVLNR/0000040000000000000400 136 136 TYNVLDMKNTTCQDLQIEVTVK/000000020400000000000000 137 137 VASVININPNTTHSTGSCR/000000000040000000000 138 138 VTVQSLLTVETLEHNQTYECR/00000000000000040000000 139 139 WVNYSCLDQAR/0004000000000 140 140 YKVDYESQSTDTQNFSSESKR/00000000000000400000000 141 141 GCVLLSYLNETVTVSASLESVR/000000000400000000000000 142 142 ALVLEQLTPALHSTNFSCVLVDPEQVVQR/0000000000000004000000000000000 143 143 WFYIASAFRNEEYNK/00000000000000400 144 144 SEGTNSTLTLSPVSFENEHSYLCTVTCGHK/00000400000000000000000000000000 145 145 QNQCFYNSSYLNVQRENGTVSR/100000040000000004000000 146 146 VDLEDFENNTAYAK/0000000040000000 147 147 IGEADFNRSKEFMEEVIQR/000000040000000000000 148 148 SHAASDAPENLTLLAETADAR/00000000004000000000000 149 149 DFYVDENTTVR/0000000400000 150 150 VQNVTEFDDSLLR/000400000000000 151 151 HGVIISSTVDTYENGSSVEYR/00000000000000400000000 152 152 YTGNASALFILPDQDKMEEVEAMLLPETLKR/000040000000000000000002000000000 153 153 AFGQFFSPGEVIYNKTDR/00000000000000400000 154 154 EAPYFYNDTVTFK/000000040000000 155 155 EHEAQSNASLDVFLGHTNVEELMK/00000004000000000000000200 156 156 ELDREVYPWYNLTVEAK/0000000000040000000 157 157 LGSYPVGGNVSFECEDGFILR/00000000040000000000000 158 158-LR GCVLLSYLNETVTVSASLESVRGNR/000000000400000000000000400 159 159-LR VYKPSAGNNSLYR/000000004000000 160 160-LR NUGHGNSTHHGPEYMR/0400000400000000200 161 161-LR NGTGHGNSTHHGPEYMR/0400000400000000000 162 162-LR AAIPSALDTNSSK/000000000040000 163 163-LR LGNWSAMPSCK/0004000200000 164 164-LR VVGVPYQGNATALFILPSEGK/00000000040000000000000 165 165-LR GLNLTEDTYKPR/00040000000000 166 166-LR SIPACVPWSPYLFQPNUCIVSGWGR/0000000000000000400000000000 167 167-LR YNSQNQSNNQFVLYR/00000400000000000 168 168-LR KLPPGLLANFTLLR/0000000004000000 169 169-LR LGNWSAMPSCK/0004000000000 170 170-LR LHINHNNLTESVGPLPK/0000000400000000000 171 171-LR GICNSSDVR/00004000000 172 172-LR HERDAGVVCTNETR/0000000000040000 173 173-LR ASPPSSSCNISSGEMQK/0000000004000000000 174 174-LR KEDALNETRESETK/0000004000000000 175 175-LR ESKPLTAQQTTKLDAPTNLQFVNETDSTVLVR/0000000000000000000000040000000000 176 176-LR EIRHNSTGCLR/0000040000000 177 177-LR MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR/000400000000000000000004000000000000 178 178-LR NFTENDLLVR/040000000000 179 179-LR NLASRPYTFHSHGITYYKEHEGAIYPDNITDFQR/000000000000000000000000000040000000 180 180-LR YPPTVSMVEGQGEKNVTFWGRPLPR/000000000000000400000000000 181 181-LR FCRDNYTDLVAIQNK/00000400000000000 182 182-LR INATDADEPNTLNSK/00400000000000000 183 183-LR TVVTYHIPQNSSLENVDSR/000000000040000000000
Moreover, glycoproteins containing the marker candidate glycopeptides selected in the aforementioned steps are shown in Table 2 below (with the proviso that Protein No. 97 and 98 (AGP) and 65 (M2BP) listed in Table 2 below are eliminated).
(88) TABLE-US-00002 TABLE 2 Protein No. Marker protein 1 ADAM metallopeptidase domain 9 isoform 1 precursor 2 ADAM metallopeptidase domain 9 isoform 2 precursor 3 ADAM metallopeptidase with thrombospondin type 1 motif, 13 isoform 1 preproprotein 4 ADAM metallopeptidase with thrombospondin type 1 motif, 13 isoform 2 preproprotein 5 ADAM metallopeptidase with thrombospondin type 1 motif, 13 isoform 3 preproprotein 6 ADAM metallopeptidase with thrombospondin type 1 motif, 9 preproprotein 7 ADAMTS-like 2 8 alpha 1B-glycoprotein 9 alpha-2-glycoprotein 1, zinc 10 alpha-2-macroglobulin precursor 11 alpha-2-macroglobulin-like 1 12 alpha-fetoprotein precursor 13 apolipoprotein B precursor 14 asialoglycoprotein receptor 1 15 attractin isoform 1 16 attractin isoform 2 17 basigin isoform 1 18 basigin isoform 2 19 biotinidase precursor 20 cadherin 5, type 2 preproprotein 21 carboxypeptidase E precursor 22 carboxypeptidase N, polypeptide 2, 83 kD 23 cat eye syndrome critical region protein 1 isoform a precursor 24 CD163 antigen isoform a 25 CD163 antigen isoform b 26 ceruloplasmin precursor 27 clusterin isoform 1 28 clusterin isoform 2 29 coagulation factor C homolog, cochlin precursor 30 coagulation factor V precursor 31 coagulation factor XIII B subunit precursor 32 colony stimulating factor 1 receptor precursor 33 complement component (3d/Epstein Barr virus) receptor 2 isoform 1 34 complement component (3d/Epstein Barr virus) receptor 2 isoform 2 35 complement component 1, q subcomponent, A chain precursor 36 complement component 1, r subcomponent 37 complement component 2 precursor 38 complement component 4 binding protein, alpha chain precursor 39 complement component 4 binding protein, beta chain isoform 1 precursor 40 complement component 4 binding protein, beta chain isoform 1 precursor 41 complement component 4 binding protein, beta chain isoform 1 precursor 42 complement component 4 binding protein, beta chain isoform 2 precursor 43 complement component 4 binding protein, beta chain isoform 2 precursor 44 complement component 4A preproprotein 45 complement component 4B preproprotein 46 complement factor B preproprotein 47 complement factor H isoform a precursor 48 cytokine receptor-like factor 1 49 dopamine beta-hydroxylase precursor 50 EMI domain containing 2 51 fibrinogen, beta chain preproprotein 52 fibrinogen, gamma chain isoform gamma-A precursor 53 fibrinogen, gamma chain isoform gamma-B precursor 54 fibronectin 1 isoform 1 preproprotein 55 fibronectin 1 isoform 2 preproprotein 56 fibronectin 1 isoform 3 preproprotein 57 fibronectin 1 isoform 4 preproprotein 58 fibronectin 1 isoform 5 preproprotein 59 fibronectin 1 isoform 6 preproprotein 60 fibronectin 1 isoform 7 preproprotein 61 fibulin 1 isoform A precursor 62 fibulin 1 isoform B precursor 63 fibulin 1 isoform C precursor 64 fibulin 1 isoform D 65 galectin 3 binding protein 66 glucosamine (N-acetyl)-6-sulfatase precursor 67 golgi phosphoprotein 2 68 golgi phosphoprotein 2 69 haptoglobin 70 hypothetical protein LOC196463 71 immunoglobulin J chain 72 immunoglobulin superfamily, member 1 isoform 1 73 insulin-like growth factor binding protein 3 isoform a precursor 74 insulin-like growth factor binding protein 3 isoform b precursor 75 inter-alpha (globulin) inhibitor H4 76 inter-aloha globulin inhibitor H2 polypeptide 77 intercellular adhesion molecule 2 precursor 78 interleukin 18 binding protein precursor 79 interleukin 18 binding protein precursor 80 interleukin 18 binding protein precursor 81 kininogen 1 82 laminin, gamma 1 precursor 83 legumain preproprotein 84 legumain preproprotein 85 lumican precursor 86 lunatic fringe isoform a 87 lunatic fringe isoform b 88 lysosomal-associated membrane protein 1 89 lysosomal-associated membrane protein 2 precursor 90 lysosomal-associated membrane protein 2 precursor 91 mannan-binding lectin serine protease 1 isoform 2 precursor 92 mannosidase, alpha, class 2B, member 2 93 MHC class I chain-related gene A protein 94 microfibrillar-associated protein 4 95 neuronal cell adhesion molecule isoform A precursor 96 neuronal cell adhesion molecule isoform B precursor 97 orosomucoid 1 precursor 98 orosomucoid 2 99 oxygen regulated protein precursor 100 palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile) 101 peptidoglycan recognition protein 2 precursor 102 phospholipid transfer protein isoform a precursor 103 plasma carboxypeptidase B2 isoform a preproprotein 104 plasma carboxypeptidase B2 isoform b 105 polymeric immunoglobulin receptor 106 PREDICTED: similar to ADAMTS-like 2 107 PREDICTED: similar to Carboxypeptidase N subunit 2 precursor (Carboxypeptidase N polypeptide 2) 108 PREDICTED: similar to HEG homolog 1 109 PREDICTED: similar to HEG homolog 1 110 PREDICTED: similar to Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial) (High molecular weight salivary mucin MG1) (Sublingual gland mucin) 111 PREDICTED: similar to Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial) (High molecular weight salivary mucin MG1) (Sublingual gland mucin) (4390) 112 prion protein preproprotein 113 prion protein preproprotein 114 prion protein preproprotein 115 prion protein preproprotein 116 prion protein preproprotein 117 procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 precursor 118 prosaposin isoform a preproprotein 119 prosaposin isoform b preproprotein 120 prosaposin isoform c preproprotein 121 selectin L precursor 122 selenoprotein P isoform 1 precursor 123 selenoprotein P isoform 1 precursor 124 selenoprotein P isoform 2 125 serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4 126 serine (or cysteine) proteinase inhibitor, clade A, member 7 127 serine (or cysteine) proteinase inhibitor, clade C (antithrombin), member 1 128 serpin peptidase inhibitor, clade A, member 3 precursor 129 sex hormone-binding globulin 130 SPARC-like 1 131 TP53-target gene 5 protein 132 transferrin 133 transmembrane 4 superfamily member 6 134 transmembrane 4 superfamily member 8 isoform 1 135 transmembrane 4 superfamily member 8 isoform 2 136 tripeptidyl-peptidase I preproprotein 137 tumor rejection antigen (gp96) 1 138 UDP-GlcNAc: betaGal beta-1,3-N-acetylglucosaminyltransferase 1 139 UDP-GlcNAc: betaGal beta-1,3-N-acetylglucosaminyltransferase 2 140 vascular cell adhesion molecule 1 isoform a precursor 141 vitronectin precursor 142 von Willebrand factor preproprotein 143-LR apolipoprotein H precursor 144-LR coagulation factor II precursor 145-LR complement factor I 146-LR complement factor properdin 147-LR desmoglein 2 preproprotein 148-LR hemopexin 149-LR inducible T-cell co-stimulator ligand 150-LR leucine-rich alpha-2-glycoprotein 1 151-LR serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 5
2-2-5. Verification of the Candidate Glycopeptides of Glycan Biomarker Indicating Hepatic Disease-State
(89) For example, various novel glycopeptides described in the above section “2-2-4. Candidate glycopeptides of glycan biomarker indicating hepatic disease-state” are subjected to multiple verification tests described below, to select and verify marker candidate glycopeptides for individual hepatic disease-states. More specifically, examples of the verification tests include i) Comparison of signal intensity of IGOT-labeled peptides in LC/MS analyses for glycopeptides of the hepatocellular carcinoma patients' sera taken before and after surgery, and for the sera of healthy volunteers, which peptides are obtained with a probe lectin; ii) Comparative quantitative proteomics using stable isotope(s) which methods are known in the art, for glycoproteins of the hepatocellular carcinoma patients' sera taken before and after surgery, and for the sera of healthy volunteers, which proteins are obtained with a probe lectin, iii) Quantitative detection using an antibody for each candidate glycoproteins (glycoproteins containing the sequence of glycopeptides described in the above section 2-2-4), which proteins are collected from the hepatocellular carcinoma patients' sera before and after surgery, and the sera of healthy volunteers with a probe lectin; and iv) Comparative glycan profiling by the an antibody overlay lectin microarray method etc. for glycoproteins (glycoproteins containing the sequences of glycopeptides described in the above section 2-2-4) obtained from the sera of (viral) hepatitis patients, hepatic cirrhosis patients and hepatocellular carcinoma patients.
(90) The aforementioned verification tests will be more specifically described as follows.
(91) Re: i) Comparison of signal intensity of IGOT-labeled peptides in LC/MS analyses for glycopeptides of the hepatocellular carcinoma patients' sera taken before and after surgery, and for the sera of healthy volunteers, which peptides are obtained with a probe lectin: The aforementioned specimen (the serum) proteins are separately subjected to S-reduction and alkylation and then digested with trypsin. The resultant peptide mixture is subjected to affinity-chromatography using a probe lectin to collect glycopeptides. These are labeled in accordance with the aforementioned IGOT method. The total amounts thereof are approximately equalized and the glycopeptides are individually subjected to LC/MS analysis. With reference to the mass to charge ratio and elution position of the glycopeptide identified, the spectra of the labeled peptides are obtained. The signal intensities of them are compared. The peptides remarkably present only before surgery and the peptides remarkably present before and after surgery can be selected.
(92) Re: ii) Comparative quantitative proteomics using stable isotope(s) which methods are known in the art, for glycoproteins of the hepatocellular carcinoma patients' sera taken before and after surgery, and for the serum of healthy volunteers, which proteins are obtained with a probe lectin: Glycoproteins collected from the serum specimens with a probe lectin are subjected to S-reduction and alkylation and then digested with trypsin. The resultant peptides are differentially labeled with stable isotopes (guanidination reaction of a Lys side-chain amino group using methylisourea double-labeled with 13C/15N) and then subjected to LC/MS analysis. The spectra of the peptides identified are analyzed and the signal intensities are compared. In this way, change between specimens can be quantitatively estimated. From the quantitative alteration of proteins having cancerous glycans, significance of marker candidates can be verified for each disease-state and then selected candidates for further tests.
(93) Re: iii) Quantitative detection using an antibody for each candidate glycoproteins (glycoproteins containing the sequence of glycopeptides described in the above section 2-2-4), which proteins are collected from the hepatocellular carcinoma patients' sera before and after surgery, and the sera of healthy volunteers with a probe lectin: Glycoproteins collected from the serum specimens with a probe lectin are subjected to, for example, SDS-PAGE, transferred to a membrane and immunologically detected by western blot. The signal intensities of the obtained bands are compared quantitatively to estimate change between the specimens. From the quantitative change of proteins having a cancerous glycans, significance of marker candidates can be verified for each disease-state and then selected candidates for further tests. The antibodies listed in Table 3 can be used for the immunological detection.
(94) Re: iv) Comparative glycan profiling by the an antibody overlay lectin microarray method etc. for glycoproteins (glycoproteins containing the sequences of glycopeptides described in the above section 2-2-4) obtained from the sera of (viral) hepatitis patients, hepatic cirrhosis patients and hepatocellular carcinoma patients. Blood samples are collected from (viral) hepatitis patients, chronic hepatitis patients, hepatic cirrhosis patients and hepatocellular carcinoma patients. From each collected blood sample, candidate glycoproteins of glycan biomarker indicating a hepatic disease-state are enriched and purified by immunoprecipitation method using an antibody and subjected to an antibody-overlay lectin array analyses to select candidates of the glycan biomarker (
(95) TABLE-US-00003 TABLE 3 Name of candidate protein Antibody (vender, catalog No.) alpha-1-B glycoprotein (A1BG) mouse monoclonal, clone 54B12 (AbFrontier, LFMA0185) rabbit polyclonal (GenWay Biotech, 18-003-42440) alpha-2-glycoprotein 1, zinc-binding rabbit polyclonal (Biovendor Lab. Med., (AZGP1) RD181093100) carboxypeptidase B2 (CPB2) mouse monoclonal, clone 13H4 (Genetex, GTX14757) carboxypeptidase N, polypeptide 2 mouse monoclonal, clone 36A1 (AbFrontier, (CPN2) LFMA0203) complement factor H (CFH) rabbit polyclonal (Santa Cruz Biotech., sc-33156) mouse monoclonal, clone OX-24 (Affinity Bioreagents, MA1-70057) complement factor I (CFI) sheep polyclonal (The Binding Site, PC031) Alpha-1-antitrypsin mouse monoclonal, clone 202808 (R&D Systems, MAB1268) mouse monoclonal, clone B9 (Abcam, ab9399) goat polyclonal (Abcam, ab7634) Alpha-2-antiplasmin mouse monoclonal, clone 236122 (R&D Systems, MAB1470) rabbit polyclonal (AssayPro, 13081-05025) Alpha-2-HS-glycoprotein (Fetuin A) mouse monoclonal, clone 112922 (R&D Systems, MAB1184) rabbit polyclonal (AssayPro, 12031-05025) Alpha-2-macroglobulin mouse monoclonal, clone 3D1 (AbFrontier, LFMA0139) mouse monoclonal, clone 9A3 (AbFrontier, LFMA0138) goat polyclonal (Abcam, ab7338) Apolipoprotein C-III mouse monoclonal, clone 68/7 (Chemicon (Millipore), MAB002687) goat polyclonal (GeneTex, GTX41024) Ceruloplasmin mouse monoclonal, clone 3B11 (Santa Cruz Biotech, sc-69767) rabbit polyclonal (Abcam, ab48650) Clusterin (Apo-J) mouse monoclonal, clone 78E (Santa Cruz Biotech, sc-32264) goat polyclonal (Chemicon (Millipore), AB825) Complement C1s subcomponent mouse monoclonal, clone M241 (Santa Cruz Biotech, sc-52627) sheep polyclonal (R&D Systems, BAF2060) Complement C3 mouse monoclonal, clone B-9 (Santa Cruz Biotech, sc-28294) rabbit polyclonal (Abcam, ab48342) Complement C4 mouse monoclonal, clone HYB162-02 (Antibodyshop A/S, HYB162-02-02) rabbit polyclonal (AssayPro, 11231-05025) Complement factor B mouse monoclonal, clone M20/6 (Santa Cruz Biotech, sc-47680) mouse monoclonal, clone M13/12 (Santa Cruz Biotech, sc-47682) goat polyclonal (R&D Systems, BAF2739) Hemopexin mouse monoclonal, clone ABS 013-32 (Santa Cruz Biotech, sc-59556) rabbit polyclonal (AssayPro, 12131-05025) Kininogen mouse monoclonal, clone 207025 (R&D Systems, MAB1569) goat polyclonal (R&D Systems, BAF1396) Prothrombin mouse monoclonal, clone 200710 (R&D Systems, MAB1473) rabbit polyclonal (AssayPro, 11581-05025) Serotransferrin mouse monoclonal, clone HTF-14 (Sanbio BV, MON5016) rabbit polyclonal (Rockland, 209-4634) Transthyretin (Prealbumin) mouse monoclonal, clone 10E1 (Santa Cruz Biotech, sc-69794) rabbit polyclonal (Abcam, ab48323) apolipoprotein B mouse monoclonal, clone C1.4 (Santa Cruz Biotech, SC13538) goat polyclonal (Rockland, 600-101-111) attractin mouse monoclonal, clone 9H8 (Lab Frontier, LFMA0146) goat polyclonal (Santa Cruz Biotech, SC9327) CD163 mouse monoclonal, clone RM3/1 (Hycult Biotechnology, HM2157) rabbit polyclonal (Santa Cruz Biotech, SC33559) coagulation factor V mouse monoclonal, clone 6A5 (Santa Cruz Biotech, SC13512) sheep polyclonal (Affinity BioReagents, PA1-43041) complement component 4 binding rabbit polyclonal (Aviva Systems Biology, protein, beta ARP33814_P050) complement factor properdin mouse monoclonal, clone 3B10 (AntibodyShop, HYB039-06-02) rabbit polyclonal (Santa Cruz Biotech, SC68366) golgi membrane protein 1 mouse monoclonal, clone 5B10 (Abnova, H00051280-M06) rabbit polyclonal (Imgenex, IMG-5280A) leucine-rich alpha-2-glycoprotein 1 mouse monoclonal, clone 2E3 (Abnova, H00116844-M01) lysosomal-associated membrane mouse monoclonal, clone H5G11 (Santa Cruz protein 1 Biotech, SC18821) rabbit polyclonal (Santa Cruz Biotech, SC5570) lysosomal-associated membrane mouse monoclonal, clone H4B4 (Santa Cruz protein 2 Biotech, SC18822) rabbit polyclonal (Santa Cruz Biotech, SC5571) UDP-GlcNAc: betaGal beta-1,3-N- goat polyclonal (Everest Biotech, EB08038) acetylglucosaminyltransferase 2 ADAMTS-like 2 Rabbit polyclonal (Sigma, A6352) Apolipoprotein D Mouse monoclonal clone 36C6 (abnova, ab49447) Butyrylcholinesterase Mouse polyclonal (abnova, H00000590-A01) Rabbit polyclonal (AVIVA systems biology, ARP44208_T100 Colony stimulating factor 1 receptor Biotinilated Goat polyclonal (R&D, BAF329) Mouse monoclonal (abnova, clone 1G4) Complement component Rabbit monoclonal clone EP3093 (abcam, (3d/Epstein Barr virus) receptor 2 ab75985) Rabbit monoclonal clone EP3093 (EPITOMICS, 2546-1) Dopamine beta-hydroxylase Sheep polyclonal (R&D, PPS067) Rabbit polyclonal (Thermo scientific, PA1-4655) Fibronectin 1 Rabbit polyclonal (Santa cruz biotechnology, inc., sc-9068) Goat polyclonal (Santa cruz biotechnology, inc., sc-6952) Inducible T-cell co-stimulator ligand Biotinilated rat monoclonal (abcam, ab21240) Biotinilated goat poly (R&D, BAF165) Insulin-like growth factor binding Biotinilated goat polyclonal (R&D, BAF675) protein 3 Intercellular adhesion molecule 2 Goat polyclonal (R&D, AF244) Mannan-binding lectin serine Rabbit polyclonal (Santa cruz biotechnology, inc., protease 1 (MASP3) (Same sc-48749) Goat polyclonal (R&D, BAF1724) sequence as MASP1 from 1 through 435) Polymeric immunoglobulin receptor Biotinilated Goat polyclonal (R&D, BAF2717) Mouse monoclonal clone GA-1 (Sigma, I6635) Mucin-5B (Mucin 5 subtype B, Rabbit polyclonal (Sigma, HPA008246) tracheobronchial) (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Prostaglandin H2 D-isomerase Mouse polyclonal (abnova, H00005730-B01) Selenoprotein P Mouse monoclonal (abnova, MAB0761) Serine (or cysteine) proteinase Mouse monoclonal (Lifespan, LS-C18098) inhibitor, clade A, member 7 Rabbit polyclonal (Sigma, HPA002803) Serine (or cysteine) proteinase Mouse monoclonal clone BDI205 (abcam, inhibitor, clade C (antithrombin), ab20933) Biotinilated goat polyclonal (R&D, member 1 BAF1267) Sex hormone-binding globulin Biotinilated goat polyclonal (R&D, BAF2656) SPARC-like 1 Biotinilated goat polyclonal (R&D, BAF2728) Tumor rejection antigen 1 Rabbit polyclonal (Proteintech group, inc., 10979-1-AP) Mouse monoclonal clone 2H3 (Novus, NBP1-04346) ADAM metallopeptidase domain9 Biotinilated Goat polyclonal (R&D, BAF939) prosaposin Mouse polyclonal (Abnova, H00005660-A01) UDP-GlcNAc: betaGal beta-1,3-N- Mouse monoclonal clone 1A8 (Abnova, acetylglucosaminyltransferase1 H00010678-M05) cytokine receptor-like factor 1 Mouse monoclonal clone 4F4 (Abnova, H00009244-M01) tripeptidyl-peptidase biotinilated Goat polyclonal (R&D, BAF2237) palmitoyl-protein thioesterase 1 rabbit polyclonal (Proteintech Group Inc. 10887-1-AP) basigin Biotinilated Goat polyclonal (R&D, BAF972) oxygen regulated protein Goat polyclonal (R&D, AF5558) MHC class 1 chain-related gene A Biotinilated goat polyclonal (R&D, BAF1300) protein prion protein Mouse monoclonal (Sigma, P0110) legumain Biotinilated Goat polyclonal (R&D, BAF2199) asialoglycoprotein receptor 1 Rabbit polyclonal (Lifespan, C30704-100) carboxypeptidase E Goat polyclonal (R&D, AF3587) procollagen-lysine, 2-oxoglutarate rabbit polyclonal (Proteintech Group 5-dioxygenase 3 Inc. 11027-1-AP) glucosamine (N-acetyl)-6-sulfatase Goat polyclonal (R&D, AF2484) EMI domain containing 2 Rabbit polyclonal (Lifespan, C82705-50) mannosidase, alpha, class 2B, rabbit polyclonal (Proteintech Group member 2 Inc. 17697-1-AP) Glycosyl phosphatidyl Mouse monoclonal clone 38A1(GenWay bio, inositol-specific phospholipase D 20-007-280085)
(96) As described above, the glycan structures of glycopeptides or glycoproteins are comprehensively analyzed to check whether the glycan structures change or not between a (viral) hepatitis patient, chronic hepatitis patients, hepatic cirrhosis patients and hepatocellular carcinoma patients. A glycopeptide or glycoprotein, whose glycan structure changes, can be used as a glycan biomarker indicating the hepatic disease-state.
(97) 3. Detection of a Marker Glycopeptide Indicating Hepatic Disease-State and a Marker Glycoprotein Indicating Hepatic Disease-State
(98) 3-1. Mass Spectrometry
(99) A marker glycopeptide or glycoprotein indicating hepatic disease-state can be detected with a mass spectrometer as a detector for a specimen obtained with a probe lectin etc.
(100) A marker glycopeptide collected can be detected preferably by liquid chromatography after removal of its glycan moiety, followed by mass spectrometry, in which the eluted peptides are introduced directly into a mass spectrometer on line. Mass spectrometric analysis can obtain not only its simple mass spectrum, but also its MS/MS spectrum using collision-induced dissociation (CID) as fragmentation method. Additionally, marker peptide is able to be detected as multiple fragment ions generated by CID for pre-listed ion of the marker peptide (technology called as single reaction monitoring (SRM) or multiple reaction monitoring (MRM)). In the analytical method, if a synthetic marker peptide having certain mass difference due to incorporation of stable isotope is added into the specimen, it is possible to perform absolute quantitation of the peptide by comparing their signal intensities.
(101) A marker glycoprotein can be detected by use of various proteomic techniques known in the art. For example, a collected protein fraction is separated by one-dimensional or two-dimensional gel electrophoresis. Then, the signal intensity (dye or fluorescence staining, etc.) of the target spot can be compared to that of a reference specimen to quantify relatively. In case of use of mass spectrometer, it is possible to detect the collected glycoprotein by protease digestion followed by LC/MS analysis. Quantification can be made by various methods (e.g., ICAT, MCAT, iTRAQ, SILAC methods) using a stable isotope label and a non-labeled simple quantification method (e.g., peptide counting method, area integration method) can be used in combination with them. Furthermore, as described later, quantification can be made by the ELISA method.
(102) 3-2. Lectin Microarray
(103) 3-2-1. Glycan Profiling by Lectin Microarray
(104) (1) Lectin Microarray (Simply Referred Also to as Lectin Array)
(105) A lectin array is prepared by immobilizing a plurality of types of probe lectins different in specificity onto a single substrate in parallel (in the form of array). The lectin array can simultaneously analyze which lectin interacts with an analysis target, i.e., a conjugated polysaccharide.
(106) When the lectin array is used, information required for estimating a glycan structure can be obtained by a single analysis and a step from sample preparation to scanning can be quickly and simply carried out. In a glycan profiling system such as mass spectrometry, a glycoprotein cannot be directly analyzed as it is; in other words, a glycoprotein must be treated and decomposed into glycopeptides and free glycans. On the other hand, in the lectin microarray, a glycoprotein can be analyzed as it is only by introducing, for example, a fluorescent reagent, directly into a core protein moiety thereof. This is an advantage of the lectin microarray. The lectin microarray technique has been developed by the present inventors and the principle and fundamental are described, for example, in Kuno A., et al. Nat. Methods 2,851-856 (2005).
(107) Lectins to be used in the lectin array are listed in the following Table 4.
(108) TABLE-US-00004 TABLE 4 Lectins Origin Binding specificity (Sugar binding specificity) 1 LTL Lotus tetragonolobus Fucα1-3GlcNAc, Sia-Le.sup.x and Le.sup.x 2 PSA Pisum sativum Fucα1-6GlcNAc and α-Man 3 LCA Lens culinaris Fucα1-6GlcNAc and α-Man, α-Glc 4 UEA-I Ulex europaeus Fucα1-2LacNAc 5 AOL Aspergillus oryzae Terminal αFuc and ±Sia-Le.sup.x 6 AAL Aleuria aurantia Terminal αFuc and ±Sia-Le.sup.x 7 MAL Maackia amurensis Siaα 2-3Gal 8 SNA Sambucus nigra Siaα 2-6Gal/GalNAc 9 SSA Sambucus sieboldiana Siaα 2-6Gal/GalNAc 10 TJA-I Trichosanthes japonica Siaα 2-6Galβ1-4GlcNAcβ-R 11 PHA(L) Phaseolus vulgaris Tri- and tetra-antennary complex oligosaccharides 12 ECA Erythrina cristagalli Lac/LacNAc 13 RCA120 Ricinus communis Lac/LacNAc 14 PHA(E) Phaseolus vulgaris NA2 and bisecting GlcNAc 15 DSA Datura stramonium (GlcNAc).sub.n, polyLacNAc and LacNAc (NA3, NA4) 16 GSL-II Griffonia simplicifolia Agalactosylated N-glycan 17 NPA Narcissus pseudonarcissus non-substituted α1-6Man 18 ConA Canavalia ensiformis α-Man (inhibited by presence of bisecting GlcNAc) 19 GNA Galanthus nivalis non-substituted α1-6Man 20 HHL Hippeastrum hybrid non-substituted α1-6Man 21 BPL Bauhinia purpurea alba Galβ1-3GalNAc and NA3, NA4 22 TJA-II Trichosanthes japonica Fucα1-2Gal, β-GalNAc > NA3, NA4 23 EEL Euonymus europaeus Galα1-3[Fucα1-2Gal] > Galα1-3Gal 24 ABA Agaricus bisporus Galβ1-3GalNAcα-Thr/Ser (T) and sialyl-T 25 LEL Lycopersicon esculentum (GlcNAc).sub.n and polyLacNAc 26 STL Solanum tuberosum (GlcNAc).sub.n and polyLacNAc 27 UDA Urtica dioica (GlcNAc).sub.n and polyLacNAc 28 PWM Phytolacca americana (GlcNAc).sub.n and polyLacNAc 29 Jacalin Artocarpus integrifolia Galβ1-3GalNAcα-Thr/Ser (T) and GalNAcα-Thr/Ser (Tn) 30 PNA Arachis hypogaea Galβ1-3GalNAcα-Thr/Ser (T) 31 WFA Wisteria floribunda Terminal GalNAc (e.g., GalNAcβ1-4GlcNAc) 32 ACA Amaranthus caudatus Galβ1-3GalNAcα-Thr/Ser (T) 33 MPA Maclura pomifera Galβ1-3GalNAcα-Thr/Ser (T) and GalNAcα-Thr/Ser (Tn) 34 HPA Helix pomatia Terminal GalNAc 35 VVA Vicia villosa α-, β-linked terminal GalNAc and GalNAcα-Thr/Ser (Tn) 36 DBA Dolichos biflorus GalNAcα-Thr/Ser (Tn) and GalNAcα1-3GalNAc 37 SBA Glycine max Terminal GalNAc (especially GalNAcα1-3Gal) 38 GSL-I Griffonia simplicifolia α-GalNAc, GalNAcα-Thr/Ser (Tn), α-Gal mixture 39 PTL-I Psophocarpus tetragonolobus α-GalNAc and Gal 40 MAH Maackia amurensis Siaα 2-3Galβ1-3[Siaα2-6GalNAc] α-R 41 WGA Triticum unlgaris (GlcNAc)n and multivalent Sia 42 GSL-IA.sub.4 Griffonia simplicifolia α-GalNAc, GalNAcα-Thr/Ser (Tn) 43 GSL-IB.sub.4 Griffonia simplicifolia α-Gal
(109) For example, a lectin array (LecChip, manufactured by GP Bioscience Ltd.) in which 45 types of lectins are immobilized onto a substrate is already commercially available.
(110) (2) Statistical Analysis of Glycan Profile Obtained by Lectin Array
(111) The lectin array has been developed, up to present, to a practical technique by which a quantitative comparative glycan profiling can be made with respect to not only a purified sample but also a mixture of specimens such as the serum and a cell lysate. Particularly, the comparative glycan profiling of a cell surface glycan has been significantly developed (Ebe, Y. et al. J. Biochem. 139, 323-327 (2006), Pilobello, K. T. et al. Proc Natl Acad Sci USA. 104, 11534-11539 (2007), Tateno, H. et al. Glycobiology 17, 1138-1146 (2007)).
(112) Furthermore, data mining by statistical analysis of a glycan profile can be made, for example, by a method(s) described in “Kuno A, et al. J Proteomics Bioinform. 1, 68-72 (2008).” or “the Japanese Society of Carbohydrate Research 2008/8/18 development of application technique for lectin microarray˜comparative glycan profiling and statistical analysis of biological specimen˜Kuno A, Matsuda A, Itakura Y, Matsuzaki H, Narimatsu H, Hirabayashi J” and “Matsuda A, et al. Biochem Biophys Res Commun. 370, 259-263 (2008)”.
(113) (3) Antibody Overlay Lectin Microarray Method
(114) The platform of a lectin microarray is basically the same as described above. An above-described subject is not directly labeled with a fluorescent reagent but by indirectly introducing a fluorescent group into a subject via an antibody. In this manner, many subjects can be simply and quickly analyzed at the same time. This is an application method (see “Kuno A, Kato Y, Matsuda A, Kaneko M K, Ito H, Amano K, Chiba Y, Narimatsu H, Hirabayashi J. Mol. Cell Proteomics. 8, 99-108 (2009)”, “Hirabayashi J, Kuno A, Uchiyama N, “Development of application technology for glycan profiling using a lectin microarray”, Experimental Medicine, extra number “Study for cancer diagnosis at a molecular level˜challenge to clinical application”, Yodosha, Vol. 25 (17) 164-171 (2007)”, Kuno A, Hirabayashi J, “Application of glycan profiling system by lectin microarray to searching glycan biomarker”, Genetic Medicine MOOK No. 11 “Development of clinical glycan biomarker and elucidation of glycan function”, pp. 34-39, Medical Do (2008)).
(115) For example, if a glycoprotein is a subject, the glycan moiety can be recognized by a lectin on a lectin microarray. Thus, if an antibody against a core protein moiety is overlayed on the glycoprotein, the glycoprotein can be specifically detected with a high sensitivity without labeling the subject glycoprotein or highly purifying it.
(116) (4) Lectin Overlay Antibody Microarray Method
(117) This is a method using an antibody microarray, which is prepared by immobilizing an antibody against a core protein onto a substrate such as a glass substrate in parallel (in the form of array), in place of a lectin microarray. The same numbers of antibodies as the number of markers to be checked are required. It is necessary to previously determine a lectin for detecting a glycan change.
(118) 3-3 Lectin-Antibody Sandwich Immunological Detection
(119) Based on the results of a lectin array, a simple and inexpensive sandwich detection method can be designed. Basically, two types of antibodies are used in the sandwich detection method. This method can be applied simply by replacing lectin for one of the antibodies in the protocol of this method. Therefore, this method can be applied to an automatic operation using a conventional automatic immuno-detection apparatus. What is a point that should be considered is the reaction between an antibody and a lectin to be used as sandwiching substances. The antibody has at least two N-linked glycans. Therefore, when the lectin to be used recognizes a glycan on the antibody, background noise inevitably occurs in sandwich detection time due to the binding reaction thereof. To suppress generation of a noise signal, an approach of modifying a glycan moiety on the antibody and an approach of using only Fab containing no glycan moiety are conceivable. As these approaches, known methods may be employed. As the approach of modifying a glycan moiety, for example, methods described in Chen S. et al., Nat. Methods. 4, 437-44 (2007) and Comunale M A, et al., J Proteome Res. 8, 595-602 (2009), are mentioned. As the approach of using Fab, for example, a method described in Matsumoto H., et al., Clin Chem Lab Med 48, 505-512 (2010), may be mentioned.
(120) 3-4. Method Using Serial Column Chromatography
(121) An antibody overlay lectin array is the most ideal approach for statistically detecting a lectin, which most precisely reflects a disease specific change of a glycan on a novel hepatic disease-state-indicating glycan marker candidate molecule; however, it requires an antibody which can immunologically precipitate and can be detected by an overlay method. Nevertheless, such an antibody is not always available. Accordingly, as means for using more candidate molecules in detection of a hepatic disease, generally a method of immunologically detecting the amount of target glycoprotein is applied to a glycoprotein collected by a probe lectin. To describe more specifically, SDS-PAGE is performed; a protein is transferred onto a membrane and thereafter immunologically detected by Western blot. The signal intensities of the obtained bands are compared. In this manner, changes between specimens can be quantitatively estimated. Based on quantitative change of a protein having a cancerous glycosylation, significance of each marker candidate can be validated for each disease-state and the candidates were screened. Herein, glycan marker candidate molecules, in which fucose modification increases with the progress of a hepatic disease, are validated. In this case, generally, AAL lectin, which is used in a step of identifying a candidate molecule, is also used as a probe protein in a validation step. For example, this strategy is actually employed in a report of Liu Y., et al. J Proteome Res. 9, 798-805 (2010). However, proteins in the serum are known to differ in N-linked glycan structure (degree of branching) and fucosylation (core fucose, blood group antigen, etc.) depending upon the type of protein. Even if they are the same molecules, it has been reported that they are differently modified with fucose. For example, Nakagawa T, et al. have reported, in J. Biol. Chem. 281, 29797-29806 (2006), that α1-anti-trypsin molecules are differently modified with fucose. This is because proteins are increased or not in a different timing depending upon the type of disease and degree of progress. Therefore, it is not ideal to use AAL capable of recognizing and collecting almost all fucose modifications and collect a whole of fucose-containing glycoproteins and quantitatively compare them. Then, we conceived that two different types of fucose recognizing lectins are used for separating and fractionating proteins by serial column chromatography and individual fractions are quantitatively analyzed and compared. The scheme of the technique is shown in
(122) 4. Hepatic Disease-State-Indicating Glycan Marker Candidate
(123) Several examples of a hepatic disease-state-indicating glycan marker candidate selected in the aforementioned steps will be shown below.
(124) 4-1. Examples of the Hepatic Disease-State-Indicating Glycan Marker Candidate Glycopeptide Include the Following Glycopeptides.
(125) (1) A hepatic disease-state-indicating glycan marker glycopeptide, which is a polypeptide represented by Peptide No. 19 in Table 1.
(126) (2) A hepatic disease-state-indicating glycan marker glycopeptide, which is a polypeptide represented by Peptide No. 26 in Table 1.
(127) (3) A hepatic disease-state-indicating glycan marker glycopeptide, which is a polypeptide represented by Peptide No. 118 in Table 1.
(128) (4) A hepatic disease-state-indicating glycan marker glycopeptide, which is a polypeptide represented by Peptide No. 124 in Table 1.
(129) (5) A hepatic disease-state-indicating glycan marker glycopeptide, which is a polypeptide represented by Peptide No. 125 in Table 1.
(130) (6) A hepatic disease-state-indicating glycan marker glycopeptide, which is a polypeptide represented by Peptide No. 130 in Table 1.
(131) (7) A hepatic disease-state-indicating glycan marker glycopeptide, which is a polypeptide represented by Peptide No. 132 in Table 1.
(132) (8) A hepatic disease-state-indicating glycan marker glycopeptide, which is a polypeptide represented by Peptide No. 135 in Table 1.
(133) Note that the glycopeptides of (1) to (8) above can be used in combination with two or more.
(134) 4-2. Examples of the Hepatic Disease-State-Indicating Glycan Marker Candidate Glycoprotein Include the Following Glycoproteins:
(135) (1) A hepatic disease-state-indicating glycan marker glycoprotein, which is a glycoprotein containing a polypeptide represented by Protein No. 22 in Table 2 above and having a glyccolylation change including fucosylation;
(136) (2) A hepatic disease-state-indicating glycan marker glycoprotein, which is a glycoprotein containing a polypeptide represented by Protein No. 89 or 90 in Table 2 above and having a glycosylation change including fucosylation;
(137) (3) A hepatic disease-state-indicating glycan marker glycoprotein, which is a glycoprotein containing a polypeptide represented by Protein No. 145-LR in Table 2 above and having a glycosylation change including fucosylation;
(138) (4) A hepatic disease-state-indicating glycan marker glycoprotein, which is a glycoprotein containing a polypeptide represented by Protein No. 9 in Table 2 above and having a glycosylation change including fucosylation;
(139) (5) A hepatic disease-state-indicating glycan marker glycoprotein, which is a glycoprotein containing a polypeptide represented by Protein No. 8 in Table 2 above and having a glycosylation change including fucosylation
(140) (6) A hepatic disease-state-indicating glycan marker glycoprotein, which is a glycoprotein containing a polypeptide represented by Protein No. 103 or 104 in Table 2 above and having a glycosylation change including fucosylation;
(141) (7) A hepatic disease-state-indicating glycan marker glycoprotein, which is a glycoprotein containing a polypeptide represented by Protein No. 47 in Table 2 above and having a glycosylation change including fucosylation;
(142) (8) A hepatic disease-state-indicating glycan marker glycoprotein, which is protein pIgR containing a polypeptide represented by Protein No. 105 in Table 2 above and having a glycosylation change including fucosylation;
(143) (9) A hepatic disease-state-indicating glycan marker glycoprotein, which is protein CSF1R containing a polypeptide represented by Protein No. 32 in Table 2 above and having a glycosylation change including fucosylation;
(144) (10) A hepatic disease-state-indicating glycan marker glycoprotein, which is protein SHBG containing a polypeptide represented by Protein No. 129 in Table 2 above and having a glycosylation change including fucosylation;
(145) (11) A hepatic disease-state-indicating glycan marker glycoprotein, which is protein SEPP1 containing a polypeptide represented by Protein No. 122 or 123 in Table 2 above and having a glycosylation change including fucosylation;
(146) (12) A hepatic disease-state-indicating glycan marker glycoprotein, which is protein SPARCL1 containing a polypeptide represented by Protein No. 130 in Table 2 above and having a glycosylation change including fucosylation;
(147) (13) A hepatic disease-state-indicating glycan marker glycoprotein, which is protein SERPINA7 containing a polypeptide represented by Protein No. 126 in Table 2 above and having a glycosylation change including fucosylation; and
(148) (14) A hepatic disease-state-indicating glycan marker glycoprotein, which is protein MANA2 containing a polypeptide represented by Protein No. 92 in Table 2 above and having a glycosylation change including fucosylation.
(149) Note that the glycoproteins of (1) to (14) above can be used in combination with two or more.
(150) Furthermore, the glycoproteins of (1) to (8) described in the above section 4-1. and the glycoproteins of (1) to (14) described in the above section 4-2. can be used in combination with two or more.
(151) 5. Validation of Hepatic Disease-State-Indicating Glycan Marker Candidate
(152) The marker candidates identified above are studied on 1) how significantly a measurement value changes with the progress of a disease, 2) in which stage of disease (initial stage or late stage) the measurement value most significantly changes and 3) whether data of measurement-value change contributes to controlling a disease. Based on the study, usefulness of the marker is evaluated and which hepatic disease-state the marker is suitably used can be validated.
(153) 6. Method of Detecting and/or Identifying a Hepatic Disease by Use of a Novel Hepatic Disease-State-Indicating Glycan Marker Candidate
(154) Furthermore, the present invention includes a method of specifically detecting a hepatic disease, including detecting and/or identifying a novel hepatic disease-state-indicating glycan marker candidate listed in Table 2 above (note that, hereinafter, a lectin specifically reacting with a certain novel hepatic disease-state-indicating glycan marker candidate will be referred to as lectin “A”).
(155) For example, examples of detection means for a novel hepatic disease-state-indicating glycan marker candidate having a glycan specifically reacting with lectin “A” include the followings.
(156) (1) a combination of means, i.e., (i) means for detecting a glycan specifically reacting with lectin “A” and (ii) means for detecting a core protein by means for detecting a portion (core protein) except the glycan of a hepatic disease-state-indicating glycan marker, and (2) an antibody, which is an antibody specific to a hepatic disease-state-indicating glycan marker having a glycan specifically binding to lectin “A” and using the vicinity of a glycan binding site as an epitope. Herein, the means for detecting a glycan specifically reacting with lectin “A” and the means for detecting a core protein may be means for measuring a glycan specifically reacting with lectin “A” and means for measuring a core protein, respectively.
(157) For example, a patient with a hepatic disease can be distinguishably detected from a healthy volunteer by detecting a novel hepatic disease-state-indicating glycan marker candidate by use of an antibody against a core protein and lectin “A”. Preferably, an antibody overlay method using a lectin array (“Kuno A, Kato Y, Matsuda A, Kaneko M K, Ito H, Amano K, Chiba Y, Narimatsu H, Hirabayashi J. Mol. Cell Proteomics. 8, 99-108 (2009)) can be used.
(158) As a more simple detection method, a lectin-antibody sandwich immunological detection method can be used.
(159) 6-1. For Example, a Specific Method for Detecting a Hepatic Disease by Use of a Novel Hepatic Disease-State-Indicating Glycan Marker Candidate Having a Glycan Specifically Reacting with Lectin “A” Includes
(160) 1) a step of measuring a hepatic disease-state-indicating glycan marker having a glycan specifically reacting with lectin “A” in a specimen taken from a subject outside the body or a fragment thereof (a peptide containing a glycan modification site),
(161) 2) a step of measuring a hepatic disease-state-indicating glycan marker having a glycan specifically reacting with lectin “A” in a specimen taken from a healthy volunteer outside the body or a fragment thereof (a peptide containing a glycan modification site),
(162) 3) a step of measuring a hepatic disease-state-indicating glycan marker having a glycan specifically reacting with lectin “A” in a specimen taken from a patient with a hepatic disease outside the body or a fragment thereof (a peptide containing a glycan modification site), and
(163) 4) comparing the measurement results of the hepatic disease-state-indicating glycan marker having a glycan specifically reacting with lectin “A” taken from the subject or a fragment thereof (a peptide containing a glycan modification site) with the measurement results of a hepatic disease-state-indicating glycan marker having a glycan specifically reacting with lectin “A” taken from the healthy volunteer or the patient with a hepatic disease or a fragment thereof (a peptide containing a glycan modification site); and determining as being the hepatic disease if the measurement results of the subject is closer to the measurement value of the patient with a hepatic disease.
(164) 6-1-1.
(165) 1) Method for Measuring Progression of Fibrosis
(166) In the progression of hepatitis by hepatitis viral infection, it is known that the degree of fibrosis is correlated with deterioration of liver function and a risk of developing hepatocarcinoma. Therefore, measurement of fibrosis means to evaluate deterioration of liver function and a carcinogenic risk. Furthermore, about four out of ten hepatitis patients does not respond to an interferon therapy and viral infection sustains. Whether these disease-states are developed into active disease-states is considered to be determined based on progression of fibrosis. In view of these, measuring progression of fibrosis has significant meaning in diagnostic treatment for hepatitis.
(167) Evaluation of fibrosis presently performed is based on pathologic diagnosis on a biopsy specimen. Owing to recent introduction of FibroScan, this method is expected to be widely used. Furthermore, as a method of serologically evaluating fibrosis, Fibro Test, Forn's index, Hepatoscore, etc., are clinically used; however, they are inferior in both sensitivity and specificity to biopsy diagnosis.
(168) With respect to the marker candidate glycopeptides and glycoproteins obtained by the present invention and listed in Tables 1 or 2, analysis is made as follows. Patient's sera different in the degree of fibrosis are subjected to an antibody overlay lectin microarray. A lectin exhibiting an increase or decrease in signal intensity correlating with the degree of fibrosis is selected. Based on the data, a sandwich assay using an antibody against a marker candidate molecule and lectin “A” whose signal intensity changes with the progress of fibrosis, for example, a lectin-antibody sandwich ELISA and an antibody overlay lectin microarray method, can be established. The sera from about 100 patients having fibrosis classified by staging based on pathological diagnosis, are collected and analyzed to set a cut-off value for each stage. In this manner, progress of hepatic fibrosis can be monitored by use of the patient's serum.
(169) 2) Detection of Hepatic Cirrhosis
(170) Hepatic Cirrhosis is defined as a disease-state where a regeneration node in which a hepatic lobule structure disappears and a fibrous connective tissue surrounding it diffusely emerges over the liver. This is a terminal state of a progressive chronic hepatic disease with hepatic cell damage and fibrosis sustained. Liver biopsy for hepatic cirrhosis is performed for diagnosing a cause. In the most cases of early-stage hepatic cirrhosis and a large-node hepatic cirrhosis, it is difficult to make diagnosis (surgical pathology, 4th edition, from Bunkodo). In the circumstances, it is required to develop a testing technique enabling qualitative and quantitative diagnosis for hepatic cirrhosis. With respect to this purpose, if there is a set of a candidate molecule antibody and lectin that can distinguish fibrosis stage F3 from F4 in those found in the section 1) Method for measuring progression of fibrosis, such a set can be used for detecting hepatic cirrhosis.
(171) 3) Detection of Early-Stage Hepatocarcinoma
(172) Early-stage hepatocarcinoma is defined as a highly differentiated hepatic cell of around 1.5 cm in size accompanying pathologic interstitial infiltrate. This is a pathological change distinguished from conventional hepatocarcinoma and regeneration node and a borderline pathological change (atypical adenomatous hyperplasia). Particularly, a borderline pathological change and highly differentiated hepatocarcinoma are considered as the same in the process reaching carcinogenesis and they are known to follow a clinical course into conventional hepatocarcinoma. In addition, highly differentiated hepatocarcinoma is considered as one of pathological changes prior to conventional hepatocarcinoma. If the pathological change is found and treated, permanent cure of the cancer can be expected.
(173) As means for attaining this, a comparative hepatic analysis method such as lectin-antibody sandwich ELISA and antibody overlay lectin microarray is employed to examine a hepatic change of marker candidate glycopeptides and glycoproteins obtained in the present invention and listed in Table 1 or 2, by serially taking a plurality of sera of patients in fibrosis stage F4 for several years until a cancer is found. Owing to this, a set of a candidate molecule having a hepatic that significantly changes from the initial stage of hepatic cirrhosis to carcinogenesis and a lectin capable of capturing the hepatic change can be used as an early-stage hepatocarcinoma detection tool.
(174) 6-2. Detection of a Novel Hepatic Disease-State-Indicating Hepatic Marker Candidate Having a Glycan Specifically Reacting with Lectin “a” in a Specimen or a Fragment Thereof (a Peptide Containing a Glycan Modification Site)
(175) Examples of a specimen include a biopsy specimen and a body fluid specimen, preferably, blood (the serum, blood plasma etc.).
(176) Measurement includes both qualitative measurement and quantitative measurement.
(177) A hepatic disease-state-indicating a glycan marker having a glycan specifically reacting with lectin “A” or a fragment thereof (a peptide containing a glycan modification site) can be measured by use of, for example, (1) means for measuring a glycan specifically reacting with lectin “A”, more specifically, a lectin “A” immobilized column and array, and (2) means for measuring a novel hepatic disease-state-indicating glycan marker candidate or a fragment thereof, more specifically, use of an antibody against a novel hepatic disease-state-indicating glycan marker candidate or a fragment thereof. Preferably, a lectin-antibody sandwich ELISA and an antibody overlay lectin array method can be used.
(178) Furthermore, the concentration of a novel hepatic disease-state-indicating glycan marker candidate having a glycan specifically reacting with lectin “A” or a fragment thereof (a peptide containing a glycan modification site) can be measured. Measurement means thereof include an antibody overlay lectin array method using a lectin array, LC-MS, an immunological measurement method, an enzyme activity measurement method and capillary electrophoresis method. Preferably, a qualitative or quantitative method can be used, which includes LC-MS, enzyme immunoassay method using a monoclonal antibody or polyclonal antibody specific to a novel glycan marker for hepatocarcinoma candidate having a glycan specifically reacting with lectin “A” or a fragment thereof, a two-antibody sandwich ELISA method, a gold colloid method, a radioimmunoassay technique, a latex aggregation immunoassay, a fluorescent immunoassay, a Western blotting method, an immunohistochemical method and a surface plasmon resonance spectroscopy (hereinafter referred to as a SPR method).
(179) Further more specifically, semi-quantification can be performed by the Western blotting method using lectin “A” and an anti-novel disease-state-indicating glycan marker candidate antibody. In the qualitative measurement, the phrase “the case where measurement results of a subject is further high” means the case where the fact that a novel disease-state-indicating glycan marker candidate having a glycan specifically reacting with lectin “A” is present in a larger amount in the specimen from a subject than the specimen from a healthy volunteer is qualitatively demonstrated. Moreover, a lectin method and mass spectrometry serving as a direct measurement method for a glycan without using an antibody are also included.
(180) As lectin “A” herein, whose reactivity varies in response to a change in glycan structure of AAT, ACT, pIgR, CPB2 and CSF1R with the progress of hepatic fibrosis, AAL can be mentioned. The protein amount itself of CSF1R also tends to increase with the progress of hepatic fibrosis. However, such a quantitative change occurs in another disease. Therefore, this is not a tool for accurately distinguishing the progression of fibrosis. In contrast, AAL-bound CSF1R quantitative change in response to a change of a glycan structure is not influenced by another disease. Thus, the accuracy is high. Furthermore, the accuracy of distinguishing the range of a progression stage of fibrosis of F3 to F4 is improved by adding a step of removing LCA-bound AAT, ACT, pIgR, CPB2, CSF1R as a previous step of detecting AAL-bound AAT, ACT, pIgR, CPB2, CSF1R.
(181) As lectin “A” whose reactivity changes in response to a change in glycan structure of CSF1R with the progress of a disease from hepatic cirrhosis to hepatocarcinoma, WFA can be mentioned which is carefully selected by the antibody overlay lectin array method. As described above, since the amount of CSF1R protein in the serum increases with the progress of hepatic fibrosis, it is preferred for more accurate diagnosis that the mass of CSF1R core protein is separately measured and a WFA-bound CSF1R measurement value is normalized by the measurement value.
(182) 7. Preparation of Novel Specific Polyclonal Antibody and/or Monoclonal Antibody Using a Novel Hepatic Disease-State-Indicating Glycan Marker Candidate or a Fragment Thereof
(183) In the method of detecting hepatocarcinoma by use of a novel hepatic disease-state-indicating glycan marker, a hepatic disease-state-indicating glycan marker specific polyclonal antibody and/or monoclonal antibody can be used, if they are easily obtained. However, if they are not easily obtained, they can be prepared, for example, as follows.
(184) 7-1. Preparation of Antibody
(185) The novel hepatic disease-state-indicating glycan marker of the present invention can be used for preparing a polyclonal antibody or monoclonal antibody for detecting a hepatic disease.
(186) For example, an antibody against a fragment of a novel hepatic disease-state-indicating glycan marker candidate can be prepared by a method known in the art. Production of the antibody can be boosted by injecting complete Freund's adjuvant at the same time. Furthermore, a peptide containing a binding site at which a glycan of X is bonded is synthesized, allowed to covalently bond to a commercially available keyhole limpet hemocyanin (KLH) and injected to an animal. Note that if a granulocyte-macrophage colony stimulating factor (GM-CSF) is simultaneously injected herein, production of the antibody can be boosted.
(187) Furthermore, for example, the anti-novel hepatic disease-state-indicating glycan marker candidate monoclonal antibody can be prepared by a method of Köhler and Milstein (Nature Vol. 256, pp 495-497 (1975)). More specifically, the antibody can be prepared by fusing an antibody-forming cell obtained from an animal immunized with an antigen with a myeloma cell to prepare a hybridoma and selecting a clone producing an anti-X antibody from the resultant hybridoma.
(188) Specifically, an adjuvant is added to the obtained hepatic disease-state-indicating glycan marker candidate for an antigen. Examples of the adjuvant include complete Freund's adjuvant and incomplete Freund's adjuvant. These may be used as a mixture.
(189) The antigen obtained as mentioned above is administered to a mammal such as a mouse, a rat, a horse, a monkey, a rabbit, a goat, a sheep. As an immunization method, any method can be employed as long as it is a conventional method; however, intravenous injection, subcutaneous injection, intraperitoneal injection, etc. are primarily employed. Furthermore, the interval between immunization operations is not particularly limited; however, immunization is performed at intervals of several days to several weeks and preferably intervals of 4 to 21 days.
(190) Two to three days after the final immunization date, antibody-forming cells are collected. Examples of the antibody-forming cell include a spleen cell, a lymph node cell and a peripheral blood cell.
(191) As the myeloma cell to be fused with an antibody-forming cell, established cell-lines derived from various animals such as a mouse, a rat and a human are used as long as one skilled in the art can generally obtains. Examples of the cell-line that can be used include a cell-line having a drug resistance and not surviving in a selective medium (for example, HAT medium) in an unfusion state and surviving there only in a fusion state. Generally, 8-azaguanine resistant line is used. This cell-line is defective in hypoxanthine-guanine-phosphoribosyl transferase and cannot grow in a hypoxanthine-aminopterin-thymidine (HAT) medium.
(192) As the myeloma cell, various cell-lines known in the art are preferably used which include, for example, P3 (P3x63Ag8.653) (J. Immunol. 123, 1548-1550 1979)), P3x63Ag8U.1 (Current Topics in Microbiology and Immunology 81, 1-7 (1978)), NS-1 (Kohler, G. and Milstein, C., Eur. J. Immunol. 6, 511-519 (1976)), MPC-11 (Margulies, D. H. et al., Cell 8, 405-415 (1976)), SP2/0 (Shulman, M. et al., Nature 276, 269-270 (1978)), FO (de St. Groth, S. F. et al., J. Immunol. Methods 35, 1-21 (1980)), 5194 (Trowbridge, I. S., J. Exp. Med. 148, 313-323 (1978)) and 8210 (Galfre, G et al., Nature 277, 131-133 (1979)).
(193) Next, the myeloma cell is fused with an antibody-forming cell. Cells are fused as follows. The myeloma cell and the antibody-forming cell are allowed to be in contact with each other in a mixing ratio of 1:1 to 1:10 in a medium for culturing an animal cell, such as MEM, DMEM and RPME-1640 medium, in the presence of a fusion promoter at 30 to 37° C. for 1 to 15 minutes. To accelerate cell fusion, a fusion promoter or a fusion virus such as a polyethylene glycol and polyvinyl alcohol having an average molecular weight of 1,000 to 6,000 or Sendai virus can be used. Furthermore, the antibody-forming cell can be fused with the myeloma cell by a commercially available cell fusion apparatus employing electrical stimulation (for example, electroporation).
(194) After cell fusion treatment, a desired hybridoma is screened from fused cells. Examples of a screening method include a method of using a selective proliferation of cells in a selective medium. More specifically, a cell suspension solution is diluted with an appropriate medium and spread on a microtiter plate. A selective medium (HAT medium, etc.) is added to the wells and culturing is performed while replacing the selective medium with a fresh one, thereafter. The resultant growing cells can be obtained as hybridomas.
(195) A hybridoma is screened by a limiting dilution method, fluorescence excitation cell sorter method, etc. Finally, a monoclonal antibody producing hybridoma is obtained. Examples of a method for collecting a monoclonal antibody from the obtained hybridoma include an ordinary cell culture method and an ascitic fluid forming method.
EXAMPLES
Example 1
(196) Discovery of Glycopeptide Biomarker Candidates by Glycoproteomics (IGOT-LC/MS Method)
(197) 1. Method for Preparation of Culture Medium Supernatant (HepG2, HuH-7: -Lot. 071213)
(198) HepG2 and Huh-7 cells were cultured in Dulbecco's modified Eagle's medium (D-MEM, containing D-glucose, 10% heat-inactivated fetal bovine serum (FBS), penicillin, streptomycin and ITS (Huh-7 only) using 14 cm dishes, and maintained at 37° C. in a humidity-controlled incubator with 5% CO2 for 3 days. The cells at 80-90% confluence were washed with the serum-free medium (10 ml/dish) (100% DMEM-high glucose, no additives) after removal of FBS-containing medium. A serum-free medium (30 ml/dish) was added and the cells were cultured for 48 hours (HepG2, HuH-7 cells will be destroyed if culturing is continued over 48 h in the serum-free medium). The media supernatant was recovered by centrifugation at 4500 g for 30 min and stored at −80° C.
(199) The stored supernatant was thawed before use, filtrated by a 0.45 micrometer filter, and used in the following Examples. Note that NaN3 was added to the medium at final concentration of 0.1%.
(200) 2. Large-Scale Identification Method of Glycoprotein
(201) 1) Preparation of Peptide Specimen
(202) Proteins of the serum samples (diluted and heat-denatured before use) and of cell culture media, were precipitated by adding trichloroacetic acid (TCA, 100% saturated aqueous solution) at a final concentration of 10%.
(203) The mixture was cooled on ice for 10-60 minutes to precipitate proteins. The precipitate was recovered by high-speed centrifugation at 4° C. The precipitate was suspended with ice-cooled acetone and recovered by centrifugation to wash away TCA. The washing was repeated twice.
(204) The precipitate was solubilized with a solubilization buffer solution (0.5 M tris-hydrochloric acid buffer, pH 8-8.5, containing 7M guanidine hydrochloride and 10 mM EDTA (ethylenediamine tetraacetate)) so that a protein concentration became about 5-10 mg/ml. The precipitate remained was removed by high-speed centrifugation. Nitrogen gas was supplied or sprayed to the protein extract to remove oxygen dissolved into the extract. Then, dithiothreitol (DTT, equal weight of protein) was added to the extract, as powder or solution in the solubilization buffer. With bubbling of nitrogen gas or under nitrogen atmosphere, disulfide bonds were reduced for 1-2 hours at room temperature. Next, iodoacetamide (2.5 weight of protein) was added to the extract and the reduced cysteine residues were alkylated for 1-2 hours at room temperature in the dark. The reaction mixture was dialyzed against a buffer solution, in general 50-100 volume of 10 mM ammonium bicarbonate, pH8.6, at 4° C. (in cold room). The external solution was exchanged three to five times at appropriate time intervals to remove the denaturing agent (guanidine hydrochloride) and excess reagents.
(205) Although the protein partially precipitated, the suspension was directly subjected to protein quantification. Trypsin (sequence grade or more, 1/100-1/50 weight of protein) was added to digest proteins at 37° C. overnight (about 16 hours). The progression of digestion was confirmed by SDS-gel electrophoresis method. When digestion was confirmed to be sufficient, phenylmethane sulfonyl fluoride (PMSF) was added to terminate the reaction at a final concentration of 5 mM.
(206) 2) Collection and Purification of Glycopeptides
(207) The digest (peptide mixture) was loaded in a column, in which a probe lectin was immobilized. After washing the column, glycopeptides were eluted with appropriate sugar solution dependent on the lectin specificity. To the eluate, equal volume of ethanol and 4 volumes of 1-butanol were added, then the peptide solution was loaded to Sepharose column equilibrated with a solvent, water:ethanol:1-butanol (1:1:4, v/v). After washing with the same solvent, glycopeptides were eluted with 50% ethanol (v/v). The glycopeptide fraction was transferred little by little to a microtube containing a small amount (2 microliter) of glycerol and evaporated by centrifugal vacuum concentrator to concentrate the glycopeptides and to remove solvent water.
(208) 3) Glycan Removal and Concomitant Stable Isotope Labeling (IGOT) of Glycosylation Site
(209) To the purified glycopeptides (in glycerol solution), a requisite amount of buffer solution was added. Solvent of the mixture was evaporated again by the same way, and then, water labeled with a stable isotope oxygen-18 (H.sub.2.sup.18O) was added to the glycerol solution (glycerol concentration was controlled to be 10% or less). Peptide-N-glycanase (glycopeptidase F, PNGase) prepared with the labeled water was added and the reaction was performed at 37° C. overnight.
(210) 4) LC/MS Shotgun Analysis of the Labeled Peptides
(211) The reaction solution was diluted with 0.1% formic acid and subjected to LC/MS shotgun analysis. A nano flow LC system using direct nano-flow pump was used to detect peptides with high resolution, high reproducibility, and high sensitivity. Injected peptides were trapped once on a trap column (reverse phase C18 silica gel) for desalting. After washing, the peptide was separated by linear gradient of acetonitril using a frit-less spray tip column (150 micrometer inner diameter and 50 mm long) of the same resin. The eluate was ionized through an electrospray interface and directly introduced into a mass spectrometer. The peptides were analyzed by tandem mass spectrometry method (MS/MS) based on collision-induced dissociation (CID) in a data dependent mode in which maximum two intense ions were selected to be analyzed.
(212) 5) Identification of Peptide by MS/MS-Ion Search Method
(213) Several thousands of MS/MS spectra obtained were individually treated by smoothing and changed to centroid spectra to make a peak list.
(214) Based on the peak lists, each peptide was identified by MS/MS ion-search method using a protein sequence database. As a search engine, Mascot (Matrix Science) was used. Parameters for the identification were as follows: a fragmentation method: trypsin digestion, maximum number of missed cleavage: 2, fixed modification: carbamidomethylation of cysteine, variable modifications: deamination of an N-terminal glutamine, oxidation of methionine, 18O-incorporating deamidation of asparagine: glycosylation site, error tolerance of MS spectrum: 500 ppm, and error tolerance of MS/MS spectrum: 0.5 Da.
(215) 6) Identification of Glycopeptide
(216) Database searching was carried out by the aforementioned conditions. The obtained results were subjected to the following identification confirmation process.
(217) (1) Probability score (a coincidence probability: Expectation value) is 0.05 or less.
(218) (2) The number of fragment ions contributing to identification is 4 or more.
(219) (3) Error (ppm) is not significantly deviated from systematic error (mass error being 0.5 Da or less).
(220) (4) The identified peptide has consensus sequences and has Asn modifications (conversion to Asp and 18O incorporation) equal to or smaller than the number of consensus sequences.
(221) 3. Selection of Marker Glycopeptide Candidates for Further Verification
(222) 1) Glycopeptides collected with a probe lectin from tryptic digests of sera of primary hepatocellular carcinoma patients who were infected by hepatitis virus, which sera were obtained before and after surgery, and digests of culture media of hepatoma cell lines, and then identified by IGOT-LC/MS method described above. The glycopeptides identified were dealt as primary candidates of glycopeptide marker for estimating the progression of liver disease. The number of detection of the candidate peptides with a probe lectin (AAL) from the samples listed in Table 5-C (medium; 2, sera; 10 (before and after surgery, 5 each) is for example represents a detection frequency with the probe.
(223) 2) Next, glycopeptides collected from sera of healthy volunteers with the same lectin were identified by the same way (Comprehensive list 2). For example, the number of detection of the peptides with the probe (AAL), which were listed in Table 5-B, represents a detection frequency with the probe lectin.
(224) 3) Furthermore, to collect glycopeptides comprehensively, peptide samples prepared from sera of healthy volunteers and patients of hepatocellular carcinoma were applied to RCA120 column after sialidase treatment, and the captured glycopeptides were identified by the same way (Comprehensive list 3). The number of detection of the peptides obtained with RCA120, for example in Table 5-F, represents the detection frequency for the lectin.
(225) 4) These glycopeptide lists were compared with each other and the glycopeptides were classified and selected the markers for further verification as follows.
(226) (i) The initial glycopeptide list of the above section 1) was compared with those of comprehensive list 2. Among the proteins in the list 1, those not overlapped with those in list 2 were defined as marker glycopeptides. However, among overlapped glycopeptides, those which were not identified in sera of the patients (after surgery) and identified in the media and sera of the patients (before surgery), were ranked to lower rank of the marker glycopeptides (as Group 5). Glycopeptide markers including the group 5 were listed in Table 5, where the serial numbers of glycopeptides of the group 5 were marked with LR (lower ranking) at the tail end.
(227) (ii) With respect to the peptides not overlapped, those only identified from the culture supernatant and the serum before surgery were separated and classified as, “marker glycopeptide for hepatocellular carcinoma”, whereas those identified from before and after surgery were classified as “marker glycopeptide for liver fibrosis”. Furthermore, these were compared with those of comprehensive list 3. The overlapped glycopeptides were ranked high as marker peptides present in a relatively higher concentration in the serum. More specifically, “marker glycopeptides for hepatocellular carcinoma” were classified into a first group and a third group based on the level (high and low) in the serum, respectively. “Marker glycopeptides for liver fibrosis” were also classified into a second group and a fourth group based on the level (high and low) in the serum.
(228) As described above, the marker glycopeptides selected were not simply defined by only the amino acid sequence but also defined in combination with modification of the peptide moiety, particularly a glycosylation site clarified, and listed in Table 1 above.
(229) TABLE-US-00005 TABLE 5 C. The de- tec- tion num- E. ber The B. with detec- Hepatic disease-state indicating marker The. probe tion glycopeptide A. de- (AAL) number Peptide sequence and modification information The tec- from D. The from F. The initial position of a sequence de- tion HCC detec- HCC The G. of numbers represents the terminal amino group tec- num- relat- tion spec- de- The and the end position there of represents tion ber ed number imen tec- num- the terminal carboxyl group. The numerals num- with spec- from after tion ber between them represent modification states of ber probe imen HCC sur- num- of residue side-chains. “0” means not modified: “1” with (AAL) (me- repre- gery ber pro- represents deamidation or cyclization of an probe from dium sent- (fibro- with tein N-terminal Gln: “2” represents (AAL). heal- 2 + ative sis RCA can- oxidation of a Met side-chain: “3” (B + thy serum spec- spec- from di- SEQ. Pep- represents deamidation or cyclization of an N- C = serum 10) imen imen) serum date ID. tide terminal carbamidemethylated Cys: “4” represents a total (total (total (total (total (total de- NO.: No. glycosylation site (Asnlabel) 14) 2) 12) 7) 5) 11) rived First group: Hepatocarcinoma marker peptide (marker peptide present in a relative large amount in serum) 1 1 FNSSYLQGTNQITGR/00400000000000000 2 0 2 2 0 11 1 2 2 VSNVSCQASVSR/00040000000000 2 0 2 2 0 10 1 3 3 GTAGNALMDGASQLMGENR/000000000000000000400 2 0 2 2 0 7 1 4 4 HEEGHMLNCTCFGQGR/000000204000000000 2 0 2 2 0 3 7 5 5 RHEEGHMLNCTCFGQGR/0000000004000000000 2 0 2 2 0 3 7 6 6 VNFTEIQK/0040000000 2 0 2 2 0 2 1 7 7 LYLGSNNLTALHPALFQNLSK/00000004000000000040000 2 0 2 2 0 1 2 8 8 GLNVTLSSTGR/0004000000000 1 0 1 1 0 11 2 9 9 MDGASNVTCINSR/020000400000000 1 0 1 1 0 11 1 10 10 HEEGHMLNCTCFGQGR/000000004000000000 1 0 1 1 0 7 7 11 11 QVFPGLNYCTSGAYSNASSTDSASYYPLTGDTR/ 00000000000000004000000000000000000 1 0 1 1 0 3 1 12 12 DQCIVDDITYNVNDTFHK/00000000000004000000 3 0 3 3 0 5 7 13 13 GAFISNFSMTVDGK/0000004000000000 1 0 1 1 0 11 1 14 14 GAFISNFSMTVDGK/0000004002000000 1 0 1 1 0 11 1 15 15 GFGVAIVGNYTAALPTEAALR/00000000040000000000000 1 0 1 1 0 11 1 16 16 LGACNDTLQQLMEVFKFDTISEK/0000040000002000000000000 1 0 1 1 0 9 1 17 17 LKELPGVCNETMMALWEECKPCLK/00000000040000000000000000 1 0 1 1 0 9 2 18 18 QLVEIEKVVLHPNYSQVDIGLIK/0000000000000400000000000 1 0 1 1 0 9 1 19 19 TLFCNASKEWDNTTTECR/00000400000040000000 1 0 1 1 0 7 5 20 20 IIVPLNNRENISDPTSPLR/000000000040000000000 1 0 1 1 0 6 1 21 21 MEACMLNGTVIGPGK/00000204000000000 1 0 1 1 0 5 1 22 22 CGNCSLTTLKDEDFCK/000400000000000000 1 0 1 1 0 4 3 23 23 ITYSIVQTNCSKENFLFLTPDCK/0000000004000000000000000 1 0 1 1 0 3 1 24 24 AVLVNNITTGER/00000040000000 1 0 1 1 0 2 2 25 25 AREDIFMETLKDIVEYYNDSNGSHVLQGR/ 1 0 1 1 0 1 1 0000000200000000000004000000000 26 26 FQSPAGTEALFELHNISVADSANYSCVYVDLKPPFGGSAPSER/ 1 0 1 1 0 1 1 000000000000000400000004000000000000000000000 27 27 QNQCFYNSSYLNVQR/10000004000000000 1 0 1 1 0 1 1 28 28 SLEAINGSGLQMGLQR/000000400000200000 1 0 1 1 0 1 1 Second group: Hepatic cellfibrosis marker peptide (marker peptide presentin a relative large amount in serum) 29 29 AHLNVSGIPCSVLLADVEDLIQNISNDTVSPR/ 4 0 4 3 1 2 2 00004000000000000000000000040000000 30 30 FTKVNFTEIQK/0000040000000 4 0 4 3 1 1 1 31 31 RHEEGHMLNCTCFGQGR/0000000204000000000 3 0 3 2 1 3 7 32 32 DIVEYYNDSNGSHVLQGR/00000004004000000000 5 0 5 4 1 1 1 33 33 TLYETEVFSTDFSNISAAK/000000000000004000000 10 0 10 5 5 6 1 34 34 QDQCIYNTTYLNVQR/10000004000000000 9 0 9 4 5 3 1 35 35 QDQCIYNTTYLNVQRENGTISR/100000040000000004000000 8 0 8 5 3 1 1 36 36 FLNDTMAVYEAK/00040020000000 7 0 7 3 4 8 1 37 37 TLNQSSDELQLSMGNAMFVK/0004000000000200020000 6 0 6 2 4 6 1 38 38 FEVDSPVYNATWSASLK/0000000004000000000 5 0 5 3 2 10 1 39 39 SPYYNVSDEISFHCYDGYTLR/00000400000000000000000 5 0 5 3 2 8 1 40 40 LGACNDTLQQLMEVFKFDTISEK/0000040000000000000000000 5 0 5 2 3 11 1 41 41 YTGNASALFILPDQDKMEEVEAMLLPETLKR/ 5 0 5 2 3 5 1 0000400000000000000000000000000 42 42 VLTLNLDQVDFQHAGNYSCVASNVQGK/ 5 0 5 2 3 1 1 00000000000000004000000000000 43 43 ELPGVCNETMMALWEECKPCLK/000000040002000000000000 4 0 4 3 1 2 2 44 44 TLNQSSDELQLSMGNAMFVK/0004000000000000020000 4 0 4 2 2 8 1 45 45 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK/ 4 0 4 2 2 3 1 00000000000040000000000000000000000 46 46 YMNASALFILPDQQKMEEVEAMLLPETLKR/ 4 0 4 1 3 4 1 0000400000000000020000000000000 47 47 NISDGFDGIPDNVDAALALPAHSYSGR/ 4 0 4 1 3 1 1 04000000000000000000000000000 48 48 HGIQYFNNNTQHSSLFMLNEVKR/0000000040000000020000000 4 0 4 1 3 1 1 49 49 SHEIWTHSCPQSPGNGTDASH/00000000000000040000000 3 0 3 2 1 10 1 50 50 NPPMGGNVVIFDTVITNQEEPYQNHSGR/ 3 0 3 2 1 1 1 000020000000000000000000400000 51 51 QIGLYPVLVIDSSGYVNPNYTGR/0000000000000000000400000 3 0 3 1 2 10 1 52 52 TLNQSSDELQLSMGNAMFVK/0004000000000200000000 3 0 3 1 2 9 1 53 53 LSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNR/ 3 0 3 1 2 2 1 00000000000004000000000000000000000400 54 54 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK/ 3 0 3 1 2 1 1 0000000000004000000000000000000000 55 55 GLKFNLTETSEAEIHQSFQHLLR/0000040000000000000000000 3 0 3 1 2 1 1 56 56 SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK/ 3 0 3 1 2 1 00000040000000000000000000000000000 57 57 DIVEYYNDSNGSHVLQGR/00000004000000000000 3 0 3 1 2 1 1 58 58 EHEAQSNASLDVFLGHTNVEELMK/00000004000000000000000000 3 0 3 1 2 1 1 59 59 DVQIIVFPEDGIHGFNFTR/000000000000000040000 2 0 2 1 1 8 1 60 60 WNNTGCQALPSQDEGPSK/00400000000000000000 2 0 2 1 1 7 1 61 61 MEACMLNGTVIGPGK/02000204000000000 2 0 2 1 1 2 1 62 62 HGIQYFNNNTQHSSLFMLNEVK/000000004000000000000000 2 0 2 1 1 1 1 63 63 SVQEIQATFFYFTPNKTEDTIFLR/00000000000000040000000000 2 0 2 1 1 1 2 Third group: Hepatocarcinoma marker peptide (marker peptide presentin a relative lower amount in serum) 64 64 DLQSLEDILHQVENK/00000000000000400 2 0 2 2 0 0 2 65 65 FLNDSIVDPVDSEWFGFYR/000400000000000000000 2 0 2 2 0 0 1 66 66 FLSSSPHLPPSSYFNASGR/000000000000000400000 2 0 2 2 0 0 1 67 67 GGNSNGALCHFPFLYNNHNYTDCTSEGR/ 2 0 2 2 0 0 7 000000000000000000040000000000 68 68 GLLHLENASYGIEPLQNSSHFEHIIYR/ 2 0 2 2 0 0 2 00000004000000000400000000000 69 69 NELVQLYQVGEVRPFYYGLCTPCQAPTNYSR/ 2 0 2 2 0 0 1 0000000000000000000000000000400 70 70 NMTFDLPSDATVVLNR/040000000000000400 2 0 2 2 0 0 1 71 71 NMTFDLPSDATVVLNR/042000000000000400 2 0 2 2 0 0 1 72 72 TNINSSRDPDNIAAWYLR/00004000000000000000 2 0 2 2 0 0 1 73 73 TNSTFVQALVEHVK/0040000000000000 2 0 2 2 0 0 3 74 74 VAAANVSVTQPESTGDPNNMTLLAEEAR/ 2 0 2 2 0 0 1 000004000000000000040000000000 75 75 VAAANVSVTQPESTGDPNNMTLLAEEARK/ 2 0 2 2 0 0 1 0000040000000000000400000000000 76 76 VAQPGINYALGTNVSYPNNLLR/000000000000040000000000 2 0 2 2 0 0 1 77 77 VLNASTLALALANLNGSR/00040000000000040000 2 0 2 2 0 0 1 78 78 QNQCFYNSSYLNVQRENGTVSR/000000040000000004000000 3 0 3 3 0 0 1 79 79 EHEGAIYPDUTDFQRADDK/0000000000400000000000 1 0 1 1 0 0 1 80 80 ENGTDTVQEEEESPAEGSK/004000000000000000000 1 0 1 1 0 0 1 81 81 GENFTETDVK/000400000000 1 0 1 1 0 0 5 82 82 GIGNYSCSYR/000040000000 1 0 1 1 0 0 1 83 83 GNETIVNLIHSTR/004000000000000 1 0 1 1 0 0 1 84 84 ILLTCSLNDSATEVTGHR/00000000400000000000 1 0 1 1 0 0 2 85 85 LDVDQALNRSHEIWTHSCPQSPGNGTDASH/ 1 0 1 1 0 0 1 00000000400000000000000040000000 86 86 NCQDIDECVTGIHNCSINETCFNIQGGFR/ 1 0 I 1 0 0 4 0000000000000040004000000000000 87 87 NRTPMGHMK/04000200000 1 0 1 1 0 0 1 88 88 QYNSTGDYR/00040000000 I 0 1 1 0 0 1 89 89 SHTNTSHVMQYGNK/0000400002000400 1 0 1 1 0 0 2 90 90 SLSCQMAALQGNGSER/000000000000400000 1 0 1 1 0 0 1 91 91 SLSCQMAALQGNGSER/000000200000400000 1 0 1 1 0 0 1 92 92 TYNGTNPDAASR/00040000000000 1 0 1 1 0 0 2 93 93 VAAANVSVTQPESTGDPNNMTLLAEEAR/ 1 0 1 1 0 0 1 000004000000000000042000000000 94 94 VCEIHEDNSTR/0000000040000 1 0 1 1 0 0 1 95 95 VVDDVSNQTSCR/00000004000000 1 0 1 1 0 0 1 96 96 HTGNVVITNCSAAHSR/000000000400000000 1 0 1 1 0 0 2 97 97 INLAGDVAALNSGLATEAFSAYGNK/ 1 0 1 1 0 0 1 000000000000000000000000400 98 98 000HLFGSNVTDCSGNFCLFR/10000000040000000000000 1 0 1 1 0 0 1 99 99 QVFPGLNYCTSGAYSNASSTDSASYYPLTGDTR/ 1 0 1 1 0 0 1 10000000000000004000000000000000000 100 100 SAEFFNYTVR/000000400000 1 0 1 1 0 0 1 101 101 SDLNPANGSYPFKALR/000000040000000000 1 0 1 1 0 0 1 102 102 TVSCQVQNGSETVVQR/000000004000000000 1 0 1 1 0 0 1 103 103 VISVDELNDTIAANLSDTEFYGAK/ 1 0 1 1 0 0 2 00000000400000400000000000 104 104 VYSLPGRENYSSVDANGIQSQMLSR/ 1 0 I 1 0 0 1 000000000400000000000020000 105 105 YRGTAGNALMDGASQLMGENR/00000000000000000200400 1 0 1 1 0 0 1 106 106 YSSNHTEHSQNLR/000040000000000 1 0 1 1 0 0 1 107 107 YYNYTLSINGK/0004000000000 1 0 1 1 0 0 1 108 108 SLTFNETYQDISELVYGAK/000004000000000000000 2 0 2 2 0 0 1 109 109 AFENVTDLQWLILDHNLLENSK/000040000000000000000000 1 0 1 1 0 0 1 110 110 CRNLSGQTDK/000400000000 1 0 1 1 0 0 1 111 111 DFTLNETVNSIFAQGAPR/00000400000000000000 1 0 1 1 0 0 2 112 112 DNYTDLVAIQNK/00400000000000 1 0 1 1 0 0 1 113 113 ELHHLQEQNVSNAFLDKGEFYIGSKYK/ 1 0 1 1 0 0 1 00000000040000000000000000000 114 114 EPGSNVTMSVDAECVPMVR/000004000000000000000 1 0 1 1 0 0 1 115 115 FLNDVKTLYETEVESTDFSNISAAK/ 1 0 1 1 0 0 1 000000000000000000004000000 116 116 FSLLGHASISCTVENETIGVWRPSPPTCEK/ 1 0 1 1 0 0 1 00000000000000040000000000000000 117 117 GNEANYYSNATTDEHGLVQFSINTTNVMGTSLTVR/ 1 0 1 1 0 0 1 0000000004000000000000040000200000000 118 118 GNESALWDCKHDGWGK/004000000000000000 1 0 1 1 0 0 2 119 119 GNETLHYETFGK/00400000000000 1 0 1 1 0 0 1 120 120 HLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQNK/ 1 0 1 1 0 0 1 0000200000000000000000002000000000000400 121 121 HNNDTQHIWESDSNEFSVIADPR/0004000000000000000000000 1 0 1 1 0 0 1 122 122 HYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTR/ 0 1 1 0 0 1 1 000000000000000000000000040000000000000000000 123 123 IDGSGNFQVLLSDRYFNK/00000000000000000400 1 0 1 1 0 0 1 124 124 ISNSSDTVECECSENWK/0004000000000000000 1 0 1 1 0 0 2 125 125 KAENSSNEEETSSEGNMR/00004000000000000000 1 0 1 1 0 0 1 126 126 KTTCNPCPLGYKEENNTGECCGR/0000000000000004000000000 1 0 1 1 0 0 1 127 127 LDAPTNLQFVNETDSTVLVR/0000000000040000000000 1 0 1 1 0 0 1 128 128 LEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTR/ 0000000000200000000000040000000000000 1 0 1 1 0 0 1 129 129 LNAENNATFYFKIDNVKJ0000004000000000000 1 0 1 1 0 0 1 130 130 LQQDVLQFQKNQTNLER/0000000000040000000 1 0 1 1 0 0 2 131 131 LSHNELADSGIPGNSFNVSSLVELDLSYNK/ 1 0 1 1 0 0 1 00000000000000000400000000000000 132 132 LSNISHLNYCEPDLR/00040000000000000 1 0 1 1 0 0 1 133 133 LTDTICGVGNMSANASDQER/0000000000400040000000 1 0 1 1 0 0 1 134 134 REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR/ 1 0 1 1 0 0 1 000000000000000000000000000040000000 135 135 SGPKNMTFDLPSDATVVLNR/0000040000000000000400 1 0 1 1 0 0 1 136 136 TYNVLDMKNTTCQDLQIEVTVK/000000020400000000000000 1 0 1 1 0 0 2 137 137 VASVININPNTTHSTGSCR/000000000040000000000 1 0 1 1 0 0 2 138 138 VTVQSLLTVETLEHNQTYECR/00000000000000040000000 1 0 1 1 0 0 1 139 139 WVNYSCLDQAR/0004000000000 1 0 1 1 0 0 3 140 140 YKVDYESQSTDTQNFSSESKR/00000000000000400000000 1 0 I 1 0 0 2 Fourth group: Hepatic cellfibrosis marker peptide (marker peptide present in a relative lower amount in serum) 141 141 GCVLLSYLNETVTVSASLESVR/000000000400000000000000 6 0 6 4 2 0 1 142 142 ALVLEQLTPALHSTNFSCVLVDPEQVVQR/ 4 0 4 2 2 0 3 0000000000000004000000000000000 143 143 WFYIASAFRNEEYNK/00000000000000400 4 0 4 2 2 0 2 144 144 SEGTNSTLTLSPVSFENEHSYLCTVTCGHK/ 4 0 4 1 3 0 1 00000400000000000000000000000000 145 145 QNQCFYNSSYLNVQRENGTVSR/100000040000000004000000 4 0 4 1 3 0 1 146 146 VDLEDFENNTAYAK/0000000040000000 4 0 4 1 3 0 1 147 147 IGEADFNRSKEFMEEVIQR/000000040000000000000 3 0 3 1 2 0 1 148 148 SHAASDAPENLTLLAETADAR/00000000004000000000000 3 0 3 1 2 0 2 149 149 DFYVDENTTVR/0000000400000 3 0 3 1 2 0 1 150 150 VQNVTEFDDSLLR/000400000000000 3 0 3 1 2 0 1 151 151 HGVIISSTVDTYENGSSVEYR/00000000000000400000000 2 0 2 1 1 0 1 152 152 YTGNASALFILPDQDKMEEVEAMLLPETLKR/ 2 0 2 1 1 0 1 0000400000000000000000020000000 153 153 AFGQFFSPGEVIYNKTDR/00000000000000400000 2 0 2 1 1 0 2 154 154 EAPYFYNDTVTFK/000000040000000 2 0 2 1 1 0 2 155 155 EHEAQSNASLDVFLGHTNVEELMK/00000004000000000000000200 2 0 2 1 1 0 1 156 156 ELDREVYPWYNLTVEAK/0000000000040000000 2 0 2 1 1 0 1 157 157 LGSYPVGGNVSFECEDGFILR/00000000040000000000000 2 0 2 1 1 0 1 Fifth group: Peptide identified with AAL from the serum of a healthy person but not identified with AAL from the patient after surgery and being possible HCC marker candidate(note that rank is low) 158 158- GCVLLSYLNETVTVSASLESVRGNR/ 3 1 2 2 0 2 1 000000000400000000000000400 159 159- VYKPSAGNNSLYR/000000004000000 5 2 3 3 0 1 1 160 160- NGTGHGNSTHHGPEYMR/0400000400000000200 3 1 2 2 0 1 1 161 161- NGTGHGNSTHHGPEYMR/0400000400000000000 3 1 2 2 0 1 1 162 162- AAIPSALDTNSSK/000000000040000 3 1 2 2 0 11 1 163 163- LGNWSAMPSCK/0004000200000 3 1 2 2 0 11 1 164 164- VVGVPYQGNATALFILPSEGK/00000000040000000000000 2 1 1 1 0 11 1 165 165- GLNLTEDTYKPR/00040000000000 3 1 2 2 0 10 1 166 166- SIPACVPWSPYLF0PNDTCIVSGWGR/ 2 1 1 1 0 2 1 0000000000000000400000000000 167 167- YNSQNQSNNQFVLYR/00000400000000000 2 1 1 1 0 2 1 168 168- KLPPGLLANFTLLR/0000000004000000 2 1 1 1 0 1 1 169 169- LGNWSAMPSCK/0004000000000 2 1 1 1 0 10 1 170 170- LHINHNNLTESVGPLPK/0000000400000000000 2 1 1 1 0 8 1 171 171- GICNSSDVR/00004000000 2 1 1 1 0 7 2 172 172- HERDAGVVCTNETR/0000000000040000 2 1 1 1 0 5 1 173 173- ASPPSSSCNISSGEMQK/0000000004000000000 2 1 1 1 0 4 1 174 174- KEDALNETRESETK/0000004000000000 2 1 1 1 0 4 2 175 175- ESKPLTAQQTTKLDAPTNLQFVNETDSTVLVR/ 2 1 1 1 0 3 6 LR 0000000000000000000000040000000000 176 176- EIRHNSTGCLR/0000040000000 4 1 3 3 0 2 LR 177 177- MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLR/ 2 1 1 1 0 2 LR 000400000000000000000004000000000000 178 178- NFTENDLLVR/040000000000 2 1 1 1 0 1 LR 179 179- NLASRPYTFHSHGITYYKEHEGAIYPDNTTDFQR/ 2 1 1 1 0 1 LR 000000000000000000000000000040000000 180 180- YPPTVSMVEGQGEKNVTFWGRPLPR/ 2 1 1 1 0 1 000000000000000400000000000 181 181- FCRDNYTDLVAIQNK/00000400000000000 2 1 1 1 0 1 182 182- INATDADEPNTLNSK/00400000000000000 2 1 1 1 0 1 183 183- TVVTYHIPQNSSLENVDSR/000000000040000000000 2 1 1 1 0 1
4. Marker Glycoprotein
(230) From the sequences of the marker glycopeptides identified and selected in the section 3, the glycoproteins containing the sequences can be defined. In detail, a table (Table 6) was prepared where each serial No. of glycoprotein having a sequence of glycopeptide listed in Table 5 were linked to its corresponding No. of glycopeptides. In this manner, a list of marker glycoproteins can be easily prepared. These glycoproteins are listed in Table 2 above.
(231) TABLE-US-00006 TABLE 6 Number of derived Protein marker No. Marker protein peptides Peptide No. of derived marker peptide 1 ADAM metallopeptidase domain 9 isoform 1 precursor 1 68 2 ADAM metallopeptidase domain 9 isoform 2 precursor 1 68 3 ADAM metallopeptidase with thrombospondin type 1 1 139 motif, 13 isoform 1 preproprotein 4 ADAM metallopeptidase with thrombospondin type 1 1 139 motif, 13 isoform 2 preproprotein 5 ADAM metallopeptidase with thrombospondin type 1 1 139 motif, 13 isoform 3 preproprotein 6 ADAM metallopeptidase with thrombospondin type 1 1 97 motif, 9 preproprotein 7 ADAMTS-like 2 1 111 8 alpha 1B-glycoprotein 2 26 134 9 alpha-2-glycoprotein 1, zinc 3 25 32 57 10 alpha-2-macroglobulin precursor 3 56 117 141 11 alpha-2-macroglobulin-like 1 1 110 12 alpha-fetoprotein precursor 2 6 30 13 apolipoprotein B precursor 4 1 11 38 99 14 asialoglycoprotein receptor 1 2 90 91 15 attractin isoform 1 1 124 16 attractin isoform 2 1 124 17 basigin isoform 1 1 84 18 basigin isoform 2 1 84 19 biotinidase precursor 1 59 20 cadherin 5, type 2 preproprotein 1 156 21 carboxypeptidase E precursor 1 83 22 carboxypeptidase N, polypeptide 2, 83 kD 1 7 23 cat eye syndrome critical region protein 1 1 150 isoform a precursor 24 CD163 antigen isoform a 1 118 25 CD163 antigen isoform b 1 118 26 ceruloplasmin precursor 3 79 113 122 27 clusterin isoform 1 2 17 43 28 clusterin isoform 2 2 17 43 29 coagulation factor C homolog, cochlin precursor 1 104 30 coagulation factor V precursor 1 72 31 coagulation factor XIII B subunit precursor 1 151 32 colony stimulating factor 1 receptor precursor 2 42 138 33 complement component (3d/Epstein Barr virus) 1 154 receptor 2 isoform 1 34 complement component (3d/Epstein Barr virus) 1 154 receptor 2 isoform 2 35 complement component 1, q subcomponent, A chain 1 50 36 complement component 1, r subcomponent 2 58 155 37 complement component 2 precursor 2 133 157 38 complement component 4 binding protein, alpha 2 53 116 chain precursor 39 complement component 4 binding protein, beta 1 19 chain isoform 1 precursor 40 complement component 4 binding protein, beta 1 19 chain isoform 1 precursor 41 complement component 4 binding protein, beta 1 19 chain isoform 1 precursor 42 complement component 4 binding protein, beta 1 19 chain isoform 2 precursor 43 complement component 4 binding protein, beta 1 19 chain isoform 2 precursor 44 complement component 4A preproprotein 2 8 136 45 complement component 4B preproprotein 2 8 136 46 complement factor B preproprotein 1 39 47 complement factor H isoform a precursor 1 9 48 cytokine receptor-like factor 1 2 77 95 49 dopamine beta-hydroxylase precursor 1 28 50 EMI domain containing 2 1 102 51 fibrinogen, beta chain preproprotein 2 3 52 fibrinogen, gamma chain isoform gamma-A 1 64 precursor 53 fibrinogen, gamma chain isoform gamma-B 1 64 precursor 54 fibronectin 1 isoform 1 preproprotein 7 4 5 10 12 31 67 127 55 fibronectin 1 isoform 2 preproprotein 7 4 5 10 12 31 67 127 56 fibronectin 1 isoform 3 preproprotein 7 4 5 10 12 31 67 127 57 fibronectin 1 isoform 4 preproprotein 7 4 5 10 12 31 67 127 58 fibronectin 1 isoform 5 preproprotein 7 4 5 10 12 31 67 127 59 fibronectin 1 isoform 6 preproprotein 7 4 5 10 12 31 67 127 60 fibronectin 1 isoform 7 preproprotein 6 4 5 10 12 31 67 61 fibulin 1 isoform A precursor 1 86 62 fibulin 1 isoform B precursor 1 86 63 fibulin 1 isoform C precursor 1 86 64 fibulin 1 isoform D 1 86 65 galectin 3 binding protein 1 114 66 glucosamine (N-acetyl)-6-sulfatase precursor 1 107 67 golgi phosphoprotein 2 2 24 130 68 golgi phosphoprotein 2 2 24 130 69 haptoglobin 1 18 70 hypothetical protein LOC196463 1 101 71 immunoglobulin J chain 1 20 72 immunoglobulin superfamily, member 1 isoform 1 1 82 73 insulin-like growth factor binding protein 3 1 140 isoform a precursor 74 insulin-like growth factor binding protein 3 1 140 isoform b precursor 75 inter-alpha (globulin) inhibitor H4 1 120 76 inter-alpha globulin inhibitor H2 polypeptide 2 13 77 intercellular adhesion molecule 2 precursor 1 119 78 interleukin 18 binding protein precursor 1 142 79 interleukin 18 binding protein precursor 1 142 80 interleukin 18 binding protein precursor 1 142 81 kininogen 1 4 23 48 62 129 82 laminin, gamma 1 precursor 3 74 75 93 83 legumain preproprotein 1 89 84 legumain preproprotein 1 89 85 lumican precursor 2 109 131 86 lunatic fringe isoform a 1 96 87 lunatic fringe isoform b 1 96 88 lysosomal-associated membrane protein 1 3 70 71 135 89 lysosomal-associated membrane protein 2 1 137 precursor 90 lysosomal-associated membrane protein 2 1 137 precursor 91 mannan-binding lectin serine protease 1 1 128 isoform 2 precursor 92 mannosidase, alpha, class 2B, member 2 1 106 93 MHC class I chain-related gene A protein 1 94 94 microfibrillar-associated protein 4 1 146 95 neuronal cell adhesion molecule isoform A 1 103 precursor 96 neuronal cell adhesion molecule isoform B 1 103 precursor 97 orosomucoid 1 precursor 4 34 35 63 143 98 orosomucoid 2 5 27 63 78 143 145 99 oxygen regulated protein precursor 1 80 100 palmitoyl-protein thioesterase 1 1 65 (ceroid-lipofuscinosis, neuronal 1, infantile) 101 peptidoglycan recognition protein 2 precursor 1 15 102 phospholipid transfer protein isoform a 1 2 precursor 103 plasma carboxypeptidase B2 isoform a 1 29 preproprotein 104 plasma carboxypeptidase B2 isoform b 1 29 105 polymeric immunoglobulin receptor 2 51 60 106 PREDICTED: similar to ADAMTS-like 2 1 111 107 PREDICTED: similar to Carboxypeptidase N 1 7 subunit 2 precursor (Carboxypeptidase N polypeptide 2) 108 PREDICTED: similar to HEG homolog 1 1 148 109 PREDICTED: similar to HEG homolog 1 1 148 110 PREDICTED: similar to Mucin-5B precursor 1 153 (Mucin 5 subtype B, tracheobronchial) (High molecular weight salivary mucin MG1) (Sublingual gland mucin) 111 PREDICTED: similar to Mucin-5B precursor 1 153 (Mucin 5 subtype B, tracheobronchial) (High molecular weight salivary mucin MG1) (Sublingual gland mucin) (4390) 112 prion protein preproprotein 1 81 113 prion protein preproprotein 1 81 114 prion protein preproprotein 1 81 115 prion protein preproprotein 1 81 116 prion protein preproprotein 1 81 117 procollagen-lysine, 2-oxoglutarate 1 100 5-dioxygenase 3 precursor 118 prosaposin isoform a preproprotein 1 73 119 prosaposin isoform b preproprotein 1 73 120 prosaposin isoform c preproprotein 1 73 121 selectin L precursor 1 112 122 selenoprotein P isoform 1 precursor 1 22 123 selenoprotein P isoform 1 precursor 1 22 124 selenoprotein P isoform 2 1 22 125 serine (or cysteine) proteinase inhibitor, 2 36 149 clade A (alpha-1 antiproteinase, antitrypsin), member 4 126 serine (or cysteine) proteinase inhibitor, 2 33 115 clade A, member 7 127 serine (or cysteine) proteinase inhibitor, 3 16 40 108 clade C (antithrombin), member 1 128 serpin peptidase inhibitor, clade A, 7 37 41 44 46 52 55 152 member 3 129 sex hormone-binding globulin 2 49 85 130 SPARC-like 1 1 125 131 TP53-target gene 5 protein 1 87 132 transferrin 3 45 54 98 133 transmembrane 4 superfamily member 6 1 88 134 transmembrane 4 superfamily member 8 1 92 isoform 1 135 transmembrane 4 superfamily member 8 1 92 isoform 2 136 tripeptidyl-peptidase I preproprotein 1 66 137 tumor rejection antigen (gp96) 1 1 121 138 UDP-GlcNAc: betaGal beta-1,3-N- 2 69 76 acetylglucosaminyltransferase 1 139 UDP-GlcNAc: betaGal beta-1,3-N- 1 132 acetylglucosaminyltransferase 2 140 vascular cell adhesion molecule 1 isoform 144 a precursor 141 vitronectin precursor 47 142 von Willebrand factor preproprotein 5 21 61 123 126 147 143-LR apolipoprotein H precursor 1 159-LR 144-LR coagulation factor II precursor 1 178-LR 145-LR complement factor I 1 166-LR 146-LR complement factor properdin 1 180-LR 147-LR desmoglein 2 preproprotein 1 182-LR 148-LR hemopexin 2 160-LR 161-LR 149-LR inducible T-cell co-stimulator ligand 1 183-LR 150-LR leucine-rich alpha-2-glycoprotein 1 1 168-LR 151-LR serine (or cysteine) proteinase inhibitor, 1 164-LR clade A (alpha-1 antiproteinase, antitrypsin), member 5
(232) (with the proviso that No. 97 and No. 98 (AGP) and No. 65 (M2BP) in Table 6 above are eliminated)
(233) 5. Demonstration by Comparison of Mass Spectrometry Signal Intensities of Glycopeptides in IGOT-LC/MS Analysis
(234) Cases where a hepatic disease-state was detected by using the glycopeptides identified in the section 3 (those peptides were detected as peptides labeled with stable isotope(s) at their glycosylation site(s) in IGOT-LC/MS analysis) as markers will be shown below. Proteins contained in the sera of healthy volunteers and the patients (taken before and after surgery) were fragmented into peptides by the aforementioned method and then subjected to IGOT-LC/MS analysis. The resultant signal intensities of the glycopeptides were compared between the sera samples of healthy volunteers and patients (the sera were taken before and after surgery). As a result, marker glycopeptides showing a significant signal only in the serum before surgery were found. Part of them is shown in
Example 2
(235) Use of Hepatic Disease-State-Indicating Glycan Marker Candidate Glycoprotein in Hepatic Disease Detection
(236) Of the glycoproteins (glycoproteins containing the sequences of glycopeptides) collected from the sera of a (viral) hepatitis patient, a hepatic cirrhosis patient and a hepatocarcinoma patient, and verified during comparative glycan profiling performed by an antibody overlay lectin microarray etc. in verification and screening of the hepatic disease-state-indicating glycan marker candidates, CPN2 was applied to detection of a hepatic disease using a novel hepatic disease-state-indicating glycan marker candidate using an antibody overlay lectin array. The Example thereof will be shown below. Note that the strategy of comparative analysis of glycans on the marker glycoproteins derived from the sera of a (viral) hepatitis patient (CH), a hepatic cirrhosis patient (LC), a hepatocarcinoma patient (HCC) and a healthy volunteer (HV) according to the method is shown in
(237) 1. Enrichment of Marker Protein from the Serum
(238) The marker glycoproteins derived from the sera of a (viral) hepatitis patient (CH), a hepatic cirrhosis patient (LC), a hepatocarcinoma patient (HCC) and a healthy volunteer (HV) were enriched in accordance with “Kuno A, Kato Y, Matsuda A, Kaneko M K, Ito H, Amano K, Chiba Y, Narimatsu H, Hirabayashi J. Mol. Cell Proteomics. 8, 99-108 (2009)”. Note that to clarify that the obtained results are dependent upon the disease-state, five cases for each disease-state were analyzed. The serum of each patient was diluted 10 fold with a 0.2% SDS-containing PBS buffer solution, heated for 10 minutes at 95° C., dispensed in a 25 μL reaction tube in the case of CPN2. To the reaction tube, 500 ng of an antibody (biotinylated compound) against CPN2 was added. Each reaction solution was adjusted to be 45 μL with a reaction buffer (Tris-buffered saline (TBSTx) containing 1% Triton X-100) and then the reaction was performed at 4° C. for 2 hours with shaking. After completion of an antigen-antibody reaction, 5 μL (corresponding to 10 μl of the original beads solution) of a streptoavidin immobilized magnetic beads solution (Dynabeads MyOne Streptavidin T1, DYNAL, manufactured by Biotech ASA), which was preliminarily washed three times with a reaction buffer and adjusted to be 2 fold concentration, was added to the above reaction solution and a reaction was performed further for 1 hour. Owing to the reaction, the glycoprotein forms into a complex with magnetic beads via the biotinylated antibody. After the complex was allowed to adsorb to a magnet for recovering magnetic beads, the solution was discarded. The complex recovered was washed three times with a reaction buffer (500 μL) and then suspended in a 10 μL elution buffer (TBS containing 0.2% SDS). The suspended solution was treated with heat at 95° C. for 5 minutes to dissociate and elute the glycoprotein from magnetic beads. The obtained solution was used as an eluate. Since a biotinylated antibody denatured with heat was contaminated in the elute at this time, 10 μL of a magnetic beads solution (corresponding to 20 μl of the original beads solution), which was adjusted to be 2 fold concentration by the aforementioned method, was added to the eluate and allowed to react for 1 hour to remove the biotinylated antibody by adsorption. The resultant solution was used in the later experiments as the serum-derived glycoprotein solution.
(239) 2. Antibody Overlay Lectin Array
(240) An appropriate amount of the glycoprotein solution obtained as described above was taken and adjusted with a lectin array reaction buffer, i.e., a 1% Triton X-100-containing phosphate-buffered saline containing 1% TritonX-100 (PBSTx) to 60 μl. This solution was added to each of reaction vessels of a lectin microarray (8 reaction vessels are formed per a single glass) and reacted at 20° C. for 10 hours or more. A lectin microarray substrate formed of 8 reaction vessels was prepared in accordance with the method described by Uchiyama et al. (Proteomics 8, 3042-3050 (2008)). In this manner, the binding reaction between glycans on the glycoprotein and 43 types of lectins immobilized onto an array substrate reaches an equilibrium state. Thereafter, to avoid generation of noise formed by binding glycan on a detection antibody to lectins remaining unreacted on the substrate, 2 μL of human serum derived IgG solution (manufactured by Sigma) was added and reacted for 30 minutes. Each reaction vessel was washed three times with 60 μL of PBSTx and then the human serum derived IgG solution (2 μL) was added again, slightly stirred and then a detection antibody (biotinylated compound) against the glycoprotein was added in an amount corresponding to 100 ng and reacted at 20° C. for 1 hour. After the antigen-antibody reaction, each reaction vessel was washed three times with 60 μL of PBSTx. Subsequently, a Cy3 labeled streptoavidin (corresponding to 200 ng)—in PBSTx solution was added and further reacted at 20° C. for 30 minutes. After completion of the reaction, each reaction vessel was washed three times with 60 μL of PBSTx and the array was scanned by an array scanner, GlycoStation manufactured by MORITEX Corporation.
(241) Of the obtained results, typical examples of individual disease-states (CPN2) are shown in
(242) From the results, it was demonstrated that, of the AAL-bound glycopeptides identified by the aforementioned large-scale analysis, a glycoprotein containing the sequence of a glycopeptide that presented in a hepatocarcinoma patient but not identified in a healthy volunteer could be a hepatic disease-state marker in the same as the glycopeptide.
(243) Furthermore, These experiments of this time revealed that some lectins other than AAL and the lectins having similar binding property also increase or decrease in accordance with a change in hepatic disease-state. This means that if a plurality of lectin signals for a glycoprotein are combined in various ways, disease-states of various-phases can be more accurately detected.
Example 3
(244) Study on Separation/Fractionation of Fucose-Containing Glycoprotein by Serial Column Chromatography and Quantitative Comparative Analysis
(245) Procedure of a verification method of a marker candidate molecule by serial column chromatography using two different fucose recognizing lectins shown in
(246) 1. Separation/Fractionation of Fucose-Containing Glycoprotein by LCA-AAL Continuous Column Chromatography
(247) Fifty μl of a healthy volunteer's pooled serum (NHS) and hepatitis C virus positive hepatocarcinoma patient's serum (HCC) were diluted 10 fold with a 0.2% SDS-containing PBS buffer and heated at 95° C. for 20 minutes to inactivate the virus. Each of the heat-treated samples was applied to an LCA lectin column (manufactured by Seikagaku Corporation) (5 mL, φ7.0 mm, height: 100.0 mm) which was preliminarily equilibrated by an initiation buffer (PBS containing 0.1% SDS and 1% Triton X-100). The flow rate during the chromatography was adjusted to 200 μL/min. After injection of the sample, the column was washed with the initiation buffer (3 fold column amount) and then with a washing buffer of 3-fold column amount (0.2% SDS-containing PBS). The glycoproteins adsorbed to the LCA column was eluted with elution buffer A (PBS containing 0.02% SDS and 200 mM methyl-α-mannoside). The solution was collected by a fraction collector by 1.0 mL per tube. The position at which the LCA-unbound fraction and the bound fraction were separated was determined by protein quantitation. Next, the LCA-unbound fraction was applied to an AAL lectin column (manufactured by Wako Pure Chemical Industries Ltd.) (0.5 mL, φ5.0 mm, height: 20.0 mm), which was previously equilibrated by an initiation buffer (PBS containing 0.1% SDS and 1% Triton X-100). The flow rate during the chromatography was adjusted to 40 μL/min. After application of the sample, the column was washed with the initiation buffer (3 fold column amount) and then with a washing buffer of 6-fold column amount (0.02% SDS-containing PBS). The glycoproteins adsorbed to the AAL column were eluted by elution buffer B (PBS containing 0.02% SDS and 200 mM fucose). The solution was collected by a fraction collector by 1.0 mL per tube. The position at which the AAL-unbound fraction and the bound fraction were separated was determined by protein quantitation. After individual fractions (LCA-bound fraction (LE), LCA-unbound/AAL-bound fraction (AE) and LCA/AAL-unbound fraction (LTAT)) were determined, separation states were confirmed by SDS-PAGE. Note that, the liquid amounts of individual fractions during the chromatography were as follows. In the case of NHS, LE was 7.7 mL, AE was 1.34 mL and LTAT was 9.25 mL. In the case of HCC, LE was 12.48 mL, AE was 1.79 mL and LTAT was 11.91 mL.
(248) 2. Qualitative and Quantitative Comparison of Fractions by Lectin Array
(249) Sugar-chain profiling of heat treated serum and glycoproteins in each fragment by a lectin array was basically performed in accordance with the method of Kuno et al. (Literature 1: Kuno et al., Nature Method 2005) and the method of Uchiyama et al. (Literature 2: Uchiyama et al. Proteomics 2008). The heat treated serum proteins (corresponding to a protein amount of 1 μg) were labeled with a fluorescent substance in accordance with the following method. After serial column chromatography, a glycoprotein in each fraction was labeled with a fluorescent substance by using a liquid whose amount was calculated assuming that the serum protein corresponding to 1 μg was fractionated based on the ratio of solution amounts after fractionation. Furthermore, an elution fraction contains a competitive sugar. To remove the competitive sugar, dilution with PBS containing 0.1% SDS and centrifugal concentration using an ultrafiltration column [Millipore Amicon Ultra™ 0.5 mL 3K cut] were repeated. The sample was prepared to a volume of 10 μL with a PBS buffer containing 1% Triton X-100. To this, 10 μg of a fluorescent labeling reagent (Cy3-SE, GE Healthcare) was added and a fluorescent labeling reaction was performed for 1 hour at room temperature. To a reaction product, a glycine-containing buffer solution (90 μL) was added and a masking reaction was performed for 2 hours at room temperature to inactivate the excessive fluorescent labeling reagent. This solution was subjected to a lectin array as fluorescent labeled glycoprotein solution. The lectin array herein had 43 types of immobilized lectins shown in Table 4. The fluorescent labeled glycoprotein solution was applied to the lectin array so as to bring a final concentration up to 2.0 μg/mL. An AE fraction sample alone was applied so as to bring a final concentration up to 8.0 μg/mL. The binding reaction between a lectin and an analysis target, i.e., glycoprotein was performed at 20° C. for 12 hours. After completion of the reaction, the sample solution on the array was removed, washed three times with a buffer for exclusive use, and scanned by a scanner for a lectin array, i.e., GlycoStation™ Reader 1200 manufactured by GP Bioscience, Ltd. Data obtained by scanning were stored as jpeg file and TIFF file. Numerical conversion of signals was performed by use of the TIFF file and by means of special software, ArrayPro Analyzer.
(250) A sugar-chain profile of individual fragments are shown in
(251) Next, signal patterns of NHS and HCC were compared. In the serum, substantially no difference was observed in the patterns; however, a little difference was observed in fucose recognizing lectins, LCA, PSA, AAL, AOL, etc. In contrast, in the case of the LCA-bound fraction, an intensive signal tends to be observed in HCC as a whole. The tendency was significantly observed in the AAL-bound fraction. Interestingly, in the LCA/AAL-unbound fraction, no substantial difference was observed between NHS and HCC. From the foregoing, the amount of fucose-containing glycoprotein is higher in HCC than in NHS. This fact suggests that both LCA-bound fucose-containing glycoprotein and LCA-unbound/AAL-bound fucose-containing glycoprotein increased.
(252) 3. Quantitative Comparison Between LCA-Bound Fucose-Containing Molecule and LCA-Unbound/AAL-Bound Fucose-Containing Molecule of Specific Glycoprotein
(253) With respect to a specific glycoprotein, how much an LCA-bound fucose-containing molecule and an LCA-unbound/AAL-bound fucose-containing molecule increase with the development of hepatocarcinoma was investigated. The LCA-bound fraction (LE) and the LCA-unbound/AAL-bound fraction (AE) of NHS and HCC obtained as mentioned above each were mixed with a Laemmli sample buffer, heated and thereafter subjected to SDS/PAGE using 5 to 20% gradient polyacrylamide gel. After electrophoresis, the separated protein was transferred to a PVDF membrane. The protein on the membrane was detected in accordance with a customary method. At this time, as the blocking agent, Block Ace (DS Pharma Biomedical, Osaka, Japan) was used; as a primary antibody, a biotinylated antibody was used; as a detection reagent, alkaline phospatase-conjugated streptavidin (1/5000 diluted with TBST; ProZyme, Inc., San Leandoro, Calif.) and Wetern Blue™ stabilized substrate for alkaline phosphatase (Promega, Madison, Wis.) were used.
(254) Herein, the results of an analysis for AGP, α1-anti-trypsin (AAT), and α1-antichymotrypsin (ACT), which have been so far reported to increase fucose modification with the progress of hepatic fibrosis and HCC carcinogenesis (J Proteome Res. 2006 February; 5 (2): 308-15.), are shown in
(255) As is apparent form the above results, the N-linked glycan structure (e.g., degree of branching) and fucose modification (core fucose, blood-type antigen, etc.) differ depending upon the protein type. Furthermore, even if molecules, although they are the same type of molecules, are sometimes differently modified with fucose. These phenomena differently increase in different timing depending upon the type of disease and degree of progression thereof. In this respect, the operation where separation/fractionation is performed by serial column chromatography using two different fucose recognizing lectins and thereafter quantitative comparative analysis is performed has an advantage. To explain more specifically, by virtue of this operation, an increase or decrease of fucosylation on the same protein with a disease can be evaluated for every modification type. Hereinafter, comparative analysis of marker candidate molecules will be made by this approach.
Example 4
(256) Identification and Validation of Hepatocarcinoma Indicating Biomarker
(257) Screening and identification method for a hepatocarcinoma marker using serial column chromatography treatment described in Example 3 will be described. More specifically, optimization of e.g., a washing buffer (Triton X-100 concentration is optimized from 1.0% to 0.1%) and an elution buffer (SDS concentration is optimized from 0.02% to 0.1%) will be described. A fractionation method for the serum will be more specifically described below. The serum was diluted with PBS [pH7.4] 10 fold and then treated with heat in the presence of 0.2% SDS at 100° C. for 15 minutes. The heat treated serum specimen (10 μL) was diluted with a washing buffer [0.1% SDS, 0.1% TritonX-100, in PBS] 10 fold to adjust a total amount to 100 μL (crude).
(258) One hundred μL of LCA agarose beads (J-oil mills Inc.) and 100 μL of the diluted and heat-treated serum specimen (crude) were mixed in an microtube and shaken in a shaker at 1,400 rpm and at 4° C. for 5 hours. After shaking, centrifugation was performed at 2,000 rpm and at 4° C. for 2 minutes to obtain the supernatant (100 μL). To LCA agarose beads, a washing buffer (100 μL) was added. The mixture was lightly mixed by a vortex and centrifuged at 2,000 rpm and at 4° C. for 2 minutes to obtain the supernatant (100 μL). This operation was repeated twice. The obtained supernatants were combined to obtain 300 μL of an LCA-unbound fraction (LT).
(259) The LCA agarose beads remaining in the microtube was washed twice with 1 mL of PBS and thereafter 100 μL of elution buffer 1 [0.1% SDS, 0.2M Methyl α-D-Mannose in PBS] was added. The mixture was shaken (0/N) by a shaker at 1,400 rpm and at 4° C. On the other hand, LT (300 μL) and 50 μL of AAL agarose beads (J-oil mills Inc.) were mixed in a microtube and shaken (O/N) by a shaker at 1,400 rpm and at 4° C.
(260) To LCA agarose beads, elution buffer 1 was added. The mixture was shaken overnight and centrifuged at 2,000 rpm and at 4° C. for 2 minutes to obtain the supernatant (90 μL). Subsequently, to the LCA agarose beads, elution buffer 1 (100 μL) was added. The mixture was gently mixed by a vortex and centrifuged at 2,000 rpm and at 4° C. for 2 minutes to obtain the supernatant (100 μL). This operation was repeated twice and then elution buffer 1 (50 μL) was added. The same operation was repeated to obtain the supernatant (40 μL). The obtained supernatants were combined to obtain 330 μL of LCA elution fraction (LE).
(261) AAL agarose beads shaken overnight were centrifuged at 2,000 rpm and at 4° C. for 2 minutes to obtain the supernatant (300 μL). To the AAL agarose beads, a washing buffer (50 μL) was added. The mixture was gently mixed by a vortex and centrifuged at 2,000 rpm and at 4° C. for 2 minutes to obtain the supernatant (50 μL). This operation was repeated twice. The obtained supernatants were combined to obtain 400 μL of an LCA/AAL-unbound fraction (LTAT).
(262) The AAL agarose beads remaining in the microtube was washed twice with PBS (500 μL) and thereafter 50 μL of elution buffer 2 [0.1% SDS, 0.2M L-(−)-Fucose in PBS] was added. The mixture was shaken by a shaker at 1,400 rpm and at 4° C. for 5 hours. After shaken, the mixture was centrifuged at 2,000 rpm and at 4° C. for 2 minutes to obtain the supernatant (50 μL). To AAL agarose beads, elution buffer 2 (50 μL) was added. The mixture was gently mixed by a vortex and centrifuged at 2,000 rpm and at 4° C. for 2 minutes to obtain the supernatant (50 μL). This operation was repeated twice. The obtained supernatants were combined to obtain 150 μL of AAL elution fraction (AE).
(263) The fractionation operations with LCA and AAL mentioned above were repeated twice to obtain respective fractions (2 fold). The obtained LTAT (600 μL), LE (660 μL) and AE (300 μL) were each concentrated in an ultrafiltration column [Millipore Amicon Ultra™ 0.5 mL 3K cut] to obtain a final volume of 40 μL. After concentrated, 10 μL of 5×SDS sample buffer [250 mM Tris-HCl (pH6.8), 10% SDS, 5% β-ME, 50% glycerol, 0.05% BPB] was added. The mixture was treated with heat at 98° C. for 5 minutes and stored at −20° C. as a specimen to be used in SDS-PAGE.
Example 5
(264) Screening of Hepatocarcinoma Indicating Biomarker
(265) The pooled sera of healthy volunteers (14 individuals) and the pooled sera of hepatocellular carcinoma patients (4 patients having AFP-L3 values in the sera taken from them of 1855.4, 130.1, 171420.0 and 1562.0, respectively) were used as a sample set. Of the proteins shown in a table (Table 2), SHBG SEPP1, pIgR, SPARCL1, CSF1R, SERPINA7 and MANA2 were compared for expression levels thereof in the serum fractionations (the serum Crude, LCA-bound fractionation, LCA-unbound/AAL-bound fractionation, unbound fractionation) by the aforementioned serial column chromatography (
Example 6
(266) Screening 2 for Hepatocarcinoma Indicating Biomarker
(267) Comparative analysis was performed using a sample set consisting of the sera of three healthy volunteers (Healthy), three hepatic cirrhosis patients (LC), and three hepatocellular carcinoma patients (HCC) by the aforementioned serial column chromatography (
Example 7
(268) Screening 3 of Hepatocarcinoma Indicating Biomarker
(269) Comparative analysis was performed using a sample set consisting of the sera of five healthy volunteers (Healthy), five (viral) hepatitis patients (CH), five hepatic cirrhosis patients (LC) and five hepatocellular carcinoma patients (HCC) by the aforementioned serial column chromatography (
Example 8
(270) Screening in Connection with Fibrosis Progression
(271) To validate the relationship with fibrosis progression, comparative analysis was performed using a sample set consisting of the sera of mild chronic hepatitis (F1), moderate chronic hepatitis (F2), severe chronic hepatitis (F3) and hepatic cirrhosis (F4) patients by the aforementioned serial column chromatography. As a result, in the LCA-unbound/AAL-bound fractionation of pIgR, the expression level in the sera of F3 or F4 patients was high compared to in F1 and F2 (
Example 9
(272) Preparation of pIgR from Biological Specimen by Immunoprecipitation
(273) The serum was diluted 10-fold with PBS [pH7.4] and treated with heat in the presence of 0.2% SDS at 100° C. for 15 minutes.
(274) Subsequently, the heat treated serum specimen (40 μL) was mixed with 0.2 μg of an affinity-purified and biotinylated goat anti-human pIgR antibody [R&D Cat#BAF2717, Lot#WZN01] and an antigen-antibody reaction was performed by a shaker at 1,400 rpm and at 20° C. for 2 hours. After completion of the reaction, to the solution, 20 μL of magnetic beads [Invitrogen Dynabeads™ MyOne™ Streptavidin T1 Cat#656.02] equilibrated with a washing buffer [20 mM Tris-HCl pH8.0, 1% TritonX100, 0.1% Na3N] were added. The mixture was gently mixed and shaken by a shaker at 1,400 rpm and at 20° C. for 1 hour. After shaking, magnetic beads and the supernatant were separated by a magnet stand [Invitrogen Dynal MPCTM-S Cat#120.20D]. After the supernatant separated was removed, magnetic beads were washed three times with PBS (1 mL). To the magnetic beads already washed, 20 μL of an elution buffer [0.2% SDS in PBS] was added. The mixture was lightly mixed by a vortex and an elution reaction was performed at 70° C. for 5 minutes. Thereafter, an microtube was allowed to stand still for 5 minutes at room temperature and centrifuged at 6,400 rpm for about 3 seconds. To the solution centrifuged, a washing buffer (20 μL) was added to bring the amount of solution to 40 μL. The mixture was gently mixed by a vortex. The supernatant and the beads were separated by a magnet stand. The supernatant was taken and used as an elution fraction. The pIgR amount of the elution fraction was quantified by Western blot. The above operation was repeated several times to obtain a solution containing pIgR (12.5 ng or more). This solution was precipitated with TCA/acetone by using a 2D-Clean up kit [GE Healthcare, Code#80-6484-51] and finally dissolved in a PBS solution to perform concentration and purification. The final concentration was adjusted to 10 ng/20 μL.
Example 10
(275) Analysis of Glycan Profile of Immuno-Precipitated pIgR Specimen by Lectin Microarray
(276) By the aforementioned method, pIgR protein was purified and concentrated from the pooled sera of healthy volunteers (NHS: 14 individuals) and the pooled sera of hepatocellular carcinoma patients (HCC: 4 patients). This was subjected to lectin microarray to analyze a glycan profile of the pIgR protein (anti-pIgR antibody precipitate) (
(277) Furthermore, with respect to a hepatocellular carcinoma patient (HCC), verification was performed again using a plurality of pooled sera (HCC, HCC-K1, HCC-K2, and HCC-K3). Similarly, pIgR protein was purified and concentrated and the glycan profile of the pIgR protein (anti-pIgR antibody precipitate) was analyzed (
Example 11
(278) Simple Purification of CSF1R from Biological Specimen by Immunoprecipitation
(279) The serum was diluted with PBS [pH7.4] 10 fold and treated with heat in the presence of 0.2% SDS at 100° C. for 15 minutes. Subsequently, the heat treated serum specimen (40 μL) and 0.2 μg of affinity-purified and biotinylated goat anti-human CSF1R antibody [R&D Cat#BAF329, Lot#BXD03] were mixed and an antigen-antibody reaction was performed by a shaker at 1,400 rpm and at 20° C. for 2 hours. After completion of the reaction, to the solution, 20 μL of magnetic beads [Invitrogen Dynabeads™ MyOne™ Streptavidin T1 Cat#656.02] equilibrated with a washing buffer [20 mM Tris-HCl pH8.0, 1% Triton X100, 0.1% Na3N] were added. The mixture was gently mixed and shaken by a shaker at 1,400 rpm and at 20° C. for 1 hour. After shaking, the magnetic beads and the supernatant were separated by use of a magnet stand [Invitrogen Dynal MPCTM-S Cat#120.20D]. After the supernatant separated was removed, the magnetic beads were washed three times with PBS (1 mL). To the magnetic beads washed, 20 μL of an elution buffer [0.2% SDS in PBS] was added. The mixture was gently mixed by a vortex and an elution reaction was performed at 70° C. for 5 minutes. Thereafter, a microtube was allowed to stand still for 5 minutes at room temperature and centrifuged at 6,400 rpm for about 3 seconds. To the solution centrifuged, a washing buffer (20 μL) was added to bring the amount of solution to 40 μL. The mixture was gently mixed by a vortex. The supernatant and the beads were separated by a magnet stand and the supernatant was taken and used as an elution fraction. The CSF1R amount of the elution fraction was quantified by Western blot.
Example 12
(280) Analysis of Glycan Profile of Immuno-Precipitated CSF1R Specimen by Lectin Microarray
(281) By the aforementioned method, CSF1R protein was purified and concentrated each from the pooled sera of healthy volunteers (NHS) and the pooled sera of hepatocellular carcinoma patients (HCC). This was subjected to lectin microarray to analyze a glycan profile of the CSF1R protein (anti-pIgR antibody precipitate) (
Example 13
(282) Analysis of Comparative Glycan Profile of Immuno-Precipitated CSF1R Specimen by Lectin Microarray
(283) Furthermore, CSF1R protein was purified and concentrated in the same manner from each of the pooled sera of healthy volunteers (NHS: 14 individuals), relatively advanced-age healthy volunteers (GP: 5 individuals), (viral) hepatitis patients (CH: 5 individuals), cirrhosis patients (LC: 5 individuals) and hepatocellular carcinoma patients (HCC: 5 individuals, K1: 2 individuals, K2: 6 individuals, K3: 2 individuals) and the glycan profile of CSF1R protein (anti-CSF1R antibody precipitate) was analyzed (
Example 14
(284) Butch Fractionation Method by WFA Derived from the Serum
(285) In the analysis so far made, it has been clarified that the signal of WFA lectin increases in e.g., CSFR1 derived from a hepatocellular carcinoma patient (HCC). This was validated in accordance with
(286) A specific method for capturing and recovering WFA-bound protein will be described below.
(287) First, 5 μg of biotinylated WFA [Vector biotinilated WFA Cat#B-1355] was diluted with 40 μL of PBS [pH 7.4] to obtain a lectin dilution solution. To the lectin dilution solution, 204 of magnetic beads [Invitrogen Dynabeads™ MyOne™ Streptavidin T1 Cat#656.02] equilibrated with PBS were added. The mixture was gently mixed and shaken by a shaker at 1,400 rpm and 20° C., for 30 minutes. After shaking, magnetic beads and the supernatant were separated by a magnet stand [Invitrogen Dynal MPCTM-S Cat#120.20D]. After the supernatant separated was removed, magnetic beads were washed three times with PBS (100 μL). After the serum was diluted with PBS [pH7.4] 10 fold, the serum was treated with heat in the presence of 0.2% SDS at 100° C. for 15 minutes. The heat treated serum specimen (10 μL) was diluted with PBS 10 fold and adjusted a total amount to 100 μL (crude). The magnetic beads (20 μL) with WFA bounded thereto and the serum (100 μL) prepared were mixed in a microtube and stirred by a shaker at 1,400 rpm and at 4° C., 0/N. After shaking, the magnetic beads and the supernatant were separated by use of a magnet stand. After the supernatant separated was removed (WFA-unbound fraction), the magnetic beads were washed three times with PBS (500 μL). To the magnetic beads washed, 20 μL of an elution buffer [0.1% SDS 0.2M lactose in PBS] was added. The mixture was gently mixed by a vortex and an elution reaction was performed at 1,400 rpm and at 20° C. for 2 hours. Thereafter, the magnetic beads and the supernatant were separated by a magnet stand to recover the supernatant (WFA bound fraction).
Example 15
(288) The amount of WFA-bound CSF1R present in the sera was checked using a sample set consisting of the sera of five healthy volunteers (Normal), five (viral) hepatitis patients (CHC), five hepatic cirrhosis patients (LC) and five hepatocellular carcinoma patients (HCC) by the aforementioned method (method of Example 14). As a result, as shown in
Example 16
(289) Screening in Connection with Fibrosis Progression
(290) To validate the relationship with fibrosis progression, WFA-bound CSF1R amount was analyzed using a sample set consisting of the sera of mild chronic hepatitis (F1), moderate chronic hepatitis (F2), severe chronic hepatitis (F3) and hepatic cirrhosis (F4) patients by the aforementioned method (method of Example 14). In the WFA-bound fractionation, CSF1R was virtually not detected in F1 to F3 and detected in part of the patient's serum of F4 (one out of two cases) (
INDUSTRIAL APPLICABILITY
(291) The present invention can be used in manufacturing an apparatus, tool or kit for determining a hepatic disease or hepatic disease-state, in determination of a hepatic disease-state or detection of hepatic cirrhosis.