COMPOSITIONS AND METHODS FOR MODULATING BODY WEIGHT

20170299608 · 2017-10-19

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure provides a protein complex, including a three-dimensional structure of the protein complex, that plays a role in regulation of body weight. In addition, the protein complex and components thereof, including three-dimensional structures thereof, find use in identifying agents that can be used to control body weight.

    Claims

    1. A method for identifying an agent that binds to an extracellular domain of a GFRAL protein, the method comprising: a) constructing a three-dimensional structure of a complex with a GDF15 protein defined by the atomic coordinates of Table 6; b) employing the three-dimensional structure and a modeling method to identify a candidate agent that binds to the GFRAL protein; c) assaying the candidate agent for binding to the extracellular domain of the GFRAL protein; and d) comparing the binding of the candidate agent to the binding of the GDF15 protein to the extracellular domain of the GFRAL protein, wherein the candidate agent is identified as an agent that binds to the extracellular domain of the GFRAL protein when the candidate agent binds with an affinity similar to the GDF15 protein.

    2-8. (canceled)

    9. A method for identifying an agent that modulates binding of a GDF15 protein to a GFRAL protein, the method comprising: a) contacting a candidate agent with a recombinant cell genetically modified to express the GFRAL protein, wherein the extracellular domain of the GFRAL protein comprises one or more amino acid residues of a GFRAL domain associated with the interface between a GFRAL protein and a GDF15 protein, wherein the one or more amino acid residues of the GFRAL domain correspond to the amino acid residues at the positions selected from the group consisting of GLY140, LEU148, ALA149, ALA146, VAL142, ASN145, VAL139, ALA135, GLU136, LEU152, LEU132, SER201, ALA204, LEU205, LYS153, ILE196, PRO197, and GLN200 of SEQ ID NO: 9, and wherein the contacting is in the presence of the GDF15 protein; and b) assaying a level of binding of the GDF15 protein to the GFRAL protein; wherein a change in the level of binding of the GDF15 protein to the GFRAL protein in the presence of the candidate agent as compared to a level of binding of the GDF15 protein to the GFRAL protein in absence of the candidate agent identifies the candidate agent as an agent that modulates binding of the GDF15 protein to the GFRAL protein, or alternatively, a) constructing a three-dimensional structure of a complex with a GDF15 protein defined by the atomic coordinates of Table 6; b) employing the three-dimensional structure and a modeling method to identify a candidate agent that modulates binding of a GDF15 protein to a GFRAL protein; c) contacting the candidate agent with a recombinant cell genetically modified to express the GFRAL protein, wherein the contacting is in the presence of the GDF15 protein; and d) assaying a level of binding of the GDF15 protein to the GFRAL protein, wherein a change in the level of binding of the GDF15 protein to the GFRAL protein in the presence of the candidate agent as compared to a level of binding of the GDF15 protein to the GFRAL protein in absence of the candidate agent identifies the candidate agent as an agent that modulates binding of the GDF15 protein to the GFRAL protein.

    10-22. (canceled)

    23. A method for identifying an agent that modulates binding of a GFRAL protein comprising an extracellular domain to a RET protein, the method comprising: a) contacting a candidate agent with a recombinant cell genetically modified to express the GFRAL protein and the RET protein wherein the extracellular domain of the GFRAL protein comprises one or more amino acid residues of a GFRAL domain associated with the interface between a GFRAL protein and a RET protein, wherein the one or more amino acid residues of the GFRAL domain correspond to the amino acid residues at the positions selected from the group consisting of GLN246, ARG247, ARG250, LYS251, CYS252, ASP255, GLU256, ASN257, CYS258, ILE259, SER260, THR261, LEU262, THR297, and GLN298 of SEQ ID NO: 9; and b) assaying a level of binding of the GFRAL protein and the RET protein; wherein a change in the level of binding of the GFRAL protein and the RET protein in the presence of the candidate agent as compared to a level of binding of the GFRAL protein and the RET protein in absence of the candidate agent identifies the candidate agent as an agent that modulates binding of the GFRAL protein to the RET protein, or alternatively, a) constructing a three-dimensional structure of a complex with a GDF15 protein defined by the atomic coordinates of Table 6; b) employing the three-dimensional structure and a modeling method to identify a candidate agent that modulates binding of the GFRAL protein to the RET protein; c) contacting the candidate agent with a recombinant cell genetically modified to express the GFRAL protein and the RET protein; and d) assaying a level of binding of the GFRAL protein and the RET protein; wherein a change in the level of binding of the GFRAL protein and the RET protein in the presence of the candidate agent as compared to a level of binding of the GFRAL protein and the RET protein in absence of the candidate agent identifies the candidate agent as an agent that modulates binding of the GFRAL protein to the RET protein.

    24-26. (canceled)

    27. A method of reducing GDF15 protein activity in a subject, treating involuntary body weight loss in a subject, or preventing involuntary body weight loss in a subject at risk of involuntary body weight loss, the method comprising: administering to the subject at least one of: a) an agent that binds an extracellular domain of a GFRAL protein wherein the GFRAL-ECD comprises (i) one or more amino acid residues of a GFRAL domain associated with the interface between a GFRAL protein and a GDF15 protein, wherein the one or more amino acid residues of the GFRAL domain correspond to the amino acid residues at the positions selected from the group consisting of GLY140, LEU148, ALA149, ALA146, VAL142, ASN145, VAL139, ALA135, GLU136, LEU152, LEU132, SER201, ALA204, LEU205, LYS153, ILE196, PRO197, and GLN200 of SEQ ID NO: 9, and/or (ii) one or more amino acid residues of a GFRAL domain associated with the interface between a GFRAL protein and a RET protein, wherein the one or more amino acid residues of the GFRAL domain correspond to the amino acid residues at the positions selected from the group consisting of GLN246, ARG247, ARG250, LYS251, CYS252, ASP255, GLU256, ASN257, CYS258, ILE259, SER260, THR261, LEU262, THR297, and GLN298 of SEQ ID NO: 9; and b) an extracellular domain of a GFRAL protein (GFRAL-ECD), wherein the agent or GFRAL-ECD is administered in an amount effective to reduce the GDF15 protein activity, treat involuntary body weight loss, or prevent onset of involuntary body weight loss, in the subject.

    28-42. (canceled)

    43. A crystal comprising a GFRAL protein and a GDF15 protein.

    44. The crystal of claim 43, wherein the crystal diffracts x-ray radiation to produce a diffraction pattern representing the three-dimensional structure of the complex having approximately the following cell constants: a=75.4 Å, b=88.8 Å, c=121.3 Å, and space group P21.

    45. The crystal of claim 43, which diffracts x-ray radiations at a resolution of about 2.20 Å.

    46. The crystal of claim 43, wherein the GFRAL protein comprises the amino acid sequence of SEQ ID NO: 23.

    47. The crystal of claim 43, wherein the GDF15 protein is a homodimer.

    48. The crystal of claim 43, having the atomic coordinates of Table 6.

    49. The crystal of claim 43 for use in a screening assay for the identification of an antagonist of a GDF15 protein.

    50. A composition comprising a crystal of any one of claims 43 to 48.

    51. A method for identifying a variant GFRAL protein with the ability to bind a GDF15 protein or the ability to bind a RET protein, the method comprising: a) constructing a three-dimensional structure of a complex comprising a GFRAL protein and a GDF15 protein defined by the atomic coordinates of Table 6; b) employing the three-dimensional structure and a modeling method to identify a site for mutating the GFRAL protein and mutating the site to generate the variant GFRAL protein; c) producing the variant GFRAL protein; and d) assaying the variant GFRAL protein to determine its ability to bind the GDF15 protein or the RET protein.

    52-56. (canceled)

    57. A method for identifying a variant GDF15 protein with the ability to bind a GFRAL protein, the method comprising: a) constructing a three-dimensional structure of a complex comprising a GFRAL protein and a GDF15 protein defined by the atomic coordinates of Table 6; b) employing the three-dimensional structure and a modeling method to identify a site for mutating the GDF15 protein and mutating the site to generate the variant GDF15 protein; c) producing the variant GDF15 protein; and d) assaying the variant GDF15 protein to determine its ability to bind the GFRAL protein.

    58-59. (canceled)

    60. A method for producing an agent that inhibits formation of a complex comprising a GFRAL protein and a GDF15 protein (GFRAL/GDF15 complex) or a complex comprising a GFRAL protein and a RET protein (GFRAL/RET complex), comprising: a) obtaining two or more 3-dimensional structures of a complex comprising a GFRAL protein and one of two or more agents (GFRAL/agent complex); b) comparing each of the 3-dimensional GFRAL/agent complex structures with a 3-dimensional structure of the GFRAL/GDF15 complex or with a 3-dimensional structure of a GFRAL/RET complex; c) selecting at least one of the two or more agents based on the structural similarity of the GFRAL/agent complex with the 3-dimensional structure of a GFRAL/GDF15 complex or with a 3-dimensional structure of a GFRAL/RET complex; and d) producing the agent.

    61-68. (canceled)

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0045] FIGS. 1A, 1B, and 1C depict amino acid sequence of a human GDF15 protein (FIG. 1A; SEQ ID NO: 6), Fc-hGDF15 (FIG. 1B; SEQ ID NOS: 7 and 8) and HSA-hGDF15 (FIG. 1C; SEQ ID NO: 24).

    [0046] FIGS. 2A-2D depict protein sequences of a human GFRAL protein (FIG. 2A; SEQ ID NO: 9), a mouse GFRAL protein (FIG. 2B; SEQ ID NO: 10), a rat GFRAL protein (FIG. 2C; SEQ ID NO: 11), and a monkey GFRAL protein (FIG. 2D; SEQ ID NO:12). FIG. 2E depicts alignment of GFRAL proteins from human, mouse, rat and monkey (SEQ ID NOS: 9-12).

    [0047] FIGS. 3A-3H depict various RET9 and RET51 protein sequences (SEQ ID NOS: 13-20).

    [0048] FIG. 4 illustrates a GFRAL-Fc protein sequence (SEQ ID NO: 21).

    [0049] FIG. 5 depicts the specific binding of an Fc-GDF15 protein to a mouse GFRAL protein.

    [0050] FIGS. 6A and 6B illustrate results from analysis of expression of GFRAL mRNA in mouse tissue.

    [0051] FIGS. 7A and 7B depict the binding of .sup.125I-GDF15 to cells expressing a human GFRAL protein.

    [0052] FIG. 8 illustrates cellular response mediated by GDF15 via GFRAL-RET receptor complex.

    [0053] FIGS. 9A-9D illustrate cellular response mediated by a human GDF15 protein via GFRAL-RET receptor complex from four species (FIG. 9A: human, FIG. 9B: cynomolgus monkey, FIG. 9C: rat, FIG. 9D: mouse).

    [0054] FIG. 10 shows that a GDF15 protein, a GFRAL-Fc protein, and the antibody 1M03 compete with .sup.125I-GDF15 for binding to GFRAL expressing cells.

    [0055] FIG. 11 depicts the effect of inhibitors (GFRAL-Fc and 1M03 antibody) of GFRAL-GDF15 binding on the cellular response to GDF15.

    [0056] FIG. 12 illustrates that anti-GFRAL ECD antibodies compete with a GDF15 protein for binding to a GFRAL ECD protein.

    [0057] FIG. 13 illustrates that anti-GFRAL ECD antibodies inhibit GDF15-mediated GFRAL-RET receptor complex activation.

    [0058] FIG. 14 shows that GFRAL interacts with RET independent of GDF15.

    [0059] FIG. 15 shows an exemplary crystal of a complex having a GFRAL protein and a GDF15 protein.

    [0060] FIG. 16 illustrates an exemplary GFRAL electron density map.

    [0061] FIG. 17 shows an exemplary ribbon diagram of the a GFRAL/GDF15 dimer formed in an asymmetric GFRAL/GDF15 crystal unit. The GFRAL protein domains D2 and D3 are indicated as GFRAL D2 and GFRAL D3.

    [0062] FIG. 18 shows an exemplary ribbon diagram of a dimer of GFRAL/GDF15 hetero-dimers formed in an asymmetric GFRAL/GDF15 crystal unit. The GFRAL protein domains D2 and D3 are indicated as GFRAL D2 and GFRAL D3.

    [0063] FIGS. 19A-19B show different surface representations of a dimer of GFRAL/GDF15 hetero-dimers.

    [0064] FIG. 20 illustrates GFRAL residues interacting with GDF15.

    [0065] FIGS. 21A-21D illustrate a GFRAL/GDF15 interface. The GFRAL protein domains D2 and D3 are indicated as GFRAL D2 and GFRAL D3.

    [0066] FIGS. 22A-22B show different aspects of a superposition of a GFRAL protein and GFRα1 depicted as ribbon diagrams.

    [0067] FIGS. 23A-23D illustrate different aspects of the interaction of a GFRAL protein with a RET protein in a RET/GFRAL/GDF15 model.

    [0068] FIGS. 24A-24B illustrate amino acids on the RET interface of a GFRAL protein.

    [0069] FIG. 25 shows a sequence alignment between various GFRAL proteins. SEQ ID NOS: 9 and 31 to 40 are depicted.

    [0070] FIG. 26 shows a sequence alignment between various GDF15 proteins. SEQ ID NOS: 25 and 41 to 51 are depicted.

    [0071] Before the present invention is further described, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.

    [0072] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges, and are also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention, the preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited.

    [0073] It must be noted that as used herein and in the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “the protein” includes reference to one or more proteins, and so forth. It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as “solely,” “only” and the like in connection with the recitation of claim elements, or use of a “negative” limitation.

    [0074] The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.

    DETAILED DESCRIPTION

    [0075] The present disclosure provides a protein complex that plays a role in regulation of body weight. The components of the protein complex of the present disclosure can be used to modulate body weight. In addition, the protein complex and components thereof find use in identifying agents that can be used to control body weight. Also provided herein are methods for treating and/or preventing involuntary body weight loss. In addition, methods for reducing GDF15 activity in subjects having increased GDF15 activity or at risk of developing increased GDF15 activity are also disclosed.

    [0076] The present disclosure also provides methods for crystallizing a GDF15 protein and a GFRAL protein, which is a previously unknown and newly identified receptor for GDF15. The present disclosure provides for the first time crystals of a GDF15 protein and a GFRAL protein. The crystals provided herein diffract x-rays with sufficiently high resolution to allow determination of the three-dimensional structure of the GDF15 ligand-GFRAL receptor complex, including atomic coordinates. The three-dimensional structure (e.g., including as provided on computer readable media) is useful for rational drug design of GDF15-related mimetics or GFRAL-related ligands, as well as agents that interfere with the interaction of a GDF15 protein with its receptor, a GFRAL protein, and/or interfere with the interaction of a GFRAL protein with a RET protein. Such agents include antibodies that bind to a GFRAL protein in a GFRAL domain and that compete for the binding of a GDF15 protein with the GFRAL protein, thereby blocking in whole or in part GDF15-GFRAL complex formation. Such agents also include antibodies that bind to a GFRAL protein in a GFRAL domain and that interfere with the binding of a RET protein with the GFRAL protein, thereby blocking in whole or in part the GDF15-mediated activation of the RET protein (e.g., cell signaling).

    [0077] Accordingly, the present disclosure provides compositions and methods for modulating body weight, including compositions comprising the newly identified receptor for GDF15 and methods comprising its use. Provided herein for the first time is a crystallized GDF15 receptor (e.g., a GFRAL protein), and a crystal structure of a complex of a GDF15 receptor (e.g., a GFRAL protein) and a GDF15 protein, resolved at 2.2 Å. The novel atomic coordinates from such crystals are useful to construct three-dimensional structures which are, in turn, useful for molecular modeling and for identifying agents that bind to a GFRAL protein and/or a GDF15 protein. Such agents are useful for modulating body weight and/or for the treatment and/or prevention GDF15-mediated diseases, disorders, or conditions.

    Definitions

    [0078] The terms “patient” or “subject” as used interchangeably herein in the context of therapy, refer to a human and non-human animal, as the recipient of a therapy or preventive care.

    [0079] The terms “treat”, “treating”, treatment” and the like refer to a course of action (such as administering an agent, e.g., a polypeptide or a pharmaceutical composition comprising a polypeptide) initiated after a disease, disorder or condition, or a symptom thereof, has been diagnosed, observed, and the like so as to eliminate, reduce, suppress, mitigate, or ameliorate, either temporarily or permanently, at least one of the underlying causes of a disease, disorder, or condition afflicting a subject, or at least one of the symptoms associated with a disease, disorder, condition afflicting a subject. Thus, treatment includes inhibiting (i.e., arresting the development or further development of the disease, disorder or condition or clinical symptoms associated therewith) an active disease.

    [0080] The term “in need of treatment” as used herein refers to a judgment made by a physician or other caregiver that a subject requires or will benefit from treatment. This judgment is made based on a variety of factors that are in the realm of the physician's or caregiver's expertise.

    [0081] The terms “prevent”, “preventing”, “prevention” and the like refer to a course of action (such as administering an agent, e.g., a polypeptide or a pharmaceutical composition comprising a polypeptide) initiated in a manner (e.g., prior to the onset of a disease, disorder, condition or symptom thereof) so as to prevent, suppress, inhibit or reduce, either temporarily or permanently, a subject's risk of developing a disease, disorder, condition or the like (as determined by, for example, the absence of clinical symptoms) or delaying the onset thereof, generally in the context of a subject predisposed to having a particular disease, disorder or condition. In certain instances, the terms also refer to slowing the progression of the disease, disorder or condition or inhibiting progression thereof to a harmful or otherwise undesired state.

    [0082] The term “in need of prevention” as used herein refers to a judgment made by a physician or other caregiver that a subject requires or will benefit from preventative care. This judgment is made based on a variety of factors that are in the realm of a physician's or caregiver's expertise.

    [0083] The phrase “therapeutically effective amount” refers to the administration of an agent to a subject, either alone or as a part of a pharmaceutical composition and either in a single dose or as part of a series of doses, in an amount that is capable of having any detectable, positive effect on any symptom, aspect, or characteristics of a disease, disorder or condition when administered to a patient. The therapeutically effective amount can be ascertained by measuring relevant physiological effects. The therapeutically effective amount can be adjusted in connection with the dosing regimen and diagnostic analysis of the subject's condition and the like.

    [0084] The phrase “in a sufficient amount to effect a change” means that there is a detectable difference between a level of an indicator measured before (e.g., a baseline level) and after administration of a particular therapy. Indicators include any objective parameter (e.g., body weight or food intake) or subjective parameter (e.g., a subject's feeling of well-being or appetite).

    [0085] The term “involuntary body weight loss” refers to the unintended loss of body weight that is observed in many conditions such as cachexia, liver cirrhosis, hyperthyroidism, chronic kidney disease, Parkinson's disease, cancer, eating disorder, and sarcopenia.

    [0086] The term “cachexia” refers to wasting syndrome that is marked with loss of weight (e.g., involuntary loss of weight), muscle atrophy, fatigue, weakness, loss of fat mass, loss of lean mass, increased muscle protein breakdown, insulaine resistance, and/or significant loss of appetite in someone who is not actively trying to lose weight. Cachexia can greatly contribute to morbidity of patients suffering from some chronic diseases (e.g., cancer, chronic renal disease, chronic obstructive pulmonary disease, AIDS, tuberculosis, chronic inflammatory diseases, sepsis and other forms of systemic inflammation, muscle wasting, such as muscular dystrophy, and the eating disorder known as anorexia nervosa).e.g. For example, in late stage cancer, cachexia is common (occurring in most terminally ill cancer patients), and is responsible for about a quarter of all cancer-related deaths. Metabolic processes (e.g., that act directly on muscle, reducing its mass and/or formation) and reduced food intake (e.g., that leads to loss of fat and/or muscle) may drive development and/or progression of cachexia. Cachexia may progress through stages that have been designated precachexia, cachexia, and refractory cachexia.

    [0087] The term “activators” refers to agents that, for example, stimulate, increase, activate, facilitate, enhance activation, sensitize or up-regulate the function or activity of one or more agents, e.g., polypeptides used to treat or prevent a metabolic disorder. In addition, activators include agents that operate through the same mechanism of action as the polypeptides of the present invention (i.e., agents that modulate the same signaling pathway as the polypeptides in a manner analogous to that of the polypeptides) and are capable of eliciting a biological response comparable to (or greater than) that of the polypeptides. Examples of activators include agonists such as small molecule compounds.

    [0088] The term “native” or “wild type”, in reference to GDF15, refers to biologically active, naturally-occurring GDF15. The term includes the 112 amino acid human GDF15 mature sequence (FIG. 1A).

    [0089] As used herein, “homologues” or “variants” refers to protein or DNA sequences that are similar based on their amino acid or nucleic acid sequences, respectively. Homologues or variants encompass naturally occurring DNA sequences and proteins encoded thereby and their isoforms. The homologues also include known allelic or splice variants of a protein/gene. Homologues and variants also encompass nucleic acid sequences that vary in one or more bases from a naturally-occurring DNA sequence but still translate into an amino acid sequence that correspond to the naturally-occurring protein due to degeneracy of the genetic code. Homologues and variants may also refer to those that differ from the naturally-occurring sequences by one or more conservative substitutions and/or tags and/or conjugates.

    [0090] The terms “crystal”, and “crystallized” as used herein, refer to one or more proteins or fragments thereof that exist in the form of a crystal. Crystals are one form of the solid state of matter, which is distinct from other forms such as the amorphous solid state or the liquid crystalline state. Crystals are composed of regular, repeating, three-dimensional arrays of atoms, ions, molecules (e.g., proteins such as antibodies), or molecular assemblies (e.g., ligand/receptor or antigen/antibody complexes). These three-dimensional arrays are arranged according to specific mathematical relationships that are well-understood in the field. The fundamental unit, or building block, that is repeated in a crystal is called the asymmetric unit. Repetition of the asymmetric unit in an arrangement that conforms to a given, well-defined crystallographic symmetry provides the “unit cell” of the crystal. Repetition of the unit cell by regular translations in all three dimensions provides the crystal. See Giege, R. and Ducruix, A. Barrett, Crystallization of Nucleic Acids and Proteins, a Practical Approach, 2nd ea., pp. 20 1-16, Oxford University Press, New York, N.Y., (1999).”

    [0091] The terms “polypeptide” and “protein”, used interchangeably herein, refer to a polymeric form of amino acids, which can include genetically coded and non-genetically coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones. The term includes fusion proteins, including, but not limited to, fusion proteins with a heterologous amino acid sequence, fusions with heterologous and homologous leader sequences, with or without N-terminal methionine residues; immunologically tagged proteins; and the like.

    [0092] It will be appreciated that throughout this present disclosure reference is made to amino acids according to the single letter or three letter codes. For the reader's convenience, the single and three letter amino acid codes are provided below:

    TABLE-US-00001 G Glycine Gly P Proline Pro A Alanine Ala V Valine Val L Leucine Leu I Isoleucine Ile M Methionine Met C Cysteine Cys F Phenylalanine Phe Y Tyrosine Tyr W Tryptophan Trp H Histidine His K Lysine Lys R Arginine Arg Q Glutamine Gln N Asparagine Asn E Glutamic Acid Glu D Aspartic Acid Asp S Serine Ser T Threonine Thr

    [0093] The terms “nucleic acid molecule” and “polynucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Non-limiting examples of polynucleotides include linear and circular nucleic acids, messenger RNA (mRNA), cDNA, recombinant polynucleotides, vectors, probes, and primers.

    [0094] The term “heterologous” refers to two components that are defined by structures derived from different sources. For example, where “heterologous” is used in the context of a polypeptide, where the polypeptide includes operably linked amino acid sequences that can be derived from different polypeptides (e.g., a first component consisting of a tag peptide or protein and a second component derived from GFRAL polypeptide). Similarly, “heterologous” in the context of a polynucleotide encoding a chimeric polypeptide includes operably linked nucleic acid sequence that can be derived from different genes (e.g., a first component from a nucleic acid encoding a peptide according to an embodiment disclosed herein and a second component from a nucleic acid encoding a carrier polypeptide). Other exemplary “heterologous” nucleic acids include expression constructs in which a nucleic acid comprising a coding sequence is operably linked to a regulatory element (e.g., a promoter) that is from a genetic origin different from that of the coding sequence (e.g., to provide for expression in a host cell of interest, which may be of different genetic origin relative to the promoter, the coding sequence or both). For example, a T7 promoter operably linked to a polynucleotide encoding a GFRAL or RET polypeptide or domain thereof is said to be a heterologous nucleic acid. “Heterologous” in the context of recombinant cells can refer to the presence of a nucleic acid (or gene product, such as a polypeptide) that is of a different genetic origin than the host cell in which it is present.

    [0095] The term “operably linked” refers to functional linkage between molecules to provide a desired function. For example, “operably linked” in the context of nucleic acids refers to a functional linkage between nucleic acids to provide a desired function such as transcription, translation, and the like, e.g., a functional linkage between a nucleic acid expression control sequence (such as a promoter or array of transcription factor binding sites) and a second polynucleotide, wherein the expression control sequence affects transcription and/or translation of the second polynucleotide. “Operably linked” in the context of a polypeptide refers to a functional linkage between amino acid sequences (e.g., of different domains) to provide for a described activity of the polypeptide.

    [0096] As used herein in the context of the structure of a polypeptide, “N-terminus” and “C-terminus” refer to the extreme amino and carboxyl ends of the polypeptide, respectively, while “N-terminal” and “C-terminal” refer to relative positions in the amino acid sequence of the polypeptide toward the N-terminus and the C-term inus, respectively, and can include the residues at the N-terminus and C-terminus, respectively.

    [0097] “Derived from” in the context of an amino acid sequence or polynucleotide sequence (e.g., an amino acid sequence “derived from” a GFRAL, RET, or GDF15 polypeptide) is meant to indicate that the polypeptide or nucleic acid has a sequence that is based on that of a reference polypeptide or nucleic acid (e.g., a naturally occurring GFRAL, RET, or GDF15 polypeptide or GFRAL, RET, or GDF15-encoding nucleic acid), and is not meant to be limiting as to the source or method in which the protein or nucleic acid is made.

    [0098] “Isolated” refers to a protein of interest that, if naturally occurring, is in an environment different from that in which it may naturally occur. “Isolated” is meant to include proteins that are within samples that are substantially enriched for the protein of interest and/or in which the protein of interest is partially or substantially purified. Where the protein is not naturally occurring, “isolated” indicates the protein has been separated from an environment in which it was made by either synthetic or recombinant means.

    [0099] “Enriched” means that a sample is non-naturally manipulated (e.g., by a scientist or a clinician) so that a protein of interest is present in a greater concentration (e.g., at least three-fold greater, at least 4-fold greater, at least 8-fold greater, at least 64-fold greater, or more) than the concentration of the protein in the starting sample, such as a biological sample (e.g., a sample in which the protein naturally occurs or in which it is present after administration), or in which the protein was made (e.g., as in a bacterial protein and the like).

    [0100] “Substantially pure” indicates that an entity (e.g., polypeptide) makes up greater than about 50% of the total content of the composition (e.g., total protein of the composition) and typically, greater than about 60% of the total protein content. More typically, a “substantially pure” refers to compositions in which at least 75%, at least 85%, at least 90% or more of the total composition is the entity of interest (e.g., 95% of the total protein). Preferably, the protein will make up greater than about 90%, and more preferably, greater than about 95% of the total protein in the composition.

    [0101] “Detectably labeled” in the context of a detectably labeled protein refers to a protein that has been modified by attachment of a detectable moiety. The detectable moiety may produce a signal directly or indirectly. Examples of a detectable moiety that produces a signal directly include a fluorescent molecule, a chemiluminescent molecule and a radioactive molecule. Detectable moieties that produce a signal indirectly include moieties that produce a signal upon exposure to detection reagents such as substrates, enzymes, or antibodies, etc. A detectable moiety that produces a signal directly can optionally be detected by indirect means such as by using a labeled antibody that binds to the moiety. The signal may be detectable by a radiation measuring device, e.g., a scintillation counter; a photodetector, e.g., a light microscope, a spectrophotometer, a fluorescent microscope, a fluorescent sample reader, or a florescence activated cell sorter, etc.

    [0102] The term “endogenous” with reference to a gene, indicates that the gene is native to a cell, i.e., the gene is present at a particular locus in the genome of a non-modified cell. An endogenous gene may be a wild type gene present at that locus in a wild type cell (as found in nature). An endogenous protein is a protein expressed by an endogenous gene.

    [0103] The term “construct” refers to a recombinant nucleic acid, generally recombinant DNA, that has been generated for the purpose of the expression of a specific nucleotide sequence(s), or is to be used in the construction of other recombinant nucleotide sequences. A construct might be present in a vector or in a genome.

    [0104] The term “recombinant” refers to a polynucleotide or polypeptide that does not naturally occur in a host cell. A recombinant molecule may contain two or more naturally-occurring sequences that are linked together in a way that does not occur naturally. A recombinant cell contains a recombinant polynucleotide or polypeptide.

    [0105] The term “coding sequence” refers to a nucleic acid sequence that once transcribed and translated produces a protein, for example, in vivo, when placed under the control of appropriate regulatory elements. A coding sequence as used herein may have a continuous ORF or might have an ORF interrupted by the presence of introns or non-coding sequences. In this embodiment, the non-coding sequences are spliced out from the pre-mRNA to produce a mature mRNA.

    Isolated Protein Complex

    [0106] An isolated complex that includes a GDF15 protein and a GFRAL protein is provided. GDF15, also known as MIC-1 (macrophage inhibitory cytokine-1), PDF, PLAB, NAG-1, TGF-PL, and PTGFB, is a member of the transforming growth factor β (TGF-β) super-family. The inventors have discovered that GDF15 binds to GFRAL and mediates activation of GFRAL-Ret receptor complex. The proteins of the isolated complex find use in regulating body weight as well as identification of agents that modulate body weight.

    [0107] “GDNF Family Receptor Alpha Like” (GFRAL) is also known as GRAL. As used herein, “GFRAL” refers to a protein having the amino acid sequence that is at least 65% identical to the amino acid sequence of SEQ ID NO: 1. SEQ ID NO: 1 is the sequence of mature human GFRAL that lacks the signal peptide:

    TABLE-US-00002 (SEQ ID NO: 1) qtnnctylreqclrdangckhawrvmedacndsdpgdpckmrnssycnlsi qylvesnfqfkeclctddfyctvnkllgkkcinksdnykedkfkwnlttrs hhgfkgmwsclevaeacvgdvvcnaqlasylkacsangnpcdlkqcqaair ffyqnipfniaqmlafcdcaqsdipcqqskealhsktcavnmvppptclsv irscqndelcrrhyrtfqskcwqrvtrkchedencistlskqdltcsgsdd ckaayidilgtvlqvqctcrtitqseeslckifqhmlhrkscfnyptlsnv kgmalytrkhankitltgfhspfngeviyaamcmtvtcgilllvmvklrts risskardpssiqipgel 

    [0108] The amino acid sequence of a full-length precursor human GFRAL protein is provided below, which includes a signal peptide sequence (underlined and lowercase residues):

    TABLE-US-00003 (SEQ ID NO: 9) mivfiflamglsleneytsQTNNCTYLREQCLRDANGCKHAWRVMEDACN DSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKK CINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLAS YLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQ SKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTR KCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSE ESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNG EVIYAAMCMTVTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL

    [0109] Accordingly, “GFRAL” as used herein encompasses human GFRAL and variants thereof, including but not limited to orthologs thereof, such as murine GFRAL, rat GFRAL, cyno GFRAL, and the like. Such sequences of GFRAL are depicted in FIG. 2. GFRAL is not TGFβ RII (Acc. Nos.: NM_001024847.2; NM_003242.5) or orthologs thereof. GFRAL is distinct from TGFβ RI (Acc. Nos.: NP_001124388.1; NP_004603.1) or orthologs thereof. In certain embodiments, GFRAL may be a protein having the amino acid sequence that is at least 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 1. Such exemplary GFRAL proteins include chimpanzee (99%), cynomolgus monkey (92%), giant panda (82%), dog (81%), cat (80%), pig (77%), bovine (75%), mouse (70%), rat (70%), Chinese hamster (65%), and platypus (59%), as shown in FIG. 25

    [0110] A GFRAL protein or GFRAL also refers to proteins that have one or more alteration in the amino acid residues (e.g., at locations that are not conserved across variants and/or species) while retaining the conserved domains and having a biological activity similar to the naturally-occurring GFRAL. GFRAL may be encoded by nucleic acid sequences that vary in one or more bases from a naturally-occurring DNA sequence but still translate into an amino acid sequence that corresponds to the a naturally-occurring protein due to degeneracy of the genetic code. GFRAL may also refer to those proteins that differ from the naturally-occurring sequences of GFRAL by one or more conservative substitutions and/or tags and/or conjugates.

    [0111] Proteins of the present disclosure contain a contiguous amino acid residues of any length derived from GFRAL. A sufficient length of contiguous amino acid residues may vary depending on the specific naturally-occurring amino acid sequence from which the protein is derived. For example, the protein may be at least 100 amino acids to 150 amino acid residues in length, at least 150 amino acids to 200 amino acid residues in length, or at least 220 amino acids up to the full-length protein (e.g., 250 amino acids, 300 amino acids, 319 amino acids, 333 amino acids, 376 amino acids).

    [0112] A protein containing an amino acid sequence that is substantially similar to the amino acid sequence of a GFRAL polypeptide includes a polypeptide comprising an amino acid sequence having at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, or at least about 99%, amino acid sequence identity to a contiguous stretch of from about 100 amino acids (aa) to about 150 aa, from about 150 aa to about 200 aa, from about 200 aa to about 250 aa, from about 250 aa to about 300, or from about 300 aa up to the full length of a naturally occurring GFRAL polypeptide. For example, a GFRAL polypeptide of the subject compositions and methods can comprise an amino acid sequence having at least about 71%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, or at least about 99%, amino acid sequence identity to a contiguous stretch of from about 100 amino acids (aa) to about 150 aa, from about 150 aa to about 200 aa, from about 200 aa to about 250 aa, from about 250 aa to about 300, or from about 300 aa up to about 350 aa, from about 350 aa to about full length, of the GFRAL polypeptide amino acid sequence depicted in FIGS. 2A-2D.

    [0113] The protein may lack at least 5, at least 10, up to at least 50 or more aa relative to a naturally-occurring full-length GFRAL polypeptide. For example, the protein may not contain the signal sequence based on the amino acid sequence of a naturally-occurring GFRAL polypeptide. The protein may also contain the same or similar post-translational modifications as a naturally-occurring GFRAL polypeptide or may not contain a post-translational modification. For example, the protein may have the same or similar glycosylation pattern as those of a naturally-occurring GFRAL polypeptide or may contain no glycosylation. In other embodiments, the GFRL protein may include mutations relative to the sequence of naturally-occurring GFRAL protein that introduce a glycosylation site at a location not present in the naturally-occurring GFRAL protein.

    [0114] Many DNA and protein sequences of GFRAL are known in the art and certain sequences are discussed later below. Certain GFRAL protein sequences are depicted in FIGS. 2A-2E. FIG. 2E shows an alignment of the GFRAL sequences shown in FIGS. 2A-2D.

    [0115] In certain embodiments, GFRAL may be expressed by a recombinant cell genetically modified to express a GFRAL protein on its cell surface. The cell may be present in a composition that includes an isolated GDF15 protein. In certain cases, the cell may additionally express RET—for example the cell may express RET endogenously without being genetically modified to include an exogenous sequence encoding RET. In other embodiments, the cell may not express detectable levels of RET and may be genetically modified to express RET from an exogenous sequence.

    [0116] Also disclosed herein are fragments of GFRAL, such as GFRAL fragments that lack an intracellular domain present in native GFRAL, or the intracellular domain and the transmembrane domain present in native GFRAL, such as the native GFRAL depicted in FIGS. 2A-2D. As noted above, a fragment of GFRAL may also lack a signal sequence present in the native GFRAL and may or may not include a heterologous signal sequence. The fragment may lack the intracellular domain present in native GFRAL but include the transmembrane domain.

    [0117] In certain embodiments, an isolated GFRAL-extracellular domain (GFRAL-ECD) polypeptide is provided. The GFRAL-ECD may be bound to a ligand such as GDF15 when present in the isolated protein complex of the present disclosure. The term “GFRAL-extracellular domain” (“GFRAL-ECD”) includes full-length GFRAL ECDs, GFRAL ECD fragments, and GFRAL ECD variants. As used herein, the term “GFRAL ECD” refers to a GFRAL polypeptide with or without a signal peptide that lacks the intracellular and transmembrane domains. In some embodiments, the GFRAL ECD refers to a protein having the amino acid sequence that is at least 70% identical to the amino acid sequence of human full-length GFRAL ECD having the amino acid sequence:

    TABLE-US-00004 (SEQ ID NO: 2) qtnnctylreqclrdangckhawrvmedacndsdpgdpckmrnssycnls iqylvesnfqfkeclctddfyctvnkllgkkcinksdnvkedkfkwnltt rshhgfkgmwsclevaeacvgdvvcnaqlasylkacsangnpcdlkqcqa airffyqnipfniaqmlafcdcaqsdipcqqskealhsktcavnmvpppt clsvirscqndelcrrhyrtfqskcwqrvtrkchedencistlskqdltc sgsddckaayidilgtvlqvqctcrtitqseeslckifqhmlhrkscfny ptlsnvkgmalytrkhankitltgfhspfnge

    [0118] The term “full-length GFRAL ECD”, as used herein, refers to a GFRAL ECD that extends to the last amino acid of the extracellular domain, and may or may not include an N-terminal signal peptide. However, it is noted that “full-length GFRAL ECD” also encompasses GFRAL-ECD that are extended by 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids on the C-terminus to include amino acids residues of the transmembrane domain provided that the polypeptide is soluble. In other words, the GFRAL ECD lacks a sufficient length of a transmembrane domain such that it is not anchored into a cell membrane. The phrase “full-length GFRAL ECD” also encompasses GFRAL-ECD that are extended by 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids on the N-terminus to include amino acids residues of the signal peptide. In certain embodiments, GFRAL ECD fragment refers to a contiguous amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or more identical to a contiguous amino acid sequence depicted in FIGS. 2A-2D and lacks at least 30, 33, 35, 40, 45, 50, or 55 amino acids or more at the C-terminus of the GFRAL sequences depicted in FIGS. 2A-2D.

    [0119] GFRAL ECD is not ECD of TGFβ RII (Acc. Nos.: NM_001024847.2; NM_003242.5) or orthologs thereof. GFRAL ECD is distinct from ECD of TGFβ RI (Acc. Nos.: NP_001124388.1. NP_004603.1) or orthologs thereof. In certain embodiments, GFRAL ECD may be a protein having the amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 2.

    [0120] As used herein, the term “GFRAL ECD fragment” refers to a GFRAL ECD having one or more residues deleted from the N and/or C terminus of the full-length ECD and that retains the ability to bind to GDF15. In some instances, the GFRAL ECD fragment may or may not include an N-terminal signal peptide. In some instances, the GFRAL ECD fragment is a human GFRAL ECD fragment that lacks 1, 5, 10, 15, 16, 17, 18, or 19 residues present at the N-terminus of the sequence:

    TABLE-US-00005 (SEQ ID NO: 4) mivfiflamglsleneytsqtnnctylreqclrdangckhawrvmedacn dsdpgdpckmrnssycnlsiqylvesnfqfkeclctddfyctvnkllgkk cinksdnvkedkfkwnlttrshhgfkgmwsclevaeacvgdvvcnaqlas ylkacsangnpcdlkqcqaairffyqnipfniaqmlafcdcaqsdipcqq skealhsktcavnmvppptclsvirscqndelcrrhyrtfqskcwqrvtr kchedencistlskqdltcsgsddckaayidilgtvlqvqctcrtitqse eslckifqhmlhrkscfnyptlsnvkgmalytrkhankitltgfhspfng e

    [0121] Another exemplary GFRAL ECD fragment comprises the following amino acid sequence, which corresponds to Q20 to C316 of a full-length human precursor GFRAL protein:

    TABLE-US-00006 (SEQ ID NO: 22) qtnnctylreqclrdangckhawrvmedacndsdpgdpckmrnssycnls iqylvesnfqfkeclctddfyctvnkllgkkcinksdnvkedkfkwnltt rshhgfkgmwsclevaeacvgdvvcnaqlasylkacsangnpcdlkqcqa airffyqnipfniaqmlafcdcaqsdipcqqskealhsktcavnmvpppt clsvirscqndelcrrhyrtfqskcwqrvtrkchedencistlskqdltc sgsddckaayidilgtvlqvqctcrtitqseeslckifqhmlhrksc

    [0122] Yet another exemplary GFRAL ECD fragment comprises the following amino acid sequence, which corresponds to W115 to E351 of a full-length human precursor GFRAL protein:

    TABLE-US-00007 (SEQ ID NO: 23) wnlttrshhgfkgmwsclevaeacvgdvvcnaqlasylkacsangnpcdl kqcqaairffyqnipfniaqmlafcdcaqsdipcqqskealhsktcavnm vppptclsvirscqndelcrrhyrtfqskcwqrvtrkchedencistlsk qdltcsgsddckaayidilgtvlqvqctcrtitqseeslckifqhmlhrk scfnyptlsnvkgmalytrkhankitltgfhspfnge.

    [0123] The above exemplary GFRAL ECD fragment was used in the methods described in the Examples to produce a crystal of a complex comprising a GFRAL protein and a GDF15 protein.

    [0124] Within the GFRAL ECD there are three separate domains—domain 1 (D1), domain 2 (D2) and domain 3 (D3). In some embodiments, the amino acid sequence demarcating D1 of the GFRAL ECD are residues Q20 to S130 of SEQ ID NO: 9. In some embodiments, the amino acid sequence demarcating D2 of the GFRAL ECD are residues C131 to C210 of SEQ ID NO: 9. In some embodiments, the amino acid sequence demarcating D3 of the GFRAL ECD are residues C220 to C316. Certain properties of GFRAL can be attributed to the activity and/or binding of these domains within the ECD. For example, as described herein, amino acid residues within D2 of the GFRAL ECD are identified as being core interaction interface amino acids and/or boundary interaction interface amino acids for GFRAL binding to GDF15. Likewise, as described herein, amino acid residues within D3 of the GFRAL ECD are identified as being core interaction interface amino acids and/or boundary interaction interface amino acids for GFRAL binding to RET.

    [0125] The term “core interaction interface amino acid” or grammatical equivalent thereof refers to an amino acid residue of a given protein that has at least one atom within less or equal to 4.5 Å from an interacting protein (e.g., an amino acid on GFRAL that interacts with GDF15 or RET). A distance of 4.5 Å allows for atoms within a van der Waals radius plus a possible water-mediated hydrogen bond to form a bond with the interacting protein.

    [0126] The term “boundary interaction interface amino acid” or grammatical equivalent thereof refers to an amino acid residue of a given protein that has at least one atom within less than or equal to 5 Å from a core interface amino acid on the given protein (e.g., an amino acid on GFRAL that is within 5 Å of a core interaction interface amino acid on GFRAL that interacts with GDF15 or RET). A distance of less than or equal to 5 Å allows proteins binding to residues less than 5 Å away from core interaction interface amino acids on a given protein to be within the van der Waals radius of an interacting protein.

    [0127] As used herein, the term “GFRAL ECD variants” refers to GFRAL ECDs that contain amino acid additions, deletions, or substitutions and that remain capable of binding to GDF15. Such variants may be at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, or 99% identical to the parent GFRAL ECD. The % identity of two polypeptides can be measured by a similarity score determined by comparing the amino acid sequences of the two polypeptides using an algorithm, such as, the Bestfit program with the default settings for determining similarity. Bestfit uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981) to find the best segment of similarity between two sequences.

    [0128] In certain embodiments, the GFRAL-ECD may include a soluble polypeptide that includes a contiguous amino acid sequence about 100-340 residues in length (for example, 100, 150, 200, 250, 300, 310, 320, 330, 333, or 335 residues long), that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the human soluble GFRAL-ECD:

    TABLE-US-00008 (SEQ ID NO: 5) qtnnctylreqclrdangckhawrvmedacndsdpgdpckmrnssycnls iqylvesnfqfkeclctddfyctvnkllgkkcinksdnvkedkfkwnltt rshhgfkgmwsclevaeacvgdvvcnaqlasylkacsangnpcdlkqcqa airffyqnipfniaqmlafcdcaqsdipcqqskealhsktcavnmvpppt clsvirscqndelcrrhyrtfqskcwqrvtrkchedencistlskqdltc sgsddckaayidilgtvlqvqctcrtitqseeslckifqhmlhrkscfny ptlsnvkgmalytrkhankitltgfhspfnge

    [0129] In certain embodiments, a soluble GFRAL-ECD may be about 325, 329, 330, 331, 332, 335, 340 amino acids long and may be at least 75%, 80%, 85%, 90%, 95% or 99% identical to the human soluble GFRAL-ECD, mouse soluble GFRAL-ECD, or rat soluble GFRAL-ECD.

    [0130] In certain cases, the GFRAL-extracellular domain may be expressed on the surface of a cell genetically modified to express the GFRAL-ECD with a transmembrane domain. In certain cases, the soluble GFRAL-ECD may be immobilized on a support. As noted herein, the polypeptides of the present disclosure may be fusion proteins that include the polypeptide conjugated to a heterologous protein sequence.

    [0131] Suitable supports may have a variety of forms and compositions and may derive from naturally occurring materials, naturally occurring materials that have been synthetically modified, or synthetic materials. Examples of suitable materials include, but are not limited to, nitrocellulose, glasses, silicas, teflons, and metals (for example, gold, platinum, and the like). Suitable materials also include polymeric materials, including plastics (for example, polytetrafluoroethylene, polypropylene, polystyrene, polycarbonate, and blends thereof, and the like), polysaccharides such as agarose (e.g., that available commercially as Sepharose®, from Pharmacia) and dextran (e.g., those available commercially under the tradenames Sephadex® and Sephacyl®, also from Pharmacia), polyacrylamides, polystyrenes, polyvinyl alcohols, copolymers of hydroxyethyl methacrylate and methyl methacrylate, and the like.

    [0132] Also contemplated herein is a composition that includes a RET protein and a GDF15 protein. In certain cases, such a composition may further include GFRAL. In certain cases, RET may be attached to a support or expressed on cell surface of a recombinant cell genetically modified to express RET. In certain cases, the composition may include a recombinant cell genetically modified to express RET; GDF15; and a carrier, such as a pharmaceutically acceptable carrier.

    [0133] In certain embodiments, a composition may include GFRAL and RET. In certain cases, the composition may include a recombinant cell genetically modified to express RET and GFRAL; and a carrier, such as a pharmaceutically acceptable carrier.

    [0134] In certain cases, the composition may include a recombinant cell genetically modified to express RET and GFRAL; GDF15; a carrier, such as a pharmaceutically acceptable carrier.

    [0135] As used herein, “Ret” or “RET” refers to a protein having the amino acid sequence that is at least 75% identical, e.g., 77%, 79%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identical to the amino acid sequence of SEQ ID NO: 3. RET is distinct from TGFβ RI and TGFβ RII. SEQ ID NO: 3 is the sequence of mature human RET9 that lacks a signal peptide:

    TABLE-US-00009 (SEQ ID NO: 3) KVALGLYFSRDAYWEKLYVDQAAGTPLLYVHALRDAPEEVPSFRLGQHL YGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLTVY LKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRP SFRIRENRPPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLE VSTRWALDREQREKYELVAVCTVHAGAREEVVMVPFPVTVYDEDDSAPTF PAGVDTASAVVEFKRKEDTVVATLRVFDADVVPASGELVRRYTSTLLPGD TWAQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNRNLSISENRTMQL AVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQI GKVCVENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKA LRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVS KRRLECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDV VETQDINICPQDCLRGSIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEP EDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHCYHKFAHKPPISSA EMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKILEDPKWEFPRK NLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDL LSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKV GPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVH RDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIES LFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMER PDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAAST PSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGRISHAFTRF

    [0136] The amino acid sequence of a full-length precursor human RET protein is provided below, which includes a signal peptide sequence (underlined and lowercase residues):

    TABLE-US-00010 (SEQ ID NO: 26) makatsgaaglrlllllllpllgKVALGLYFSRDAYWEKLYVDQAAGTPL LYVHALRDAPEEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRS LDHSSWEKLSVRNRGFPLLTVYLKVFLSPTSLREGECQWPGCARVYFSFF NTSFPACSSLKPRELCFPETRPSFRIRENRPPGTFHQFRLLPVQFLCPNI SVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELVAVCTVHAGAR EEVVMVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTVVATLRVFD ADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVRAT VHDYRLVLNRNLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPV SLHLPSTYSLSVSRRARRFAQIGKVCVENCQAFSGINVQYKLHSSGANCS TLGVVTSAEDTSGILFVNDTKALRRPKCAELHYMVVATDQQTSRQAQAQL LVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGLGSPTGRCEWRQGDGKG ITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPR GIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSV LLSAFCIHCYHKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSM ENQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRA GYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPL LLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGD LISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVY EEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGN PYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFAD ISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPR ALPSTWIENKLYGRISHAFTRF

    [0137] Accordingly, “RET” as used herein encompasses human RET and variants thereof, including but not limited to orthologs thereof, such as murine RET, cyno RET, and the like. Such sequences of RET are depicted in FIG. 3. In certain embodiments, RET may be a protein having the amino acid sequence that is at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 3.

    [0138] In certain embodiments, an isolated RET-extracellular domain (RET-ECD) polypeptide is provided. The RET-ECD may be bound to a ligand such as GFRAL when present in the isolated protein complex of the present disclosure. The term “RET-extracellular domain” (“RET-ECD”) includes full-length RET ECDs, RET ECD fragments, and RET ECD variants. As used herein, the term “RET ECD” refers to a RET polypeptide with or without a signal peptide that lacks the intracellular and transmembrane domains. In some embodiments, the RET ECD refers to a protein having the amino acid sequence that is at least 75% identical to the amino acid sequence of human full-length RET ECD having the amino acid sequence:

    TABLE-US-00011 (SEQ ID NO: 27) KVALGLYFSRDAYWEKLYVDQAAGTPLLYVHALRDAPEEVPSFRLGQHL YGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLTVY LKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRP SFRIRENRPPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLE VSTRWALDREQREKYELVAVCTVHAGAREEVVMVPFPVTVYDEDDSAPTF PAGVDTASAVVEFKRKEDTVVATLRVFDADVVPASGELVRRYTSTLLPGD TWAQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNRNLSISENRTMQL AVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQI GKVCVENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKA LRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVS KRRLECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDV VETQDINICPQDCLRGSIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEP EDIQDPLCDELCR

    [0139] In another exemplary embodiment, the RET ECD refers to a protein having the amino acid sequence that is at least 75% identical to the amino acid sequence of human full-length RET ECD having the amino acid sequence:

    TABLE-US-00012 (SEQ ID NO: 28) LYFSRDAYWEKLYVDQAAGTPLLYVHALRDAPEEVPSFRLGQHLYGTY RTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLTVYLKVF LSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRI RENRPPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTR WALDREQREKYELVAVCTVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGV DTASAVVEFKRKEDTVVATLRVFDADVVPASGELVRRYTSTLLPGDTWAQ QTFRVEHWPNETSVQANGSFVRATVHDYRLVLNRNLSISENRTMQLAVLV NDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVC VENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRP KCAELHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRL ECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQ DINICPQDCLRGSIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPEDIQ DPLCDELCR

    [0140] The term “full-length RET ECD”, as used herein, refers to a RET ECD that extends to the last amino acid of the extracellular domain, and may or may not include an N-terminal signal peptide. However, it is noted that “full-length RET ECD” also encompasses RET-ECD that are extended by 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids on the C-terminus to include amino acids residues of the transmembrane domain provided that the polypeptide is soluble. In other words, the RET ECD lacks a sufficient length of a transmembrane domain such that it is not anchored into a cell membrane. The phrase “full-length RET ECD” also encompasses RET-ECD that are extended by 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids on the N-terminus to include amino acids residues of the signal peptide. In certain embodiments, RET ECD fragment refers to a contiguous amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identical to a contiguous amino acid sequence depicted in FIGS. 3A-3H and lacks at least 30, 33, 35, 40, 45, 50, or 55 amino acids or more at the C-terminus of the RET sequences depicted in FIGS. 3A-3H.

    [0141] As used herein, the term “RET ECD fragment” refers to a RET ECD having one or more residues deleted from the N and/or C terminus of the full-length ECD and that retains the ability to bind to GFRAL. In some instances, the RET ECD fragment may or may not include an N-terminal signal peptide. In some instances, the RET ECD fragment is a human RET ECD fragment that lacks 1, 5, 10, 15, 16, 17, 18, or 19 residues present at the N-terminus of the sequence:

    TABLE-US-00013 (SEQ ID NO: 29) LYFSRDAYWEKLYVDQAAGTPLLYVHALRDAPEEVPSFRLGQHLYGTY RTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLTVYLKVF LSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRI RENRPPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTR WALDREQREKYELVAVCTVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGV DTASAVVEFKRKEDTVVATLRVFDADVVPASGELVRRYTSTLLPGDTWAQ QTFRVEHWPNETSVQANGSFVRATVHDYRLVLNRNLSISENRTMQLAVLV NDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFAQIGKVC VENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRP KCAELHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRL ECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQ DINICPQDCLRGSIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPEDIQ DPLCDELCR

    [0142] The above exemplary RET ECD fragment was used in the methods described in the Examples to produce a model of a complex comprising a RET protein, a GFRAL protein and a GDF15 protein.

    [0143] In alternative embodiments of a RET ECD, the RET-ECD comprises a C64R, N75Q, N166Q, or C183S mutation in a RET ECD sequence of SEQ ID NO 27.

    [0144] The proteins described in the method of the present disclosure include those containing contiguous amino acid sequences of any naturally-occurring GFRAL, as well as those having 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more usually no more than 40, 30, 20, 10, or 5 amino acid substitutions, where the substitution is usually a conservative amino acid substitution. The phrase “conservative amino acid substitution” generally refers to substitution of amino acid residues within the following groups:

    [0145] 1) L, I, M, V, F;

    [0146] 2) R, K;

    [0147] 3) F, Y, H, W, R;

    [0148] 4) G, A, T, S;

    [0149] 5) Q, N; and

    [0150] 6) D, E.

    [0151] Conservative amino acid substitutions in the context of a peptide or a protein disclosed herein are selected so as to preserve putative activity of the protein. Such presentation may be preserved by substituting with an amino acid having a side chain of similar acidity, basicity, charge, polarity, or size to the side chain of the amino acid being replaced. Guidance for substitutions, insertion, and deletion may be based on alignments of amino acid sequences of different variant proteins or proteins from different species. Residues that are semi-conserved (. or :) may tolerate changes that preserve charge, polarity, and/or size. See FIG. 2E for example.

    [0152] The present disclosure provides any of the polypeptides described above. The protein may be isolated from a natural source, e.g., is in an environment other than its naturally-occurring environment. The subject protein may also be recombinantly made, e.g., in a genetically modified host cell (e.g., bacteria; yeast; insect; mammalian-murine, human cells; and the like), where the genetically modified host cell is genetically modified with a nucleic acid comprising a nucleotide sequence encoding the subject protein. The subject protein encompasses synthetic polypeptides, e.g., a subject synthetic polypeptide is synthesized chemically in a laboratory (e.g., by cell-free in vitro synthesis or chemical synthesis). Methods of productions are described in more detail below.

    Nucleic Acid and Protein Sequences

    [0153] The subject polypeptide may be generated using recombinant techniques to manipulate nucleic acids of different GFRAL, RET, or GDF15 proteins to provide constructs encoding a protein of interest. It will be appreciated that, provided an amino acid sequence, the ordinarily skilled artisan will immediately recognize a variety of different nucleic acids encoding such amino acid sequence in view of the knowledge of the genetic code.

    [0154] For production of subject proteins derived from naturally-occurring polypeptides, it is noted that nucleic acids encoding a variety of different polypeptides are known and available in the art. Nucleic acid (and amino acid sequences) for various GFRAL, RET, and GDF15 polypeptides are also provided as accession nos. GFRAL: i) Homo sapiens: amino acid sequence NP_997293.2; nucleotide sequence: NM_207410.2; ii) Mus musculus: amino acid sequence NP_995316.2; nucleotide sequence NM_205844; iii) Rattus norvegicus: amino acid sequence: NP_001178927.1; nucleotide sequence: NM_001191998.1; iv) Macaca fascicularis: amino acid sequence: G7P2W4; v) Gallus gallus: amino acid sequence XP_419904.4; nucleotide sequence XM_419904.4. RET: i) Homo sapiens RET51: amino acid sequence: NP_066124.1; nucleotide sequence: NM_020975.4; ii) Homo sapiens RET9: amino acid sequence: NP_065681.1; nucleotide sequence: NM_020630.4; iii) Mus musculus RET51: amino acid sequence: P35546; nucleotide sequence: NM_001080780.1; iv) Mus musculus RET9: amino acid sequence: P35546-2; nucleotide sequence: NM_001080780.1; v) Rattus norvegicus RET51: amino acid sequence: NP_036775.2 nucleotide sequence: NM_012643.2; vi) Rattus norvegicus RET9: amino acid sequence: NP_001103569.1; nucleotide sequence: NM_001110099.1; vii) Macaca fascicularis RET51: amino acid sequence: XP_005565094.1; nucleotide sequence: XM_005565037.1; viii) Macaca fascicularis RET9: amino acid sequence: XP_005565095.1; nucleotide sequence: XM_005565038.1. Exemplary GFRAL and RET amino acid sequences are depicted in FIGS. 2 and 3, respectively.

    [0155] “Growth differentiation factor 15” or “GDF15,” also known in the art as MIC-1 (macrophage inhibitory cytokine-1), PDF (prostate differentiation factor), PLAB (placental bone morphogenetic protein), NAG-1 (non-steroidal anti-inflammatory drugs (NSAIDs) activated gene), TGF-PL, and PTGFB, is a member of the transforming growth factor β (TGF-β) super-family. GDF15, which is synthesized as a 62 kDa intracellular precursor protein that is subsequently cleaved by a furin-like protease, is secreted as a 25 kDa disulfide-linked protein (see, e.g., Fairlie et al., J. Leukoc. Biol 65:2-5 (1999)). GDF15 mRNA is seen in several tissues, including liver, kidney, pancreas, colon and placenta, and GDF15 expression in liver can be significantly up-regulated during injury of organs such as the liver, kidneys, heart and lungs.

    [0156] The GDF15 precursor is a 308 amino acid polypeptide (NCBI Ref. Seq. NP_004855.2; GI:153792495) containing a 29 amino acid signal peptide, a 167 amino acid pro-domain, and a mature domain of 112 amino acids which is excised from the pro-domain by furin-like proteases.

    [0157] An amino acid sequence of a precursor human GDF15 polypeptide is provided below:

    TABLE-US-00014 (SEQ ID NO: 25) MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHS EDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGS GGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLS LARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRA RARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIG ACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTG VSLQTYDDLLAKDCHCI

    [0158] The 308-amino acid GDF15 polypeptide is referred to as a “full-length” GDF15 polypeptide; a 112-amino acid GDF15 polypeptide (amino acids 197-308 of “full-length” GDF15) is a “mature” GDF15 polypeptide.

    [0159] “GDF15” as used herein includes a protein having the amino acid sequence that is at least 65% identical to the amino acid sequence of SEQ ID NO: 6. An amino acid sequence of a mature human GDF15 polypeptide is provided below:

    TABLE-US-00015 (SEQ ID NO: 6) ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGA CPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGV SLQTYDDLLAKDCHCI

    [0160] The above exemplary mature human GDF15 was used in the methods described in the Examples to produce a crystal of a complex comprising a GFRAL protein and a GDF15 protein.

    [0161] Unless otherwise indicated, the term “GDF15” refers to the 112 amino acid mature human sequence. In addition, numerical references to particular GDF15 residues refer to the 112 amino acid mature sequence (i.e., residue 1 is Ala (A), and residue 112 is Ile (I); see SEQ ID NO: 6). Of note, while the GDF15 precursor amino acid sequence predicts three excision sites, resulting in three putative forms of “mature” human GDF15 (i.e., 110, 112 and 115 amino acids), the 112 amino acid mature sequence is accepted as being correct.

    [0162] In some embodiments, a GDF15 protein is a homodimer (e.g., comprising two polypeptide chains each of SEQ ID NO: 6).

    [0163] The GDF15 precursor is a 308 amino acid polypeptide (NCBI Ref. Seq. NP_004855.2) containing a 29 amino acid signal peptide, a 167 amino acid pro-domain, and a mature domain of 112 amino acids which is excised from the pro-domain by furin-like proteases. A 308-amino acid GDF15 polypeptide is referred to as a “full-length” GDF15 polypeptide; a 112-amino acid GDF15 polypeptide (see FIG. 1A) is a “mature” GDF15 polypeptide. Unless otherwise indicated, the term “GDF15” refers to the 112 amino acid mature sequence. In addition, numerical references to particular GDF15 residues refer to the 112 amino acid mature sequence (i.e., residue 1 is Ala (A), and residue 112 is Ile (I); see FIG. 1A).

    [0164] The scope of the present disclosure includes GDF15 orthologs, and modified forms thereof, from other mammalian species, and their use, including mouse (NP_035949), chimpanzee (XP_524157), orangutan (XP_002828972), Rhesus monkey (EHH29815), giant panda (XP_002912774), gibbon (XP_003275874), guinea pig (XP_003465238), ferret (AER98997), cow (NP_001193227), pig (NP_001167527) and dog (XP_541938). Such exemplary GDF15 proteins are shown in FIG. 26, which includes an alignment of the various exemplary GDF15 proteins. The mature form of human GDF15 has approximately 67% amino acid identity to the murine ortholog.

    [0165] It will be appreciated that the nucleotide sequences encoding the protein may be modified so as to optimize the codon usage to facilitate expression in a host cell of interest (e.g., Escherichia coli, and the like). Methods for production of codon optimized sequences are known in the art.

    Protein Modifications

    [0166] The proteins used in the present disclosure can be provided as proteins that are modified relative to the naturally-occurring protein. Purposes of the modifications may be to increase a property desirable in a protein formulated for therapy (e.g., serum half-life), to raise antibody for use in detection assays, and/or for protein purification, and the like.

    [0167] One way to modify a subject protein is to conjugate (e.g., link) one or more additional elements at the N- and/or C-terminus of the protein, such as another protein (e.g., having an amino acid sequence heterologous to the subject protein) and/or a carrier molecule. Thus, an exemplary protein can be provided as fusion proteins with a polypeptide(s) derived from an immunoglobulin Fc polypeptide.

    [0168] Conjugate modifications to proteins may result in a protein that retains the desired activity, while exploiting properties of the second molecule of the conjugate to impart and/or enhances certain properties (e.g., desirable for therapeutic uses). For example, the polypeptide may be conjugated to a molecule, e.g., to facilitate solubility, storage, half-life, reduction in immunogenicity, controlled release in tissue or other bodily location (e.g., blood or other particular organs, etc.).

    [0169] Other features of a conjugated protein may include one where the conjugate reduces toxicity relative to an unconjugated protein. Another feature is that the conjugate may target a type of cell or organ more efficiently than an unconjugated material. The protein can optionally have attached a drug to further counter the causes or effects associated with disorders of metabolism (e.g., drug for muscle atrophy), and/or can optionally be modified to provide for improved pharmacokinetic profile (e.g., by PEGylation, hyperglycosylation, and the like).

    [0170] Where a subject protein is a fusion protein comprising a GFRAL or GDF15 or RET polypeptide and a heterologous fusion partner polypeptide, a subject fusion protein can have a total length that is equal to the sum of the GFRAL or GDF15 or RET polypeptide and the heterologous fusion partner polypeptide and a linker, if present. Exemplary GDF15 fusion proteins are shown in FIG. 1B (Fc fusion) and FIG. 1C (human serum albumin fusion).

    [0171] Any of the foregoing components and molecules used to modify the polypeptide sequences of the present disclosure may optionally be conjugated via a linker. Suitable linkers include “flexible linkers” which are generally of sufficient length to permit some movement between the modified polypeptide sequences and the linked components and molecules. The linker molecules can be about 6-50 atoms long. The linker molecules may also be, for example, aryl acetylene, ethylene glycol oligomers containing 2-10 monomer units, diamines, diacids, amino acids, or combinations thereof. Suitable linkers can be readily selected and can be of any suitable length, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 10-20, 20-30, 30-50 amino acids.

    [0172] Exemplary flexible linkers include glycine polymers (G).sub.n, glycine-alanine polymers, alanine-serine polymers, glycine-serine polymers (for example, (G.sub.mS.sub.o).sub.n, (GSGGS), (SEQ ID NO: 52), (G.sub.mS.sub.oG.sub.m).sub.n, (G.sub.mS.sub.oG.sub.mS.sub.oG.sub.m).sub.n (SEQ ID NO: 53), (GSGGS.sub.m).sub.n (SEQ ID NO: 54), (GSGS.sub.mG).sub.n (SEQ ID NO: 55) and (GGGS.sub.m).sub.n (SEQ ID NO: 56), and combinations thereof, where m, n, and o are each independently selected from an integer of at least 1 to 20, e.g., 1-18, 2-16, 3-14, 4-12, 5-10, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10), and other flexible linkers. Glycine and glycine-serine polymers are relatively unstructured, and therefore may serve as a neutral tether between components. Exemplary flexible linkers include, but are not limited to GGSG (SEQ ID NO: 57), GGSGG (SEQ ID NO: 58), GSGSG (SEQ ID NO: 59), GSGGG (SEQ ID NO: 60), GGGSG (SEQ ID NO: 61), and GSSSG (SEQ ID NO: 62).

    [0173] Additional flexible linkers include glycine polymers (G).sub.n or glycine-serine polymers (e.g., (GS).sub.n, (GSGGS).sub.n (SEQ ID NO: 63), (GGGS).sub.n (SEQ ID NO: 64) and (GGGGS).sub.n (SEQ ID NO: 65), where n=1 to 50, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 10-20, 20-30, 30-50. Exemplary flexible linkers include, but are not limited to GGGS (SEQ ID NO: 66), GGGGS (SEQ ID NO: 67), GGSG (SEQ ID NO: 57), GGSGG (SEQ ID NO: 58), GSGSG (SEQ ID NO: 59), GSGGG (SEQ ID NO: 60), GGGSG (SEQ ID NO: 61), and GSSSG (SEQ ID NO: 62). A multimer (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 10-20, 20-30, or 30-50) of these linker sequences may be linked together to provide flexible linkers that may be used to conjugate a heterologous amino acid sequence to the polypeptides disclosed herein. As described herein, the heterologous amino acid sequence may be a signal sequence and/or a fusion partner, such as, albumin, Fc sequence, and the like.

    Methods of Production

    [0174] The proteins of the present disclosure can be produced by any suitable method, including recombinant and non-recombinant methods (e.g., chemical synthesis). Where a polypeptide is chemically synthesized, the synthesis may proceed via liquid-phase or solid-phase. Solid-phase synthesis (SPPS) allows the incorporation of unnatural amino acids and/or peptide/protein backbone modification. Various forms of SPPS, such as Fmoc and Boc, are available for synthesizing peptides of the present disclosure. Details of the chemical synthesis are known in the art (e.g., Ganesan A. 2006 Mini Rev. Med Chem. 6:3-10 and Camarero J A et al. 2005 Protein Pept Lett. 12:723-8). Briefly, small insoluble, porous beads are treated with functional units on which peptide chains are built. After repeated cycling of coupling/deprotection, the free N-terminal amine of a solid-phase attached is coupled to a single N-protected amino acid unit. This unit is then deprotected, revealing a new N-terminal amine to which a further amino acid may be attached. The peptide remains immobilized on the solid-phase and undergoes a filtration process before being cleaved off.

    [0175] Where the protein is produced using recombinant techniques, the proteins may be produced as an intracellular protein or as an secreted protein, using any suitable construct and any suitable host cell, which can be a prokaryotic or eukaryotic cell, such as a bacterial (e.g., E. coli) or a yeast host cell, respectively.

    [0176] Other examples of eukaryotic cells that may be used as host cells include insect cells, mammalian cells, and/or plant cells. Where mammalian host cells are used, the cells may include one or more of the following: human cells (e.g., HeLa, 293, H9 and Jurkat cells); mouse cells (e.g., NIH3T3, L cells, and C127 cells); primate cells (e.g., Cos 1, Cos 7 and CV1) and hamster cells (e.g., Chinese hamster ovary (CHO) cells).

    [0177] A wide range of host-vector systems suitable for the expression of the subject protein may be employed according to standard procedures known in the art. See for example, Sambrook et al. 1989 Current Protocols in Molecular Biology Cold Spring Harbor Press, New York and Ausubel et al. 1995 Current Protocols in Molecular Biology, Eds. Wiley and Sons.

    [0178] Methods for introduction of genetic material into host cells include, for example, transformation, electroporation, conjugation, calcium phosphate methods and the like. The method for transfer can be selected so as to provide for stable expression of the introduced GFRAL and/or RET-encoding nucleic acid. The polypeptide-encoding nucleic acid can be provided as an inheritable episomal element (e.g., plasmid) or can be genomically integrated. A variety of appropriate vectors for use in production of a polypeptide of interest are available commercially.

    [0179] Vectors can provide for extrachromosomal maintenance in a host cell or can provide for integration into the host cell genome. The expression vector provides transcriptional and translational regulatory sequences, and may provide for inducible or constitutive expression, where the coding region is operably linked under the transcriptional control of the transcriptional initiation region, and a transcriptional and translational termination region. In general, the transcriptional and translational regulatory sequences may include, but are not limited to, promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences. Promoters can be either constitutive or inducible, and can be a strong constitutive promoter (e.g., T7, CMV, and the like). In certain embodiments, the proteins of the present disclosure may be expressed from a nucleic acid construct in which a heterologous promoter is operably linked to a nucleic acid sequence encoding the protein.

    [0180] Expression constructs generally have convenient restriction sites located near the promoter sequence to provide for the insertion of nucleic acid sequences encoding proteins of interest. A selectable marker operative in the expression host may be present to facilitate selection of cells containing the vector. In addition, the expression construct may include additional elements. For example, the expression vector may have one or two replication systems, thus allowing it to be maintained in organisms, for example in mammalian or insect cells for expression and in a prokaryotic host for cloning and amplification. In addition the expression construct may contain a selectable marker gene to allow the selection of transformed host cells. Selectable genes are well known in the art and will vary with the host cell used.

    [0181] Isolation and purification of a protein can be accomplished according to methods known in the art. For example, a protein can be isolated from a lysate of cells genetically modified to express the protein constitutively and/or upon induction, or from a synthetic reaction mixture, by immunoaffinity purification, which generally involves contacting the sample with an anti-protein antibody, washing to remove non-specifically bound material, and eluting the specifically bound protein. The isolated protein can be further purified by dialysis and other methods normally employed in protein purification methods. In one embodiment, the protein may be isolated using metal chelate chromatography methods. Protein of the present disclosure may contain modifications to facilitate isolation, as discussed above.

    [0182] The subject proteins may be prepared in substantially pure or isolated form (e.g., free from other polypeptides). The protein can be present in a composition that is enriched for the polypeptide relative to other components that may be present (e.g., other polypeptides or other host cell components). Purified protein may be provided such that the protein is present in a composition that is substantially free of other expressed proteins, e.g., less than 90%, usually less than 60% and more usually less than 50% of the composition is made up of other expressed proteins.

    Recombinant Cells

    [0183] As noted above, a recombinant cell genetically modified to express a GFRAL protein is disclosed. As explained above the GFRAL protein expressed by the cell may be a full length GFRAL protein as depicted in FIGS. 1C-1E or a variant or a fragment thereof. For example, the GFRAL protein may lack an intracellular domain present in native GFRAL and/or may include a heterologous signal sequence. The recombinant cell may endogenously express RET and/or may be genetically modified to express RET.

    [0184] In certain cases, the recombinant cell may include a reporter construct that includes a promoter sequence operably linked to a nucleic acid sequence encoding a reporter, wherein the promoter directs expression of the reporter upon activation of RET by binding of the GDF15 protein to GFRAL.

    [0185] In certain embodiments, the recombinant cell may include a transcriptional activator such as an Elk protein or a functionally active fragment thereof which may be phosphorylated by the activated RET. The phosphorylated Elk can induce transcription of the reporter when bound to the promoter operably linked to the nucleic acid sequence encoding the reporter while Elk that is not phosphorylated is not capable of inducing transcription. The Elk protein may be fused to a DNA binding domain (DBD) of a heterologous protein, e.g., a GAL4DBD which specifically binds to a GAL4 upstream activating sequence (GAL4-UAS). In certain embodiments, the promoter sequence of the reporter construct may include a GAL4-UAS. In certain embodiments, activation of RET by binding of GFRAL to GDF15 may lead to activation of Elk via phosphorylation by activated RET. In certain embodiments, the phosphorylated Elk when bound to the GAL4-UAS via the GAL4DBD may mediate the transcription of the reporter.

    [0186] A number of reporter constructs may be used for detecting RET activation. For example, the reporter sequence may encode a reporter protein that is directly or indirectly detectable. For example, the reporter may be a fluorescent protein, an enzyme, or a protein that may be detected using an antibody.

    [0187] The recombinant cell may include a plasmid or a stably integrated nucleic acid that includes a promoter sequence that directs the expression of an Elk-GAL4 protein. The promoter may be a constitutive or an inducible promoter. In certain embodiments, in absence of RET activation, the Elk-GAL4 protein may not be significantly phosphorylated and may not activate transcription of a reporter operably connected to a GAL4-UAS promoter sequence.

    [0188] A recombinant cell as disclosed herein may be used for identifying an agent that binds to the extracellular domain of GFRAL. In additional embodiments, a recombinant cell that expresses GFRAL and RET may be used to identify agents that bind to GFRAL and lead to activation of RET. In addition, a recombinant cell genetically modified to express GFRAL and RET may be used to identify agents that modulate the binding between GFRAL and RET. Methods for identifying such agents are discussed later below.

    [0189] Also disclosed herein are compositions that include a recombinant cell as described herein and an isolated GDF15 protein. As explained further below, such compositions may be used in screening methods to identify modulators of GFRAL-GDF15 receptor-ligand complex.

    Methods of Screening

    [0190] A method using the isolated protein complex described herein and/or the recombinant cell described herein for identifying agents that bind to an extracellular domain of GFRAL is disclosed.

    [0191] Candidate agents of interest for screening include biologically active agents of numerous chemical classes, primarily organic molecules, although including in some instances, inorganic molecules, organometallic molecules, immunoglobulins, genetic sequences, etc. Also of interest are small organic molecules, which comprise functional groups necessary for structural interaction with proteins, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, frequently at least two of the functional chemical groups. The candidate agents often comprise cyclical carbon or heterocyclic structures and/or aromatic or polyaromatic structures substituted with one or more of the above functional groups. Candidate agents are also found among biomolecules, including peptides, polynucleotides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof.

    [0192] Compounds may be obtained from a wide variety of sources including libraries of synthetic or natural compounds. For example, numerous means are available for random and directed synthesis of a wide variety of organic compounds, including biomolecules, including expression of randomized oligonucleotides and oligopeptides. Alternatively, libraries of natural compounds in the form of bacterial, fungal, plant and animal extracts are available or readily produced. Additionally, natural or synthetically produced libraries and compounds are readily modified through conventional chemical, physical and biochemical means, and may be used to produce combinatorial libraries. Known pharmacological agents may be subjected to directed or random chemical modifications, such as acylation, alkylation, esterification, amidification, etc. to produce structural analogs.

    [0193] A plurality of assays may be run in parallel with different concentrations to obtain a differential response to the various concentrations. As known in the art, determining the effective concentration of an agent typically uses a range of concentrations resulting from 1:10, or other log scale, dilutions. The concentrations may be further refined with a second series of dilutions, if necessary. Typically, one of these concentrations serves as a negative control, i.e. at zero concentration or below the level of detection of the agent.

    [0194] In certain embodiments, a method for identifying agents that bind to an extracellular domain of GFRAL is disclosed. The method may include assaying for binding of a candidate agent to an extracellular domain of GFRAL, where a candidate agent that binds GFRAL is identified as an agent that binds to GFRAL, where binding of the candidate agent is compared to binding of GDF15 to the extracellular domain of GFRAL.

    [0195] In certain cases, a GFRAL or an ECD-containing fragment thereof may be expressed on the surface of a cell. In other cases, a GFRAL or an ECD-containing fragment thereof may be immobilized on a support. In other cases, a cell expressing GFRAL or an ECD-containing fragment thereof expressed on the cell surface may be immobilized on a support. The assay may include contacting the cell and/or the support with a candidate agent and determining whether the candidate agent is bound to the extracellular domain of GFRAL. Any standard technique for determining binding may be utilized. For example, the candidate agents may be labeled and retention of the label to the cell or solid support after washing to remove non-specific binders may indicate that the candidate agent binds to extracellular domain of GFRAL. As noted above, the binding may be compared to the binding of GDF15 under similar conditions, where a candidate agent that binds the extracellular domain of GFRAL with an affinity similar to GDF15 may be identified as a candidate agent.

    [0196] In certain cases, the assay may include contacting a recombinant cell expressing GFRAL on the cell surface with a candidate agent, where the recombinant cell may be genetically modified to express RET. The recombinant cell may also include a reporter construct containing a promoter sequence operably linked to a nucleic acid sequence encoding a reporter, where the promoter directs expression of the reporter upon activation of RET, and where the method includes assaying for expression of the reporter, where increased expression of the reporter as compared to a negative control identifies the agent as an agent that binds to GFRAL and activates RET.

    [0197] In certain cases, the expression of the reporter upon contacting the recombinant cell with a candidate agent may be compared to the expression of the reporter upon the contacting of the recombinant cell with GDF15 in a separate assay, which may be conducted in parallel to the screening method. In certain cases, a candidate agent that induces reporter expression at a level similar to that induced by GDF15 is identified as an agent that binds to GFRAL and activates RET.

    [0198] Also provided herein is a method for identifying agents that modulate binding of GDF15 to GFRAL. In certain embodiments, the method may include contacting a candidate agent with a recombinant cell genetically modified to express GFRAL, where the contacting is in the presence of the GDF15; and assaying a level of binding of GDF15 to GFRAL; wherein a change in the level of binding of GDF15 to GFRAL in the presence of the agent as compared to a level of binding of GDF15 to GFRAL in absence of the agent identifies the agent as a modulator of GDF15 binding to GFRAL.

    [0199] In certain embodiments, GDF15 may be detectably labeled and a decrease in the amount of label bound to the recombinant cell in the presence of a candidate agent may identify it as an agent that competes with GDF15 for binding to GFRAL. In alternate embodiments the candidate agent may be detectably labeled and the assay may include determining binding of the candidate agent to GFRAL in the presence of GDF15, which may be unlabeled.

    [0200] In certain cases, the recombinant cell used in the screening in the presence of GDF15 may be genetically modified to express RET as noted above and include a reporter construct containing a promoter sequence operably linked to a nucleic acid sequence encoding a reporter, where the promoter directs expression of the reporter upon activation of RET, where the assaying comprises assaying for expression of the reporter, where a change in expression of the reporter as compared to the expression in absence of the agent identifies the agent as an agent that modulates binding of GDF15 to GFRAL.

    [0201] In certain cases, the agent may inhibit binding of GDF15 to GFRAL and may be identified as an antagonist of GDF15-GFRAL binding. In other cases, the agent may increase binding of GDF15 to GFRAL and may be identified as an agonist of GDF15-GFRAL binding.

    [0202] In certain embodiments, the agent may compete with GDF15 for binding to GFRAL. In certain cases, the agent when bound to GFRAL may lead to activation of RET and reporter expression.

    [0203] As provided herein is an assay for identifying an agent that modulates the binding between GFRAL and RET. The assay may include contacting a recombinant cell genetically engineered to express GFRAL and RET on the cell surface with a candidate agent and assessing the binding between GFRAL and RET. In certain cases, the binding between GFRAL and RET may be increased or decreased in the presence of the agent as compared to a negative control, which may identify the agent as a modulator of GFRAL and RET binding. Binding between GFRA and RET may be assessed using a standard method for assessing protein-protein binding.

    [0204] Exemplary methods for assessing protein-protein binding include immunoprecipitation, immunostaining, bioluminescence resonance energy transfer (BRET), fluorescence resonance energy transfer (FRET), TR-FRET (time-resolved-FRET) or by HTRF (homogeneous time resolved fluorescence).

    [0205] As noted herein, one of more of the proteins, e.g., GFRAL, RET, and GDF15 may be conjugated to a heterologous sequence such as a tag (e.g., poly-Histidine tag, Glutathione S-transferase (GST) tag, FLAG tag, HA tag, Fc tag, HSA tag, and the like); a fluorescent protein (GFP, YFP, RFP, and the like), bioluminescent protein (e.g., luciferase).

    [0206] In certain embodiments, binding between members of a binding pair (e.g., a pair of proteins or binding of an agent (non-protein agent) to a protein may be assessed using FRET or BRET. For example, one member of a binding pair may be conjugated to a first fluorophore (e.g., CFP) or a bioluminescent protein (e.g., luciferase) and the other member may be conjugated to a second fluorophore (e.g., YFP).

    Compositions

    [0207] The present disclosure provides compositions comprising a subject protein, which may be administered to a subject in need of treatment or prevention of involuntary body weight loss or in need of reduction of GDF15 activity. In certain cases, the composition may include a polypeptide, such as, a GFRAL ECD, a GFRAL ECD fragment, a GFRAL ECD variant as described herein, or a combination thereof.

    [0208] The polypeptides of the present disclosure may be in the form of compositions suitable for administration to a subject. In general, such compositions are “pharmaceutical compositions” comprising one or more polypeptides and one or more pharmaceutically acceptable or physiologically acceptable diluents, carriers or excipients. In certain embodiments, the polypeptides are present in a therapeutically effective amount. The pharmaceutical compositions may be used in the methods of the present disclosure; thus, for example, the pharmaceutical compositions can be administered ex vivo or in vivo to a subject in order to practice the therapeutic and prophylactic methods and uses described herein.

    [0209] The pharmaceutical compositions of the present disclosure can be formulated to be compatible with the intended method or route of administration; exemplary routes of administration are set forth herein. Furthermore, the pharmaceutical compositions may be used in combination with other therapeutically active agents or compounds (e.g., an appetite enhancing agent) in order to treat or prevent the diseases, disorders and conditions as contemplated by the present disclosure.

    [0210] The pharmaceutical compositions typically comprise a therapeutically effective amount of at least one of the polypeptides contemplated by the present disclosure and one or more pharmaceutically and physiologically acceptable formulation agents. Suitable pharmaceutically acceptable or physiologically acceptable diluents, carriers or excipients include, but are not limited to, antioxidants (e.g., ascorbic acid and sodium bisulfate), preservatives (e.g., benzyl alcohol, methyl parabens, ethyl or n-propyl, p-hydroxybenzoate), emulsifying agents, suspending agents, dispersing agents, solvents, fillers, bulking agents, detergents, buffers, vehicles, diluents, and/or adjuvants. For example, a suitable vehicle may be physiological saline solution or citrate buffered saline, possibly supplemented with other materials common in pharmaceutical compositions for parenteral administration. Neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles. Those skilled in the art will readily recognize a variety of buffers that could be used in the pharmaceutical compositions and dosage forms. Typical buffers include, but are not limited to, pharmaceutically acceptable weak acids, weak bases, or mixtures thereof. As an example, the buffer components can be water soluble materials such as phosphoric acid, tartaric acids, lactic acid, succinic acid, citric acid, acetic acid, ascorbic acid, aspartic acid, glutamic acid, and salts thereof. Acceptable buffering agents include, for example, a Tris buffer, N-(2-Hydroxyethyl)piperazine-N′-(2-ethanesulfonic acid) (HEPES), 2-(N-Morpholino)ethanesulfonic acid (MES), 2-(N-Morpholino)ethanesulfonic acid sodium salt (MES), 3-(N-Morpholino)propanesulfonic acid (MOPS), and N-tris[Hydroxymethyl]methyl-3-am inopropanesulfonic acid (TAPS).

    [0211] After a pharmaceutical composition has been formulated, it may be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or dehydrated or lyophilized powder. Such formulations may be stored either in a ready-to-use form, a lyophilized form requiring reconstitution prior to use, a liquid form requiring dilution prior to use, or other acceptable form. In some embodiments, the pharmaceutical composition is provided in a single-use container (e.g., a single-use vial, ampoule, syringe, or autoinjector (similar to, e.g., an EpiPen®)), whereas a multi-use container (e.g., a multi-use vial) is provided in other embodiments. Any drug delivery apparatus may be used to deliver the polypeptides, including implants (e.g., implantable pumps) and catheter systems, both of which are well known to the skilled artisan. Depot injections, which are generally administered subcutaneously or intramuscularly, may also be utilized to release the polypeptides disclosed herein over a defined period of time. Depot injections are usually either solid- or oil-based and generally comprise at least one of the formulation components set forth herein. One of ordinary skill in the art is familiar with possible formulations and uses of depot injections.

    [0212] The pharmaceutical compositions may be in the form of a sterile injectable aqueous or oleagenous suspension. This suspension may be formulated according to the known art using those suitable dispersing or wetting agents and suspending agents mentioned herein. The sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example, as a solution in 1,3-butane diol. Acceptable diluents, solvents and dispersion media that may be employed include water, Ringer's solution, isotonic sodium chloride solution, Cremophor EL™ (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS), ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol), and suitable mixtures thereof. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil may be employed including synthetic mono- or diglycerides. Moreover, fatty acids such as oleic acid find use in the preparation of injectables. Prolonged absorption of particular injectable formulations can be achieved by including an agent that delays absorption (e.g., aluminum monostearate or gelatin).

    [0213] The pharmaceutical compositions containing the active ingredient (e.g., polypeptides of the present disclosure) may be in a form suitable for oral use, for example, as tablets, capsules, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsions, hard or soft capsules, or syrups, solutions, microbeads or elixirs. Pharmaceutical compositions intended for oral use may be prepared according to any method known to the art for the manufacture of pharmaceutical compositions, and such compositions may contain one or more agents such as, for example, sweetening agents, flavoring agents, coloring agents and preserving agents in order to provide pharmaceutically elegant and palatable preparations. Tablets, capsules and the like contain the active ingredient in admixture with non-toxic pharmaceutically acceptable excipients which are suitable for the manufacture of tablets. These excipients may be, for example, diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents, for example, corn starch, or alginic acid; binding agents, for example starch, gelatin or acacia, and lubricating agents, for example magnesium stearate, stearic acid or talc.

    [0214] The tablets, capsules and the like suitable for oral administration may be uncoated or coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action. For example, a time-delay material such as glyceryl monostearate or glyceryl distearate may be employed. They may also be coated by techniques known in the art to form osmotic therapeutic tablets for controlled release. Additional agents include biodegradable or biocompatible particles or a polymeric substance such as polyesters, polyamine acids, hydrogel, polyvinyl pyrrolidone, polyanhydrides, polyglycolic acid, ethylene-vinylacetate, methylcellulose, carboxymethylcellulose, protamine sulfate, or lactide/glycolide copolymers, polylactide/glycolide copolymers, or ethylenevinylacetate copolymers in order to control delivery of an administered composition. For example, the oral agent can be entrapped in microcapsules prepared by coacervation techniques or by interfacial polymerization, by the use of hydroxymethylcellulose or gelatin-microcapsules or poly (methylmethacrolate) microcapsules, respectively, or in a colloid drug delivery system. Colloidal dispersion systems include macromolecule complexes, nano-capsules, microspheres, microbeads, and lipid-based systems, including oil-in-water emulsions, micelles, mixed micelles, and liposomes. Methods of preparing liposomes are described in, for example, U.S. Pat. Nos. 4,235,871, 4,501,728, and 4,837,028. Methods for the preparation of the above-mentioned formulations will be apparent to those skilled in the art.

    [0215] Formulations for oral use may also be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate, kaolin or microcrystalline cellulose, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example peanut oil, liquid paraffin, or olive oil.

    [0216] Aqueous suspensions contain the active materials in admixture with excipients suitable for the manufacture thereof. Such excipients can be suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydroxy-propylmethylcellulose, sodium alginate, polyvinyl-pyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents, for example a naturally-occurring phosphatide (e.g., lecithin), or condensation products of an alkylene oxide with fatty acids (e.g., polyoxy-ethylene stearate), or condensation products of ethylene oxide with long chain aliphatic alcohols (e.g., for heptadecaethyleneoxycetanol), or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol (e.g., polyoxyethylene sorbitol monooleate), or condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides (e.g., polyethylene sorbitan monooleate). The aqueous suspensions may also contain one or more preservatives.

    [0217] Oily suspensions may be formulated by suspending the active ingredient in a vegetable oil, for example arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as liquid paraffin. The oily suspensions may contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol. Sweetening agents such as those set forth above, and flavoring agents may be added to provide a palatable oral preparation.

    [0218] Dispersible powders and granules suitable for preparation of an aqueous suspension by the addition of water provide the active ingredient in admixture with a dispersing or wetting agent, suspending agent and one or more preservatives. Suitable dispersing or wetting agents and suspending agents are exemplified herein.

    [0219] The pharmaceutical compositions of the present disclosure may also be in the form of oil-in-water emulsions. The oily phase may be a vegetable oil, for example olive oil or arachis oil, or a mineral oil, for example, liquid paraffin, or mixtures of these. Suitable emulsifying agents may be naturally-occurring gums, for example, gum acacia or gum tragacanth; naturally-occurring phosphatides, for example, soy bean, lecithin, and esters or partial esters derived from fatty acids; hexitol anhydrides, for example, sorbitan monooleate; and condensation products of partial esters with ethylene oxide, for example, polyoxyethylene sorbitan monooleate.

    [0220] Formulations can also include carriers to protect the composition against rapid degradation or elimination from the body, such as a controlled release formulation, including implants, liposomes, hydrogels, prodrugs and microencapsulated delivery systems. For example, a time delay material such as glyceryl monostearate or glyceryl stearate alone, or in combination with a wax, may be employed.

    [0221] The present disclosure contemplates the administration of the polypeptides in the form of suppositories for rectal administration of the drug. The suppositories can be prepared by mixing the drug with a suitable non-irritating excipient which is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug. Such materials include, but are not limited to, cocoa butter and polyethylene glycols.

    [0222] The polypeptides contemplated by the present disclosure may be in the form of any other suitable pharmaceutical composition (e.g., sprays for nasal or inhalation use) currently known or developed in the future.

    [0223] The concentration of a polypeptide or fragment thereof in a formulation can vary widely (e.g., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight) and will usually be selected primarily based on fluid volumes, viscosities, and subject-based factors in accordance with, for example, the particular mode of administration selected.

    [0224] Contemplated herein is the use of Nano Precision Medical's depot delivery technology (Nano Precision Medical; Emeryville, Calif.). The technology utilizes a titania nanotube membrane that produces zero-order release rates of macromolecules, such as protein and peptide therapeutics. The biocompatible membrane is housed in a small, subcutaneous implant that provides long-term (e.g., up to one year), constant-rate delivery of therapeutic macromolecules. The technology is currently being evaluated for the delivery of GLP-1 agonists for the treatment of Type II diabetes. In certain embodiments, the polypeptide(s) disclosed herein may be a formulation with a membrane. For example, the polypeptide may be impregnated into the membrane or surrounded by the membrane. The membrane may be in shape of a disc, tube or sphere. In certain embodiments, the tube may be a nanotube or the sphere may be a nanosphere.

    [0225] A subject pharmaceutical composition can include a GFRAL, GFRAL extracellular domain, or soluble GFRAL-ECD polypeptide, and a pharmaceutically acceptable excipient.

    Patient Populations

    [0226] The present disclosure provides a method to treat a patient suffering from involuntary weight loss. An example of a suitable patient may be one who is diagnosed with a wasting disease or cachexia. Suitable patients include those suffering from liver cirrhosis, hyperthyroidism, chronic kidney disease, Parkinson's disease, cancer, eating disorder (e.g., anorexia nervosa), chronic inflammatory disease (e.g., rheumatoid arthritis), sepsis or other forms of systemic inflammation, chronic obstructive pulmonary disease, AIDS, tuberculosis, and muscle wasting, such as muscular dystrophy or multiple sclerosis), or sarcopenia.

    [0227] The present disclosure also provides methods for preventing involuntary weight loss in a patient who may be at risk of involuntary weight loss due to a chronic disease, such as, liver cirrhosis, hyperthyroidism, chronic kidney disease, Parkinson's disease, cancer, eating disorder (e.g., anorexia nervosa), chronic inflammatory disease (e.g., rheumatoid arthritis), sepsis or other forms of systemic inflammation, chronic obstructive pulmonary disease, AIDS, tuberculosis, and muscle wasting, such as muscular dystrophy or multiple sclerosis), or sarcopenia. Such patients may include patients who have elevated levels of GDF15, are undergoing treatment for cancer, and the like.

    [0228] The present disclosure provides a method to treat a patient suffering from cachexia. An example of a suitable patient may be one who is diagnosed with cachexia. The present disclosure also provides methods for preventing involuntary weight loss in a patient who may be at risk of involuntary weight loss due to onset of cachexia. Such patients include patients who have elevated levels of GDF15, have cancer, are undergoing treatment for cancer, have an eating disorder, and the like.

    [0229] Also disclosed is a method for reducing GDF15 activity in a patient having elevated GDF15 activity. As used herein, “elevated GDF15 activity” refers to increased activity or amount of GDF15 in a biological fluid of a subject in comparison to a normal subject. A number of conditions are associated with increased GDF15 serum level, wherein the increased GDF15 results in a number of symptoms such as appetite loss, weight loss, and the like. Examples of conditions associated with increased GDF15 serum level include cancer, e.g., melanoma, gastric cancer, pancreatic cancer, prostate cancer; autoimmune diseases such as, arthritis and inflammation; cardiovascular diseases like atherosclerosis, heart failure, hypertension, myocardial infarction, chest pain, and cardiovascular events; metabolic diseases like anemia, cachexia, anorexia, kidney disease, and thalassemia, etc.

    [0230] A patient having any of the above disorders may be a suitable candidate for receiving an agent that binds an extracellular domain of a GFRAL protein, or a fragment of GFRAL that includes a GFRAL extracellular domain, e.g., a soluble GFRAL ECD, or a combination of the agent and GFRAL fragment.

    [0231] Administering the subject GFRAL protein fragments, such as, GFRAL ECD, GFRAL ECD fragment, and/or GFRAL ECD variant in such an individual may decrease or prevent one or more of the symptoms associated with the disorder. For example, administering the proteins of the present disclosure may increase body weight and/or appetite in a subject.

    Methods

    [0232] The subject method involves administering the subject proteins to a patient who has involuntary body weight loss or is at risk of developing involuntary body weight loss. The subject methods include administering proteins disclosed herein to a subject who has elevated serum levels of GDF15. The methods of the present disclosure include administering at least one of: an agent that binds an extracellular domain of a GFRAL protein; and a fragment of GFRAL that includes a GFRAL extracellular domain, e.g., a soluble GFRAL-ECD.

    [0233] In certain cases, the agent may be an anti-GFRAL antibody that competes with GDF15 for binding to extracellular domain of GFRAL. In certain cases, the agent may be an agent that binds to an extracellular domain of a GFRAL protein but does not activate RET. For example, the agent may be an anti-GFRAL antibody that competes with GDF15 for binding to extracellular domain of GFRAL but does not activate RET upon binding to GFRAL. Such an antibody may be generated by immunizing a laboratory animal with a GFRAL ECD and screening the generated antibodies in a GFRAL binding assay and/or GFRAL signaling assay as described herein. Such anti-GFRAL antibodies may be modified to generate chimeric or humanized antibodies by using standard methods.

    [0234] In certain cases, the fragment of GFRAL administered to a patient who has cachexia or is at risk of developing cachexia may be a GFRAL ECD, a GFRAL ECD fragment, and/or a GFRAL ECD variant, as described herein.

    [0235] Subjects having, suspected of having, or at risk of developing cachexia are contemplated for therapy described herein.

    [0236] In the methods of the present disclosure, protein compositions described herein can be administered to a subject (e.g., a human patient) to, for example, achieve a target body weight and/or maintain body weight; achieve a target body mass index (BMI) and/or maintain a BMI; increase appetite; and the like. A normal human adult has a BMI in the range 18.5-24.9 Kg/m.sup.2.

    [0237] The subject treatment methods may increase body weight, BMI, muscle weight, and/or food intake in a patient by at least about 5%, e.g., 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50% or more.

    [0238] In certain cases, the agent may be an agent identified via a screening method for GFRAL binding agents, such as, the screening methods disclosed herein.

    [0239] The methods relating to treatment or prevention of cachexia contemplated herein include, for example, use of protein described above for therapy/prevention alone or in combination with other types of therapy. The method involves administering to a subject the subject protein (e.g., subcutaneously, intradermally, or intravenously).

    [0240] In some embodiments, the agent is administered to a patient experiencing loss of muscle mass, for example, loss of muscle mass associated with an underlying disease. Underlying diseases associated with cachexia include, but are not limited to, cancer, chronic renal disease, chronic obstructive pulmonary disease, AIDS, tuberculosis, chronic inflammatory diseases, sepsis and other forms of systemic inflammation, muscle wasting, such as muscular dystrophy, and the eating disorder known as anorexia nervosa. In some embodiments, the agent inhibits loss of lean mass (e.g., muscle mass) and or fat mass by at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%.

    [0241] In some embodiments, a loss of lean mass (e.g., muscle mass) is accompanied by a loss of fat mass. In some embodiments, the agent can inhibit loss of fat mass by at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%.

    [0242] In some embodiments, the agent is administered to a patient diagnosed with body weight loss (e.g., involuntary weight loss). In some embodiments, the agent can revert body weight loss (e.g., involuntary weight loss) by at least 2%, 5%, 10%, 15%, 20%, 25%, 30% or 35%.

    [0243] In some embodiments, the agent is administered to a patient diagnosed with loss of organ mass, for example, loss of organ mass associated with an underlying disease. Underlying diseases associated with cachexia include, but are not limited to, cancer, chronic renal disease, chronic obstructive pulmonary disease, AIDS, tuberculosis, chronic inflammatory diseases, sepsis and other forms of systemic inflammation, muscle wasting, such as muscular dystrophy, and the eating disorder known as anorexia nervosa. In some embodiments, the agent can inhibit loss of organ mass by at least 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%. In some embodiments, loss of organ mass is observed in heart, liver, kidney, and/or spleen. In some embodiments, the loss of organ mass in accompanied by a loss of muscle mass, a loss of fat mass and/or involuntary weight loss.

    [0244] Sarcopenia, muscle wasting disorders and significant muscle weight loss can occur in the absence of cachexia, decreased appetite or body weight loss. In some embodiments, the agent can be used to treat a subject diagnosed with sarcopenia, a muscle wasting disorder and/or significant muscle weight loss, whether or not the subject has, or has been diagnosed with, cachexia or decreased appetite. Such a method comprises administering a therapeutically effective amount of one or more agents to a subject in need thereof.

    [0245] In some embodiments, the agent is administered to a patient diagnosed with obesity. In some embodiments, the agent can inhibit weight gain or to reduce body weight by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45% or 50%. Use of the agent to treat obesity in a patient comprises administering to the patient a therapeutically effective amount of the agent.

    Routes of Administration

    [0246] The present disclosure contemplates the administration of the disclosed polypeptides, and compositions thereof, in any appropriate manner. Suitable routes of administration include parenteral (e.g., intramuscular, intravenous, subcutaneous (e.g., injection or implant), intraperitoneal, intracisternal, intraarticular, intraperitoneal, intracerebral (intraparenchymal) and intracerebroventricular), oral, nasal, vaginal, sublingual, intraocular, rectal, topical (e.g., transdermal), sublingual and inhalation.

    [0247] Depot injections, which are generally administered subcutaneously or intramuscularly, may also be utilized to release the polypeptides disclosed herein over a defined period of time. Depot injections are usually either solid- or oil-based and generally comprise at least one of the formulation components set forth herein. One of ordinary skill in the art is familiar with possible formulations and uses of depot injections.

    [0248] Regarding antibodies, in an exemplary embodiment an antibody or antibody fragment of the present disclosure is stored at 10 mg/ml in sterile isotonic aqueous saline solution for injection at 4° C. and is diluted in either 100 ml or 200 ml 0.9% sodium chloride for injection prior to administration to the subject. The antibody is administered by intravenous infusion over the course of 1 hour at a dose of between 0.2 and 10 mg/kg. In other embodiments, the antibody is administered by intravenous infusion over a period of between 15 minutes and 2 hours. In still other embodiments, the administration procedure is via subcutaneous bolus injection.

    [0249] The present disclosure contemplates methods wherein the polypeptide or an antibody or antibody fragment of the present disclosure is administered to a subject at least twice daily, at least once daily, at least once every 48 hours, at least once every 72 hours, at least once weekly, at least once every 2 weeks, at least once monthly, at least once every 2 months, or at least once every 3 months, or less frequently.

    Combination Therapy

    [0250] Any of a wide variety of therapies directed to treating or preventing cachexia can be combined in a composition or therapeutic method with the subject proteins.

    [0251] “Combination” as used herein is meant to include therapies that can be administered separately, e.g., formulated separately for separate administration (e.g., as may be provided in a kit), as well as for administration in a single formulation (i.e., “co-formulated”). Examples of agents that may be provided in a combination therapy include an agent that binds an extracellular domain of a GFRAL protein and competes with GDF15 for binding to the ECD of GFRAL, e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL. An exemplary combination therapy may include administering an anti-GFRAL ECD antibody and a fragment of GFRAL that includes a GFRAL extracellular domain, e.g., a soluble GFRAL-ECD.

    [0252] Where the GFRAL-ECD protein is administered in combination with one or more other therapies, the combination can be administered anywhere from simultaneously to up to 5 hours or more, e.g., 10 hours, 15 hours, 20 hours or more, prior to or after administration of a subject protein. In certain embodiments, a subject protein and other therapeutic intervention are administered or applied sequentially, e.g., where a subject protein is administered before or after another therapeutic treatment. In yet other embodiments, a subject protein and other therapy are administered simultaneously, e.g., where a subject protein and a second therapy are administered at the same time, e.g., when the second therapy is a drug it can be administered along with a subject protein as two separate formulations or combined into a single composition that is administered to the subject. Regardless of whether administered sequentially or simultaneously, as illustrated above, the treatments are considered to be administered together or in combination for purposes of the present disclosure.

    [0253] Cytokines that are implicated in cachexia include Activin A and IL-6. Increased activin levels have been associated with cancer-associated cachexia and gonadal tumors. See, e.g., Marino et al. (2013) CYTOKINE & GROWTH FACTOR REV. 24:477-484. Activin A is a member of the TGF-beta family, and is a ligand of the activin type 2 receptor, ActRIIB. See, e.g., Zhou et al. (2010) CELL 142:531-543. Circulating levels of IL-6 have been shown to correlate with weight loss in cancer patients, as well as with reduced survival. See, e.g., Fearon et al. (2012) CELL METABOLISM 16: 153-166.

    [0254] Accordingly, in some embodiments, one or more inhibitors of Activin-A or the Activin-A receptor, ActRIIB, IL-6 or the IL-6 receptor (IL-6R), can be administered in combination with (for example, administered at the same time as, administered before, or administered after) an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL). Exemplary inhibitors of Activin A or ActRIIB, include, for example, an anti-Activin-A antibody or an antigen binding fragment thereof, an anti-ActRIIB antibody or an antigen binding fragment thereof, a small molecule inhibitor of Activin-A, a small molecule inhibitor of ActRIIB, and a ‘decoy’ receptor of ActRIIB, such as a soluble ActRIIB receptor and a fusion of the soluble ActRIIB receptor with an Fc molecule (ActRIIB-Fc). See, e.g., Zhou et al. (2010), supra. Suitable inhibitors of IL-6 or IL-6R, include an anti-IL-6 antibody or an antigen binding fragment thereof, an anti-IL-6R antibody or an antigen binding fragment thereof, a small molecule inhibitor of IL-6, a small molecule inhibitor of IL-6R, and a ‘decoy’ receptor of IL-6R, such as a soluble IL-6 receptor and a fusion of the soluble IL-6 receptor with an Fc molecule (IL6R-Fc). See, e.g., Enomoto et al. (2004) BIOCHEM. AND BIOPHYS. RES. COMM. 323: 1096-1 102; Argiles et al. (2011) EUR. J. PHARMACOL. 668:S81-S86; Tuca et al. (2013) ONCOLOGY/HEMATOLOGY 88:625-636. Suitable inhibitors of IL-6 or IL-6R can include, e.g., Tocilizumab (Actemra®, Hoffmann-LaRoche), a humanized anti-IL-6R monoclonal antibody approved for treatment of rheumatoid arthritis, and Sarilumab/REGN88 (Regeneron), a humanized anti-IL6R antibody in clinical development for treatment of rheumatoid arthritis; and Selumetinib/AZD6244 (AstraZeneca), an allosteric inhibitor of MEK, which has been shown to inhibit IL-6 production. Prado et al. (2012) BRITISH J. CANCER 106: 1583-1586.

    [0255] TNFα and IL-1 are cytokines known to be involved in mediation of the proinflammatory response, which are also implicated in muscle depletion, anorexia and cachexia. Increased circulating levels of TNFα appear to inhibit myogenesis. TNFα, also known as “cachectin,” stimulates interleukin-1 secretion and is implicated in the induction of cachexia. IL-1 is a potent trigger of the acute-phase inflammatory response, and it has been shown that infusion of IL-1 can lead to marked weight loss and appetite loss. IL-1 has been shown to contribute to the initiation of cancer cachexia in mice bearing a murine colon-26 adenocarcinoma (Strassmann et al. (1993) J. IMMUNOL. 150:2341). See also, Mathys and Billiau (1997) NUTRITION 13:763-770; Fong et al. (1989) AM. J. PHYSIOL.—REGULATORY, INTEGRATIVE AND COMPARATIVE PHYSIOL., 256:R659-R665. Thus, TNFα inhibitors and IL-1 inhibitors that are used in the treatment of rheumatoid arthritis may also be useful in the treatment of cachexia.

    [0256] Accordingly, in some embodiments, one or more inhibitors of TNFα or IL-1 can be administered in combination with (e.g., administered at the same time as, administered before, or administered after) an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL). Suitable inhibitors of TNFα or IL-1 include an anti-TNFα antibody or an antigen binding fragment thereof, an anti-IL-1 antibody or an antigen binding fragment thereof, a small molecule inhibitor of TNFα or IL-1, and a ‘decoy’ receptor of TNFα or IL-1, such as a soluble TNFα or IL-1 receptor and a fusion of the soluble form of TNFα or IL-1 with an Fc molecule. Suitable inhibitors of TNFα include for example, etanercept (Enbrel®, Pfizer/Amgen), infliximab (Remicade®, Janssen Biotech), adalimumab (Humira®, Abbvie), golimumab (Simponi®, Johnson and Johnson/Merck), and certolizumab pegol (Cimzia®, UCB). Suitable IL-1 inhibitors include, e.g., Xilonix® antibody that targets IL-1 a (XBiotech), anikinra (Kinaret®, Amgen), canakinumab (Ilaris®, Novartis), and rilonacept (Arcalyst®, Regeneron). In certain embodiments, the TNFa inhibitor or IL-1 inhibitor, which is typically administered systemically for the treatment of rheumatoid arthritis may be administered locally and directly to the tumor site.

    [0257] Myostatin, also known as GDF-8, is a member of the TGF-β family of peptides that is a negative regulator of muscle mass, as shown by increased muscle mass in myostatin deficient mammals. Myostatin is a ligand of the activin type 2 receptor, ActRIIB.

    [0258] Accordingly, in some embodiments, one or more inhibitors of myostatin or its receptor may be administered in combination with (for example, administered at the same time as, administered before, or administered after) an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL). Suitable inhibitors of myostatin or ActRIIB, include an anti-myostatin antibody or an antigen binding fragment thereof, an anti-ActRIIB antibody or an antigen binding fragment thereof, a small molecule inhibitor of myostatin, a small molecule inhibitor of ActRIIB, and a ‘decoy’ receptor of GDF-8, such as a soluble ActRIIB and a fusion of the soluble form of ActRIIB with an Fc molecule. See, e.g., Lokireddy et al. (2012) BIOCHEM. J. 446(I):23-26. Myostatin inhibitors that may be suitable for the present methods include REGN1033 (Regeneron); see Bauerlein et al. (2013) J. CACHEXIA SARCOPENIA MUSCLE: Abstracts of the 7.sup.th Cachexia Conference, Kobe/Osaka, Japan, Dec. 9-11, 2013, Abstract 4-06; LY2495655 (Lilly), a humanized anti-myostatin antibody in clinical development by Eli Lilly; see also “A PHASE 2 STUDY OF LY2495655 IN PARTICIPANTS WITH PANCREATIC CANCER,” available on the world wide web at clinicaltrials.gov/ct2/NCT01505530; NML identifier: NCT01505530; ACE-031 (Acceleron Pharma); and stamulumab (Pfizer).

    [0259] Agents such as Ghrelin or ghrelin mimetics, or other growth hormone secretagogues (GHS) which are able to activate the GHS receptor (GHS-Rla), also known as the ghrelin receptor, can be useful for increasing food intake and body weight in humans. See Guillory et al. (2013) in VITAMINS AND HORMONES vol. 92, chap. 3; and Steinman and DeBoer (2013) VITAMINS AND HORMONES vol. 92, chap. 8. Accordingly, in some embodiments, one or more Ghrelin or ghrelin mimetics, or other growth hormone secretagogues (GHS), can be administered in combination with (for example, administered at the same time as, administered before, or administered after) an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL). Suitable ghrelin mimetics include anamorelin (Helsinn, Lugano, CH); see Temel et al. (2013) J. CACHEXIA SARCOPENIA MUSCLE: Abstracts of the 7.sup.th Cachexia Conference, Kobe/Osaka, Japan, Dec. 9-11, 2013, Abstract 5-01. Other suitable GHS molecules can be identified, for example, using the growth hormone secretagogue receptor Ghrelin competition assay described in PCT Publication Nos. WO201 1/1 17254 and WO2012/1 13103.

    [0260] Agonists of the androgen receptor, including small molecules and other selective androgen receptor modulators (SARMs) can be useful in treating cachexia and/or sarcopenia. See, e.g., Mohler et al. (2009) J. MED. CHEM. 52:3597-3617; Nagata et al. (2011) BIOORGANIC AND MED. CHEM. LETTERS 21: 1744-1747; and Chen et al. (2005) MOL. INTERV. 5: 173-188. Ideally, SARMs should act as full agonists, like testosterone, in anabolic target tissues, such as muscle and bone, but should demonstrate only partial or pure androgen receptor antagonistic activities on prostate tissue. See, e.g., Bovee et al. (2010) J. STEROID BIOCHEM. & MOL. BIOL. 118:85-92. Suitable SARMs can be identified, e.g., by use of the methods and assays described in Zhang et al. (2006) BIOORG. MED. CHEM. LETT. 16:5763-5766; and Zhang et al. (2007) BIOORG. MED. CHEM. LETT. 17:439-443.

    [0261] Accordingly, in some embodiments, one or more androgen receptor agonists can be administered in combination with (for example, administered at the same time as, administered before, or administered after) an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL). Suitable SARMs include, for example, GTx-024 (enobosarm, Ostarine®, GTx, Inc.), a SARM in phase II clinical development by GTx, Inc. See also, Dalton et al. (2011) J. CACHEXIA SARCOPENIA MUSCLE 2: 153-161. Other suitable SARMs include 2-(2,2,2)-trifluoroethyl-benzimidazoles (Ng et al. (2007) BIOORG. MED. CHEM. LETT. 17: 1784-1787) and JNJ-26146900 (Allan et al. (2007) J. STEROID BIOCHEM. & MOL. BIOL. 103:76-83).

    [0262] β-adrenergic receptor blockers, or beta-blockers, have been studied for their effect on body weight in cachexia subjects, and have been associated with partial reversal of cachexia in patients with congestive heart failure. See, e.g., Hryniewicz et al. (2003) J. CARDIAC FAILURE 9:464-468. Beta-blocker MT-102 (PsiOxus Therapeutics, Ltd.) has been evaluated in a phase 2 clinical trial for subjects with cancer cachexia. See Coats et al. (2011) J. CACHEXIA SARCOPENIA MUSCLE 2:201-207. Accordingly, in some embodiments, one or more β-adrenergic receptor blockers, or beta-blockers, can be administered in combination with (for example, administered at the same time as, administered before, or administered after) an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL).

    [0263] Melanocortin receptor-knockout mice with a genetic defect in melanocortin signaling exhibit a phenotype opposite that of cachexia: increased appetite, increased lean body mass, and decreased metabolism. Thus, melanocortin antagonism has emerged as a potential treatment for cachexia associated with chronic disease (DeBoer and Marks (2006) TRENDS IN ENDOCRINOLOGY AND METABOLISM 17: 199-204).

    [0264] Accordingly, in some embodiments, one or more inhibitors of a melanocortin peptide or a melanocortin receptor can be administered in combination (e.g., administered at the same time as, administered before, or administered after) with an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL). Suitable inhibitors of melanocortins or melanocortin receptors include an anti-melanocortin peptide antibody or an antigen binding fragment thereof, an anti-melanocortin receptor antibody or an antigen binding fragment thereof, a small molecule inhibitor of a melanocortin peptide, a small molecule inhibitor of a melanocortin receptor, and a ‘decoy’ receptor of a melanocortin receptor, such as soluble melanocortin receptor and a fusion of a soluble melanocortin receptor with an Fc molecule. Suitable melacortin receptor inhibitors include, for example, the melanocortin receptor antagonist agouri-related peptide (AgRP(83-132)), which has been demonstrated to prevent cachexia-related symptoms in a mouse model of cancer-related cachexia (Joppa et al. (2007) PEPTIDES 28:636-642).

    [0265] Anti-cancer agents, especially those that can cause cachexia and elevate GDF-15 levels, such as cisplatin, can be used in methods of the present disclosure in combination with (for example, administered at the same time as, administered before, or administered after) an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL). Many cancer patients are weakened by harsh courses of radio- and/or chemotherapy, which can limit the ability of the patient to tolerate such therapies, and hence restrict the dosage regimen. Certain cancer agents themselves, such as fluorouracil, adriamycin, methotrexate and cisplatin, can contribute to cachexia, for example by inducing severe gastrointestinal complications. See, e.g., Inui (2002) CANCER J. FOR CLINICIANS 52:72-91. By the methods of the present disclosure, in which an anti-cancer agent is administered in combination with an anti-GDF-15 antibody of the disclosure, it is possible to decrease the incidence and/or severity of cachexia, and ultimately increase the maximum tolerated dose of such an anti-cancer agent. Accordingly, efficacy of treatment with anti-cancer agents that can cause cachexia can be improved by reducing the incidence of cachexia as a dose-limiting adverse effect, and by allowing administration of higher doses of a given anticancer agent.

    [0266] Thus, provided herein are pharmaceutical compositions comprising an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL) in combination with an agent selected from the group consisting of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-Rla agonist, a SARM, a TNFα inhibitor, an IL-la inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, a melanocortin receptor inhibitor, and an anti-cancer agent. The present disclosure also includes methods of treating, preventing or minimizing cachexia and/or sarcopenia in a mammal comprising administering to a mammal in need thereof a pharmaceutical composition or compositions comprising an effective amount of an anti-GDF-15 antibody of the disclosure in combination with an effective amount of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-Rla agonist, a SARM, a TNFα inhibitor, an IL-la inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, or a melanocortin receptor inhibitor.

    [0267] In another aspect, provided herein is a method of inhibiting loss of muscle mass associated with an underlying disease comprising administering to a mammal in need thereof a pharmaceutical composition or compositions comprising an effective amount of an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL) in combination with an effective amount of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-Rla agonist, a SARM, a TNFα inhibitor, an IL-lα inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, or a melanocortin receptor inhibitor to prevent or reduce loss of muscle mass. The underlying disease can be selected from the group consisting of cancer, chronic heart failure, chronic kidney disease, chronic obstructive pulminary disease, AIDS, multiple sclerosis, rheumatoid arthritis, sepsis, and tuberculosis. Additionally, in some embodiments, the loss of muscle mass is accompanied by a loss of fat mass.

    [0268] In another aspect, provided herein is a method of inhibiting or reducing involuntary weight loss in a mammal comprising administering to a mammal in need thereof a pharmaceutical composition or pharmaceutical compositions comprising an effective amount of an anti-GDF-15 antibody of the disclosure in combination with an effective amount of an inhibitor of Activin-A, an inhibitor of ActRIIB, an inhibitor of IL-6 or an inhibitor of IL-6R, a ghrelin, a ghrelin mimetic or a GHS-Rla agonist, a SARM, a TNFα inhibitor, a IL-lα inhibitor, a myostatin inhibitor, a beta-blocker, a melanocortin peptide inhibitor, or a melanocortin receptor inhibitor.

    [0269] Certain anti-cancer agents, such as cisplatin, have one or more undesirable adverse effects that involve causing or increasing one or more syndromes such as cachexia, sarcopenia, muscle wasting, bone wasting or involuntary body weight loss. Accordingly, in another aspect, provided herein is a method of treating cancer, while preventing, minimizing or reducing the occurrence, frequency or severity of cachexia, sarcopenia, or muscle wasting, bone wasting or involuntary loss of body weight in a mammal, comprising administering to a mammal in need thereof a pharmaceutical composition comprising an effective amount of an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL) in combination with one or more anti-cancer agents. In some embodiments, the method of treating cancer, while preventing, minimizing or reducing the occurrence, frequency or severity of cachexia, sarcopenia or muscle wasting, bone wasting or involuntary loss of body weight in a mammal, comprises administering to a mammal in need thereof a pharmaceutical composition comprising an effective amount of an agent that binds an extracellular domain of a GFRAL protein and/or competes with GDF15 for binding to the ECD of GFRAL (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL) in combination with one or more anti-cancer agents known to cause or increase the occurrence, frequency or severity of cachexia, sarcopenia, or muscle wasting, bone wasting or involuntary loss of body weight in a mammal.

    Dosages

    [0270] In the methods, a therapeutically effective amount of a subject protein is administered to a subject in need thereof. For example, a subject protein causes the body weight to return to a normal level relative to a healthy individual when the subject protein is delivered to the bloodstream in an effective amount to a patient who previously did not have a normal body weight relative to a healthy individual prior to being treated. The amount administered varies depending upon the goal of the administration, the health and physical condition of the individual to be treated, age, the degree of resolution desired, the formulation of a subject protein, the activity of the subject proteins employed, the treating clinician's assessment of the medical situation, the condition of the subject, and the body weight of the subject, as well as the severity of cachexia, and other relevant factors. The size of the dose will also be determined by the existence, nature, and extent of any adverse side-effects that might accompany the administration of a particular protein.

    [0271] It is expected that the amount will fall in a relatively broad range that can be determined through routine trials. For example, the amount of subject protein employed to restore body weight and/or appetite is not more than about the amount that could otherwise be irreversibly toxic to the subject (i.e., maximum tolerated dose). In other cases, the amount is around or even well below the toxic threshold, but still in an effective concentration range, or even as low as threshold dose.

    [0272] Individual doses are typically not less than an amount required to produce a measurable effect on the subject, and may be determined based on the pharmacokinetics and pharmacology for absorption, distribution, metabolism, and excretion (“ADME”) of the subject protein or its by-products, and thus based on the disposition of the composition within the subject. This includes consideration of the route of administration as well as dosage amount, which can be adjusted for enteral (applied via digestive tract for systemic or local effects when retained in part of the digestive tract) or parenteral (applied by routes other than the digestive tract for systemic or local effects) applications. For instance, administration of a subject protein is typically via injection and often intravenous, intramuscular, or a combination thereof.

    [0273] An effective dose (ED) is the dose or amount of an agent that produces a therapeutic response or desired effect in some fraction of the subjects taking it. The “median effective dose” or ED50 of an agent is the dose or amount of an agent that produces a therapeutic response or desired effect in 50% of the population to which it is administered. Although the ED50 is commonly used as a measure of reasonable expectance of an agent's effect, it is not necessarily the dose that a clinician might deem appropriate taking into consideration all relevant factors.

    [0274] In some embodiments, the effective amount is the same as the calculated ED.sub.50, and in certain embodiments the effective amount is an amount that is more than the calculated ED.sub.50. In certain embodiments the effective amount is an amount that is less than the calculated ED.sub.50.

    [0275] An effective amount of a protein may also be an amount that is effective, when administered in one or more doses, to increase body weight of an individual by at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, or more than 80%, compared to body weight in the individual prior to the treatment.

    [0276] Further examples of dose per administration may be at less than 10 μg, less than 2 μg, or less than 1 μg. Dose per administration may also be more than 50 μg, more than 100 μg, more than 300 μg up to 600 μg or more. An example of a range of dosage per weight is about 0.1 μg/kg to about 1 μg/kg, up to about 1 mg/kg or more. Effective amounts and dosage regimens can readily be determined empirically from assays, from safety and escalation and dose range trials, individual clinician-patient relationships, as well as in vitro and in vivo assays known in the art.

    [0277] The term “unit dosage form,” as used herein, refers to physically discrete units suitable as unitary dosages for human and animal subjects, each unit containing a predetermined quantity of proteins of the present disclosure calculated in an amount sufficient to produce the desired effect in association with a pharmaceutically acceptable diluent, carrier or vehicle. The specifications for the novel unit dosage forms depend on the particular protein employed and the effect to be achieved, and the pharmacodynamics associated with each protein in the host.

    [0278] In some embodiments, a therapeutically effective amount of a subject protein (e.g., an antibody that competes with GDF15 for binding to ECD of GFRAL) is in the range of 0.1 mg/kg to 100 mg/kg, 1 mg/kg to 100 mg/kg, 1 mg/kg to 10 mg/kg, or 2.0 mg/kg to 10 mg/kg. The amount administered can depend on variables such as the type and extent of disease or indication to be treated, the overall health of the patient, the in vivo potency of the antibody or fusion protein, the pharmaceutical formulation, the serum half-life of the antibody or fusion protein, and the route of administration. The initial dosage can be increased beyond the upper level in order to rapidly achieve the desired blood-level or tissue level. Alternatively, the initial dosage can be smaller than the optimum, and the dosage can be progressively increased during the course of treatment. Human dosage can be optimized, e.g., in a conventional Phase I dose escalation study designed to run from 0.5 mg/kg to 20 mg/kg. Dosing frequency can vary, depending on factors such as route of administration, dosage amount, serum half-life of the antibody or fusion protein, and the disease being treated. Exemplary dosing frequencies are once per day, once per week and once every two weeks. In some embodiments, dosing is once every two weeks. A preferred route of administration is parenteral, e.g., intravenous infusion. Formulation of monoclonal antibody-based drugs and fusion protein-based drugs are within ordinary skill in the art. In some embodiments, the antibody or fusion protein is lyophilized, and then reconstituted in buffered saline, at the time of administration. The effective amount of a second active agent, for example, an anti-cancer agent or another agent described herein, will also follow the principles discussed hereinabove and will be chosen so as to elicit the required therapeutic benefit in the patient.

    Kits

    [0279] Also provided by the present disclosure are kits for using the compositions disclosed herein and for practicing the methods, as described above. The kits may be provided for administration of the subject protein in a subject in need of treatment or prevention of cachexia. The kit can include one or more of the proteins disclosed herein, which may be provided in a sterile container, and can be provided in a formulation with a suitable pharmaceutically acceptable excipient for administration to a subject. The proteins can be provided with a formulation that is ready to be used as it is or can be reconstituted to have the desired concentrations. Where the proteins are provided to be reconstituted by a user, the kit may also provide buffers, pharmaceutically acceptable excipient, and the like, packaged separately from the subject protein. The proteins of the present kit may be formulated separately or in combination with other drugs.

    [0280] In addition to above-mentioned components, the kits can further include instructions for using the components of the kit to practice the subject methods. The instructions for practicing the subject methods are generally recorded on a suitable recording medium. For example, the instructions may be printed on a substrate, such as paper or plastic, etc. As such, the instructions may be present in the kits as a package insert, in the labeling of the container of the kit or components thereof (i.e., associated with the packaging or subpackaging) etc. In other embodiments, the instructions are present as an electronic storage data file present on a suitable computer readable storage medium, e.g., CD-ROM, diskette, etc. In yet other embodiments, the actual instructions are not present in the kit, but means for obtaining the instructions from a remote source, e.g., via the internet, are provided. An example of this embodiment is a kit that includes a web address where the instructions can be viewed and/or from which the instructions can be downloaded. As with the instructions, the means for obtaining the instructions is recorded on a suitable substrate.

    EXAMPLES

    [0281] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the present invention, and are not intended to limit the scope of what the inventor(s) regard as their invention nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Celsius, and pressure is at or near atmospheric. Standard abbreviations may be used, e.g., bp, base pair(s); kb, kilobase(s); pl, picoliter(s); s or sec, second(s); min, minute(s); h or hr, hour(s); aa, amino acid(s); kb, kilobase(s); bp, base pair(s); nt, nucleotide(s); i.m., intramuscular(ly); i.p., intraperitoneal(ly); s.c., subcutaneous(ly); and the like.

    Materials and Methods

    [0282] The following methods and materials were used in the Examples below.

    [0283] Generation of HEK239-GFRAL Cell Line.

    [0284] A plasmid containing human GFRAL was transfected into HEK293 cells using Lipofectamine 2000 (Life Technology). Two days after transfection, cells were incubated with DMEM containing 10% FBS and hygromycin (0.2 mg/mL) until colonies became visible. Clones were picked and evaluated for Fc-GDF15 binding using indirect immunofluorescence staining.

    [0285] RT-PCR.

    [0286] Tissues from C57/BL6 mice were harvested and total RNA was extracted by Trizol (Life Technology). 250 μg of total RNA was subjected to RT-qPCR analysis using Quantitect Multiplex RT-PCR kit (Qiagen). The PCR primer for mouse GFRAL was purchased from Life Technology (Catalog no. Mm 02344885-m1). The copy number of transcripts was calculated based on a standard curve generated using mouse GFRAL cDNA as the template.

    [0287] In Situ Hybridization.

    [0288] RNA in situ hybridization of mouse GFRAL was performed by Advanced Cell Diagnostics (Hayward, Calif.) using its RNASCOPE® Assay technology. Whole brains from C57BL/6 mice were dissected and fresh frozen in optimal cutting temperature (OCT) compound (VWR International). 20 microns cryosections were prepared, dried on slide for approximately 1 hr and stored at −20° C. until processing at Advanced Cell Diagnostics.

    [0289] Immunofluorescence Staining of Mouse Brain Sections.

    [0290] Whole brains from C57BL/6 mice were fixed in 4% paraformaldehyde:PBS overnight at 4° C. Tissues were washed in PBS and sectioned with a Vibratome. 50 μm sections were processed free floating in 2% BSA+0.2% Triton X-100:PBS solution through all blocking, antibody incubation, and wash steps. Sections were incubated overnight at 4° C. with primary antibodies: chicken anti-tyrosine hydroxylase (Ayes Labs), rabbit anti-Calcitonin Receptor (Thermo Scientific), and sheep anti-GFRAL antibody (R&D Systems). After washes, sections were incubated with secondary Alexa-conjugated antibodies (Invitrogen) overnight at 4° C. Tissue sections were brush-transferred and mounted on slides with Fluoromount-G (Southern Biotech). Epifluorescent images were obtained using a Leica DM 4000 B equipped with a Leica DFC 500 camera. Overlays and additional image processing were done using Image J software.

    [0291] .sup.125I-GDF15 binding to human GFRAL.

    [0292] HEK293 or HEK293-human GFRAL cells were suspended in ice-cold binding buffer (Dulbecco's modified Eagle's medium containing 2 mg/ml BSA, and 25 mM HEPES, pH 7.4) and transferred to pre-wetted Multiscreen filter plates (96-well Dura PVDF 0.65 um Opaque; Millipore), which were kept on ice. Typically, 1×10.sup.5 of cells in 25 μl were used per well. Cells were incubated with 25 μl of binding buffer containing serial dilution of .sup.125I-GDF15 (2 fold serial dilution from 1000 pM to 0.1 pM final reaction concentration) with or without unlabeled GDF15 (500 nM final reaction concentration) for 2 hr at 4° C. Plates were then transferred to a vacuum filtration manifold (Pall Corporation) and supernatants were filtered. Each well was washed four times with 100 μl of ice cold binding buffer. Bound .sup.125I-GDF15 were measured by scintillation counting (150 μl/well of EcoLite, MP Biomedicals, Santa Anna, Calif.) using MicroBeta2 Plate Counter (Perkin Elmer). Bound (molecule/cell) was calculated according to a standard curve correlating CPM and molarity of .sup.125I-GDF15.

    [0293] Expression and Purification of GFRAL-Fc.

    [0294] Mature GFRAL-Fc proteins were secreted into the culture medium of HEK293 cells transiently transfected with a plasmid containing GFRAL-Fc. Recombinant GFRAL-Fc was purified using Protein A capturing followed by Phenyl hydrophobic interaction chromatography.

    [0295] GDF15-Mediated Cellular Response.

    [0296] The PathDetect Trans-reporting System (Agilent Technology) was adapted. Briefly, HEK293T cells were co-transfected with the following plasmid pairs: pFA-Elk/pFR-Luc (trans-Activator/trans-Reporter; Agilent Technology) and GFRAL/RET9 expression constructs (from human, Cynomolgus monkey, rat or mouse) using Fugene 6 (Promega). Transfected cells were cultured in DMEM with 10% FBS at 37° C. overnight. Cells were treated with ligands, such as GDF15 or GDNF (Peprotech) in the presence or absence of inhibitors, such as GFRAL-Fc or an anti-GDF15 antibody (1M03) at 37° C. for 6 hr. In experiments where anti GFRAL antibodies were included (FIGS. 12 and 13), the cells were pre-treated with antibodies for an hour prior to incubation with GDF15. The reporter luciferase activities were determined using Bright Glo (Promega) as the substrate and detected by EnSpire Multimode Plate Reader (Perkin Elmer). Upon nonlinear regression curve fit (GraphPad Prism), the EC.sub.50 for GDF15 activity toward human, cynomolgus monkey, rat and mouse receptors were 2.1 pM, 5.2 pM, 6.2 pM, and 1.5 pM, respectively.

    [0297] GFRAL-Fc or an anti-GDF15 antibody (1M03) were added at following concentrations (nM): 100, 33.33, 11.11, 3.7, 1.23, 0.41, 0.14, 0.05, 0.02, and 0.01. Anti-GFRAL antibodies (12B10, 16J20, 24G2, 29G7, 44I10) were added at following concentrations (nM): 500, 166.67, 55.56, 18.52, 6.17, 2.06, 0.69, 0.23, 0.08, and 0.03. IC.sub.50 for GFRAL-Fc and 1M03 for inhibiting 1 nM GDF15-mediated receptor activation were 9.5 nM and 11.7 nM, respectively. IC.sub.50 for inhibiting 10 pM GDF15-mediated receptor activation for 16J20, 24G2, 29G7, and 44I10 were 61.1 nM, 55.9 nM, 25.7 nM, and 31.4 nM, according to nonlinear regression curve fit using GraphPad Prizm. Antibody 1M03 is a mouse monoclonal antibody that was generated using mature hGDF15 protein as the antigen.

    [0298] Radio-Ligand Competition Binding.

    [0299] HEK293-GFRAL cells were suspended in ice-cold binding buffer (Dulbecco's modified Eagle's medium containing 2 mg/ml BSA, and 25 mM HEPES, pH 7.4) and transferred to pre-wetted Multiscreen filter plates (96-well Dura PVDF 0.65 um Opaque; Millipore), which were kept on ice. Typically, 1×10.sup.5 of cells in 25 μl were used per well. 12.5 μl/well of binding buffer containing 0.6 nM .sup.125I-GDF15 was added. 12.5 μl/well of unlabeled inhibitors at varying concentrations were then added and incubated for 2 hrs at 4° C. Plates were then transferred to a vacuum filtration manifold (Pall Corporation) and supernatants were filtered. Each well was washed four times with 100 μl of ice cold binding buffer. Bound .sup.125I-GDF15 (CPM) were measured by scintillation counting (150 μl/well of EcoLite, MP Biomedicals, Santa Anna, Calif.) using MicroBeta2 Plate Counter (Perkin Elmer). The concentrations (in nM) of unlabeled inhibitors used in this experiment are as follows. GDF15 and GFRAL-Fc: 100, 25, 6.25, 1.56, 0.39, 0.098, 0.024, 0.006; 1M03: 1000, 250, 62.5, 15.63, 3.91, 0.98, 0.24, 0.06. IC.sub.50 for inhibiting 0.15 nM of .sup.125I-GDF15 binding to HEK-293-GFRAL cells are 0.4 nM, 0.56 nM, and 0.66 nM for GDF15, GFRAL-Fc, and 1M03, respectively, according to nonlinear regression curve fit using GraphPad Prism.

    [0300] ELISA-Based Competition Binding Assay.

    [0301] An antibody for human Fc (Jackson ImmunoResearch) was coated onto 96-well Nunc Maxisorp plates (Fisher Scientific) at 1 μg/ml in PBS for overnight at 4 C. The wells were washed three times with washing buffer prepared from PBS-TWEEN tablets (EMD Chemicals). The wells were blocked by incubating with 1% BSA in PBS for 1 hr at RT. After washing, 1 μg/ml of GFRAL-Fc was added and incubated for 2 hr at RT. The wells were washed three times and dose titration of purified anti-GFRAL antibodies were added and incubated for 1 hr at RT. Biotinylated-GDF15 was then added to 100 ng/ml and incubated for 1 hr at RT. The wells were washed three times and incubated with HRP-conjugated streptavidin (1:5000 dilution, Life Technology) for 1 hr at RT. The wells were washed and treated with TMB (Life Technology) for 15 min at RT. OD450 was measured using SpectroMax plate reader (Molecular Devices). The antibodies were added at the following concentrations (nM): 62.5, 20.8, 6.9, 2.3, 0.8, 0.3, 0.09, 0.03. IC.sub.50 for inhibiting 4 nM of biotinylated GDF15 binding to immobilized GFRAL-Fc are (in nM) 4.9, 0.6, 0.9, 0.8, and 0.4 for antibodies 12B10, 16J20, 24G2, 29G7, and 44I10, respectively.

    [0302] GFRAL-RET Complex.

    [0303] HEK293 cells were transfected with cDNA encoding RET51 (control) or with cDNAs encoding GFRAL and RET51 using Lipofectamine® 2000 (Life Technology) according to manufacturer's instructions. Two days after transfection, cells were starved in serum-free DMEM for 1 hour and then treated with 100 ng/ml of GDF15 for 15 minutes. Culture media were aspirated and the cells were lysed in ice-cold RIPA buffer (Sigma) containing protein phosphatase inhibitors cocktail I and II (Sigma), protease inhibitor mixture (Roche), NaF (1 mM) and NaVO.sub.4 (1 mM). 1 mg equivalent of cell lysates were incubated with 20 μg of anti-RET51 antibody (Santa Cruz Biotechnology) for 45 min at 4° C. 100 μl of Protein G Dynabeads® (Life Technology) were added and incubated for 1.5 hr at 4° C. The beads were washed three times with PBS and the bound proteins were eluted with 60 μl of SDS-PAGE buffer. 15 μl of eluted lysates were subjected to SDS-PAGE followed by western blotting using anti-Ret51 antibody (Santa Cruz Biotechnology) or anti-GFRAL antibody (R&D Systems).

    [0304] Anti-GFRAL Antibody Production.

    [0305] Recombinant proteins containing GFRAL ECD were used as immunogens to immunize B6/129 mice. Hybridoma supernatants were screened for binding to GFRAL-expressing CHO cells using high content imaging system, Cell InSight (Thermo Scientific) or by binding to GFRAL-Fc using ELISA.

    Example 1: Identification of GDF15 Receptor

    [0306] To identify a binding partner for mature human GDF15, a number of assays were performed. In order to identify a tissue that expresses a protein that binds to GDF15, .sup.125I-GDF15 was used to stain tissue sections from mouse and rats, including brain tissue sections. In addition, human biological fluid including urine, ascites fluid, and amniotic fluid was assayed for presence of GDF15 binding partner. FLAG tagged GDF15 (FLAG-GDF15) was incubated with human urine, ascites fluid, and amniotic fluid and proteins bound to the FLAG-GDF15 were analyzed by mass spectrometry. Proteins present in human urine, ascites fluid, and amniotic fluid were chromatographically fractionated followed by detection by binding to .sup.125I-GDF15.

    [0307] Screening of cDNA libraries from mouse hypothalamus and human placenta and cDNA clones of membrane proteins for binding to GDF15 was also performed. A subset (37) of ˜4000 cDNA clones of membrane proteins were expressed in HEK293T cells and screened for binding to Fc-GDF15 (FIG. 1B; Dimer of DhCpmFc(−)-(G4S)4-GDF15:DhCpmFc(+) as disclosed in PCT/US2013/023465). Membrane protein cDNA expression constructs (0.08 μg/well) were reverse transfected in HEK-293T cells (ATCC) in 384-well poly-D-lysine coated plates (Greiner) using Lipofectamine 2000 (Invitrogen Corporation, Carlsbad, Calif.) according to manufacturer's instructions. Transfected cells were cultured for three days. Cells were washed with DMEM (no phenol red; Corning Cellgro) three times, and incubated with Fc-GDF15 (5 μg/ml) in the same medium at room temperature for 1.5 hours. An Alexa647-conjugated goat anti-human Fc antibody (Jackson Immunologicals) was added to 0.33 ng/mL and Hoescht33342 (6.7 ng/ml) (Sigma) was added to the cells and incubated for 40 minutes. Plates were washed three times with cold HBSS/M2+(Cellgro), and fixed for 5 minutes with 3.7% formalin in PBS. Fluorescence intensities were measured using Cell InSight (Thermo Scientific).

    [0308] Mouse GFRAL was identified as a membrane protein that bound to Fc-GDF15. The subset of cDNA clones screened also included TGFβ family receptors and GDNF family receptors (GFRAs) which did not bind to GDF15. (FIG. 5).

    Example 2: GFRAL is Expressed in Brain Stem

    [0309] Tissues from mice were analyzed by quantitative RT-PCR to identify organs that express GFRAL. GFRAL RNA was almost exclusively expressed in brain stem (FIG. 6A). Tissue harvested from different regions of the central nervous system as well as eye was analyzed by RT-PCR and the expression of GFRAL in brain stem was confirmed (FIG. 6B).

    [0310] Using RNA in situ hybridization, the expression of GFRAL mRNA in mouse brain sagittal sections was examined. Upon careful inspection, definitively positive staining of GFRAL was only observed in the area postrema region of brain stem. Thus, mouse GFRAL appears to be expressed exclusively in area postrema of brain stem.

    [0311] Using indirect immunofluorescence staining, the expression of GFRAL protein in mouse brain sagittal sections was examined. Upon careful inspection, the definitively positive staining of GFRAL protein was only observed in the area postrema region of brain stem. Co-staining for GFRAL with neuronal markers including tyrosine hydroxylase (TH), calcitonin receptor (CT), and GLP-1 receptor was performed. GFRAL expression partially overlaps with TH- or GLP-1 receptor-expressing neurons but are excluded from CT positive neurons. These data indicate that GFRAL is expressed in a unique subset of neurons in area postrema.

    Example 3: GDF15 Binds to GFRAL at Sub-Nanomolar Affinity

    [0312] To determine the binding affinity of GDF15 to GFRAL, radio-labeled .sup.125I-GDF15 was used to bind HEK293 cells expressing human GFRAL (FIG. 2A) under equilibrium conditions. As shown in FIG. 7A, binding of .sup.125I-GDF15 to HEK293-GFRAL cells followed a typical ligand-receptor binding hyperbolic curve; in contrast, .sup.125I-GDF15 binding to control HEK293T cells is linear representing non-specific interaction. Excess amount of unlabeled GDF15 (500 nM) reduced the .sup.125I-GDF15-GFRAL binding to ‘non-specific’ background level. This further supported the specificity of .sup.125I-GDF15 and GFRAL interaction. The binding affinity of .sup.125I-GDF15-GFRAL is around 200 pM (FIG. 7B), which is also typical for high affinity ligand-receptor interaction.

    Example 4: GDF15 Stimulates Erk Signal Transduction Pathway Via GFRAL and RET

    [0313] The extracellular domain of GFRAL shares sequence homology with GDNF family receptor alpha (GFRA) family receptors. GFRA receptors are anchored to cell surface by glycosylphosphatidylinositol(GPI). GFRA receptors, upon binding to their ligand, associate with receptor tyrosine kinase RET and mediate activation of RET. Activated RET becomes tyrosine phosphorylated, which induces an intracellular signaling cascade including phosphorylation of transcription factor ELK1.

    [0314] To test the hypothesis that GDF15 mediates cellular response, such as, ELK1 phosphorylation, via GFRAL-RET receptor complex, cells expressing both hGFRAL and human RET9 (FIG. 3B) were assayed for response to GDF15. HEK293T cells were co-transfected with expression plasmids for hGFRAL and hRET9, together with a reporter system that includes a GAL4DBD-ELK1 fusion plasmid and a GAL4-UAS-Luciferase reporter gene (PathDetect Trans-Reporting Systems, Agilent Technology).

    [0315] As shown in FIG. 8, GDF15 mediates expression of luciferase in a dose-dependent manner. In contrast, GDNF, which mediates RET activation by binding to GFRA1, does not activate GFRAL-RET. Both GFRAL and RET are required for GDF15-mediated cellular response as omitting either one of these receptors abrogated luciferase expression. This result supports the hypothesis that GDF15 exerts its biological function via the GFRAL-RET receptor system.

    Example 5: Human GDF15 Activates GFRAL-RET Receptor Systems from Human, Cynomolgus Monkey, Rat and Mouse

    [0316] The conservation of GFRAL-RET receptor system in response to GDF15 treatment was examined using the reporter assay described in Example 4. GFRAL and RET9 receptors from human, cynomolgus monkey, rat and mouse were transfected into HEK293T cells and the reporter gene activation in response to human GDF15 was measured.

    [0317] As shown in FIGS. 9A-9D, GDF15 dose-dependently mediated cellular response via the GFRAL-RET receptor complex from all four species tested. These data demonstrated that the GDF15/GFRAL-RET ligand/receptor system is conserved.

    Example 6: GFRAL-Fc and an Anti-GDF15 Antibody, 1M03, Inhibit Binding of GDF15 to GFRAL

    [0318] Molecules that inhibit binding of GDF15 to GFRAL were identified using a competition binding experiment. HEK293-GFRAL cells bound to .sup.125I-GDF15 (0.15 nM) were incubated with unlabeled GDF15, GFRAL-Fc or antibody 1M03.

    [0319] GFRAL-Fc includes the extracellular domain of hGFRAL. As shown in FIG. 4, GFRAL-Fc includes a heterologous signal peptide: IgK signal peptide which replaces the endogenous signal peptide (see FIG. 2A). GFRAL-Fc is expressed with the signal peptide which is cleaved upon secretion from the cells. GFRAL-Fc includes the extracellular domain of GFRAL but not the transmembrane domain or the intracellular domain of GFRAL.

    [0320] Unlabeled GDF15, GFRAL-Fc or antibody 1M03 inhibited .sup.125I-GDF15 (0.15 nM) binding to HEK293-GFRAL cells in dose-dependent manner (FIG. 10). The IC.sub.50 for GDF15, GFRAL-Fc, and 1M03 were 0.4 nM, 0.56 nM, and 0.66 nM, respectively.

    Example 7: GFRAL-Fc and Anti-GDF15 Antibody Inhibit GDF15-Mediated Receptor Activation

    [0321] Binding of GFRAL-Fc or an anti-GDF15 antibody (1M03) to GDF15 inhibits the GDF15 mediated activation of GFRAL-RET receptor complex. Effect of GFRAL-Fc and 1M03 on GDF15 mediated activation of GFRAL-RET receptor complex was examined using the reporter assay described in Example 4. GFRAL-Fc and 1M03 dose-dependently inhibited GDF15 (1 nM)-mediated reporter activation in HEK293T cells expressing GFRAL and RET (FIG. 11). The IC.sub.50 for GFRAL-Fc and 1M03 were 9.5 nM and 11.7 nM, respectively.

    Example 8: Anti-GFRAL Antibodies Inhibit Binding of GDF15 to GFRAL

    [0322] Anti-GFRAL antibodies were generated using GFRAL ECD as described in materials and methods. Several monoclonal anti-GFRAL antibodies were examined for their ability to interfere with GDF15 binding to GFRAL. GFRAL-Fc (FIG. 4) was immobilized on plates for conducting ELISA based binding assay as described in the materials and methods. As shown in FIG. 12, biotinylated-GDF15 (4 nM) binding to the GFRAL-Fc immobilized on plates was competed by these anti-GFRAL antibodies in a dose-dependent fashion. The IC.sub.50 for anti-GFRAL ECD antibodies: 12B10, 16J20, 24G2, 29G7, and 44I10 were 4.9 nM, 0.6 nM, 0.9 nM, 0.8 nM, and 0.4 nM, respectively.

    Example 9: Anti-GFRAL Antibodies Inhibit GDF15-Mediated Receptor Activation

    [0323] Effect of anti-GFRAL antibodies on the GDF15-mediated GFRAL-RET receptor complex activation was examined using the reporter assay described in Example 4. Four anti-GFRAL ECD antibodies, 16J20, 24G2, 29G7 and 44I10, dose-dependently inhibited GDF15 (10 pM)-mediated reporter activation in HEK293T cells expressing GFRAL and RET (FIG. 13). As illustrated by FIG. 12, the 12B10 antibody, which inhibits biotinylated-GDF15 binding to GFRAL-Fc less efficiently compared to the other anti-GFRAL ECD antibodies, failed to inhibit GDF15-mediated receptor activation.

    Example 10: GFRAL Interacts with Ret Independent of GDF15

    [0324] To examine the interaction between GFRAL and RET, immunoprecipitation of RET was performed. HEK293 cells transfected with a plasmid encoding RET alone or co-transfected with plasmids encoding RET and GFRAL were treated with PBS only or 100 ng/ml of GDF15 for 15 minutes. Whole cell lysates from the treated cells were subjected to immunoprecipitation using an anti-Ret51 antibody followed by western blot analysis.

    [0325] As shown in FIG. 14, GFRAL when co-expressed with RET on HEK293 cells, was pulled down by an anti-Ret antibody. This interaction is independent of GDF15 since equivalent GFRAL was pulled down from GFRAL/RET-expressing cells treated with GDF15 or with PBS. This result indicated that GFRAL-Ret complex is formed on the cell surface independent of GDF15.

    Example 11: Complex Formation and Crystallization of a GFRAL/GDF15 Complex

    [0326] A complex of a GFRAL protein and a GDF15 protein was made by mixing 1.2 molar excess of a GFRAL (W115-E351) protein with 1 molar GDF15 protein subunit (0.5 molar GDF15, which is a homodimer of two GDF15 subunits linked by a pair of disulfide bonds). The complex was purified by size exclusion chromatography to remove excess GFRAL. The GFRAL/GDF15 complex was crystallized by mixing 1 μL protein at 5 mg/ml with 0.5 μL reservoir solution and 0.5 μL seed in a crystallization drop, with the reservoir solution containing 1.0 mL of 0.1 M Bis-Tris pH 6.0, 1.5 M (NH.sub.4).sub.2SO.sub.4 and 10% ethylene glycol. The seed crystals were obtained from a crystallization condition including a reservoir solution of 0.1 M Bis-Tris pH 6.0 and 1.5 M (NH.sub.4).sub.2SO.sub.4. The crystallization setup was kept at room temperature in Rigaku 24 well clover leaf plate. The crystallization drop showed small needle crystals after three days of incubation.

    [0327] An exemplary small needle crystal of a comples of a GFRAL protein and a GDF15 protein is shown in FIG. 15.

    [0328] The molecular model was not available for GFRAL, hence NaBr soaking was used to determine crystal phasing. A GFRAL/GDF15 crystal obtained as described above was soaked with 0.5 M NaBr and 0.75 M NaBr containing reservoir solution. After 30 minutes, 0.5 M NaBr soaked crystals were in good condition, whereas 0.75 M NaBr soaking yielded cracked crystals. Crystals from both soaks and un-soaked crystals were mounted with 30% EG as a cryo-protectant.

    [0329] The model described herein provides the first structural information for a GFRAL protein and the binding of a GFRAL protein to a GDF15 protein.

    Example 12: Data Collection and Structure Determination

    [0330] GFRAL/GDF15 complex crystals were obtained and harvested from a 0.1 M Bis-Tris pH 6.0, 1.5 M (NH.sub.4).sub.2SO.sub.4 and 10% ethylene glycol reservoir condition as soaked and unsoaked crystals from 0.5 M and 0.7 M NaBr soaks. The crystals were treated with the mother liquor supplemented with 20% ethylene glycol as cryoprotectant and flash-frozen in liquid nitrogen. These crystals were then examined for x-ray diffraction at the synchrotron beamline IMCA-CAT, Advanced Photon Source, Argonne National Lab. The crystal diffracted up to 2.28-2.20 Å resolution.

    [0331] X-ray diffraction statistics for exemplary GFRAL/GDF15 complex crystals are shown in Table 1.

    TABLE-US-00016 TABLE 1 Data collection statistics Crystal I Wave length 0.9786 Å Space group P2.sub.1 Unit cell (Å) a = 75.352 b = 88.768 c = 121.293 Resolution (Å).sup.† 50-2.20 (2.28-2.20) Number of measurements 118,710 Number of unique reflections 20,379 R.sub.sym (%).sup.† 0.09 (0.58) Completeness (%).sup.† 97.4 (85.4) I/σ .sup.† 18.9 (2.2) Redundancy.sup.† 5.8 (4.9) Molecules in the A.U. 1 GFRAL 1 GDF15 .sup.†The parenthesis is for the highest resolution shell in Å.

    [0332] Molecular replacement of GFRAL/GDF15 was performed by using the scaled dataset with a previously solved GFRAL/GDF15 complex at 3.2 Å resolutions as a starting model and the rigid body refinement (See Vagin, A. A., et al., (2004) “REFMAC5 dictionary: Organization of prior chemical knowledge and guidelines for its use.” Acta Crystallogr. D 60:2284-2295) and initial positional refinement was completed in REFMAC5 as implemented in CCP4. Several rounds of model rebuilding resulted in structures of the GFRAL/GDF15 complex.

    [0333] Exemplary structures of the a comples of a GFRAL protein and a GDF15 protein are shown, for example, in FIGS. 17-24B.

    [0334] Inspection of the initial electron density maps showed unambiguous density for GFRAL and GDF15. After rigid body refinement, several rounds of model building and restrained refinement were performed using COOT (See Emsley, P. and Cowtan, K. (2004) “COOT: model-building tools for molecular graphics.” Acta Crystallogr. D 60:2126-2132). After placement of the solvent molecules final refinement was completed.

    [0335] The atomic coordinates from the x-ray diffraction patterns are found in Table 6.

    [0336] Refinement statistics for exemplary crystals are shown in Table 2.

    TABLE-US-00017 TABLE 2 Refinement Statistics Refinement Range (Å) 35.82-2.20 R.sub.cryst (%) 20.1 R.sub.free (%) 26.2 Molecules GDF15, GFRAL;  1.1; 132 Water molecules Bond lengths (Å) 0.019 Bond angles (°) 1.943 Average B-factors (Å.sup.2) Overall Main chain atoms 43.9, 57.6 (GDF15, GFRAL) Side chain atoms 51.2, 66.8 (GDF15, GFRAL) Water molecules 56.7 Ramachandran Plot (%) Overall Favored 96.3 Allowed 2.7 Disallowed 1.0

    [0337] The clear electron density for GFRAL in an exemplary GFRAL/GDF15 complex crystal is illustrated in FIG. 16. FIG. 16 shows an electron density map (2fo-fc) for the GFRAL molecule calculated with 2.20 Å resolution data and contoured at the 1σ level. The GFRAL residues are clearly visible.

    Example 13: Crystal Structure of GFRAL/GDF15 Complex

    [0338] The crystal structure of a complex of a GFRAL protein and a GDF15 protein was determined.

    [0339] Core interaction interface amino acids were determined as being the amino acid residues (on a protein such as GFRAL) with at least one atom less than or equal to 4.5 Å from the GFRAL interacting proteins (such as GDF15). 4.5 Å was chosen as the core region cutoff distance to allow for atoms within a van der Waals radius plus a possible water-mediated hydrogen bond.

    [0340] Boundary interaction interface amino acids were determined as the amino acid residues (on a protein such as GFRAL) with at least one atom less than or equal to 5 Å from core interaction interface amino acids on GFRAL that interact with GFRAL interacting proteins (such as GDF15). Less than or equal to 5 Å was chosen as the boundary region cutoff distance because proteins binding to residues less than 5 Å away from core interaction interface amino acids on GFRAL will be within the van der Waals radius of GFRAL interacting proteins.

    [0341] Amino acids that met these distance criteria were calculated with the Molecular Operating Environment (MOE) program from CCG (Chemical Computing Group).

    [0342] FIG. 17 shows an exemplary illustration of a heterodimeric GFRAL/GDF15 complex, as found in the asymmetric unit of a GFRAL/GDF15 protein crystal. The dimeric molecule GDF15 has one intermolecular disulfide link, which was found to be weak due to radiation damage. One side of a GDF15 molecule can form a dimer in the asymmetric unit. FIG. 18 shows an exemplary dimeric arrangement of the GFRAL/GDF15 hetero dimers in a GFRAL/GDF15 crystal.

    [0343] FIGS. 19A-19B illustrate the extent of the protein-protein contacts on a GFRAL-GDF15 interface. The contact region on GFRAL is indicated by light gray arrows; the contact region on GDF15 is indicated by the black arrows.

    [0344] FIG. 20 shows that three α-helices of GFRAL are involved in a GFRAL/GDF15 interface. Multiple disulfide bridges appear to stabilize the structural arrangement of the three GFRAL α-helices.

    [0345] FIGS. 21A-21D illustrate different aspects of a GFRAL/GDF15 interface and the core and boundary amino acid residues of a GFRAL protein and a GDF15 protein involved in forming a GFRAL/GDF15 interface. The GFRAL protein and the GDF15 protein are depicted as ribbon diagrams with residues in the GFRAL/GDF15 interface shown in a space-filled surface representation. FIGS. 21A-21C show core interaction interface amino acids of the GFRAL protein and the GDF15 protein. FIG. 21D shows boundary interaction interface amino acids.

    [0346] The amino acid sequence of a full-length precursor human GFRAL protein is shown below:

    TABLE-US-00018 GFRAL sequences SEQ ID NO: 9         10         20         30         40  MIVFIFLAMG LSLENEYTSQ TNNCTYLREQ CLRDANGCKH          50         60         70         80 AWRVMEDACN DSDPGDPCKM RNSSYCNLSI QYLVESNFQF         90        100        110        120 KECLCTDDFY CTVNKLLGKK CINKSDNVKE DKFRWNLTTR        130        140        150        160 SHHGFKGMWS CLEVAEACVG DVVCNAQLAS YLKACSANGN        170        180        190        200 PCDLKQCQAA IRFFYQNIPF NIAQMLAFCD CAQSDIPCQQ        210        220        230        240  SKEALHSKTC AVNMVPPPTC LSVIRSCQND ELCRRHYRTF         250        260        270        280 QSKCWQRVTR KCHEDENCIS TLSKQDLTCS GSDDCKAAYI        290        300        310        320 DILGTVLQVQ CTCRTITQSE ESLCKIFQHM LHRKSCFNYP        330        340        350        360 TLSNVKGMAL YTRKHANKIT LTGFHSPFNG EVIYAAMCMT        370        380        390 VTCGILLLVM VKLRTSRISS KARDPSSIQI PGEL

    [0347] GFRAL amino acids at the interface of the GFRAL/GDF15 complex are shown in Table 3.

    TABLE-US-00019 TABLE 3 GFRAL Residues Binding GDF15* Core interaction interface Boundary interaction amino acids interface amino acids GLY140 SER156 LEU148 GLN147 ALA149 LEU148 ALA146 ALA149 VAL142 SER150 ASN145 TYR151 VAL139 LEU152 ALA135 LYS153 GLU136 ALA154 LEU152 CYS155 LEU132 PHE174 SER201 TYR175 ALA204 GLU136 LEU205 ALA137 LYS153 CYS138 ILE196 VAL139 PRO197 GLY140 GLN200 ASP141 VAL142 VAL143 CYS144 ASN145 ALA146 LEU186 CYS189 CYS191 ALA192 GLN193 SER194 ASP195 ILE196 PRO197 CYS198 GLN199 GLN200 SER201 LYS202 GLU203 ALA204 LEU205 HIS206 SER207 SER130 CYS131 LEU132 GLU133 VAL134 ALA135 *GFRAL amino acid numbering according to SEQ ID NO: 9

    [0348] The amino acid sequence of mature human GDF15 is shown below:

    TABLE-US-00020 (SEQ ID NO: 6) ARNGDHCPLG PGRCCRLHTV RASLEDLGWA DWVLSPREVQ VTMCIGACPS QFRAANMHAQ IKTSLHRLKP DTVPAPCCVP ASYNPMVLIQ KTDTGVSLQT YDDLLAKDCH CI

    [0349] GDF15 residues at the interface of the GFRAL/GDF15 complex are shown in Table 4.

    TABLE-US-00021 TABLE 4 Residues on GDF15 that bind to GFRAL* Core interaction interface Boundary interaction amino acids interface amino acids SER35 SER35 LEU34 VAL33 THR94 LEU34 GLY95 ASP93 GLN40 THR94 VAL96 GLY95 LEU98 VAL39 PRO36 GLN40 VAL87 ARG37 LEU88 GLU38 ILE89 VAL96 ASP102 SER97 THR100 LEU98 PRO85 PRO36 MET86 VAL87 LEU88 ILE89 VAL41 GLN90 LYS91 THR92 THR42 LEU104 LEU105 TYR101 ASP102 ASP103 GLN99 THR100 LEU24 TRP32 TRP29 ARG21 THR19 TYR83 ASN84 PRO85 MET86 VAL20 *GDF15 amino acid numbering according to SEQ ID NO: 6

    Example 14: Model of GFRAL/RET/GDF15 Complex

    [0350] The RET/GFRα1/GDNF ternary complex described by Goodman et al. (2014) CELL REPORTS 8, 1894-1904 (PDB 4UX8) was used as a template to build a model of the complex of GFRAL/GDF15/RET (from GFRAL/GDF15 structure, see, e.g., Examples 11-13). The RET/GFRα1/GDNF template resulted from an electron microscopy reconstruction of a reconstituted mammalian RET(ECD)-GDNF-GFRα1 ternary complex (Goodman et al., supra).

    [0351] To compare the structural similarity of the GFRAL/GDF15 crystal structure from Example 13 and the structure of GFRα1/GDNF in the RET/GFRα1/GDNF template, the GFRAL structure in GFRAL/GDF15 crystal was superposed with GFRα1 in GFRα1/GDNF/RET model (PDB 4UX8) using MOE from CCG. The high quality of the superposition, and therefore the structural similarity of the GFRAL/GFRα1 and GFRAL/GDF15 complexes was demonstrated by an RMSD of GFRAL/GFRα1 backbone residues of 2.21 Å. This ternary complex model, including the GFRAL/GDF15 structure and the RET structure, was used to map the interactions between GFRAL and RET.

    [0352] FIGS. 22A-B illustrate exemplary aspects of the superposition of GFRAL and GFRα1 in 4XU8. RMSD of backbone residues was 2.21 Å.

    [0353] FIGS. 23A-D illustrate exemplary aspects of the interaction of a GFRAL protein with a RET protein in a RET/GFRAL/GDF15 model. In FIG. 23A, interacting GFRAL and GDF15 residues at the GFRAL/GDF15 interface as modeled are represented by stick models. In FIG. 23B, the RET-interacting residues on GFRAL are depicted in a space filled surface model. In FIG. 23C, the space filled surface model of the core interaction residues are highlighted on GFRAL and RET. In FIG. 23D, the space filled surface model of the boundary interaction residues are highlighted on GFRAL and RET.

    [0354] FIGS. 24A-B illustrate the core and boundary amino acid residues on a GFRAL protein identified in space filled surface models at the modeled RET interface. In FIG. 24A, core residues on GFRAL as modeled are shown in a darker grey in a space-filled surface model. In FIG. 24B, boundary residues on GFRAL as modeled are shown in a lighter grey in a space filled surface model.

    [0355] Based on this modeling, a number of GFRAL residues were identified for interaction with RET residues, as shown in Table 5 Å. Additionally, a number of RET residues were identified for interaction with GFRAL residues, as shown in Table 5B.

    TABLE-US-00022 TABLE 5A Residues on GFRAL that bind to RET in RET/GFRAL/GDF15 Model Core interaction Boundary interaction interface amino acids interface amino acids GLN246 ILE224 ARG247 ARG225 ARG250 GLN241 LYS251 SER242 CYS252 LYS243 ASP255 CYS244 GLU256 TRP245 ASN257 GLN246 CYS258 ARG247 ILE259 VAL248 SER260 THR249 THR261 ARG250 LEU262 LYS251 THR297 CYS252 GLN298 HIS253 SER299 GLU254 ASP255 GLU256 ASN257 CYS258 ILE259 SER260 THR261 LEU262 SER263 LYS264 GLN265 ASP266 LEU267 THR268 THR295 ILE296 THR297 GLN298 SER299 GLU300 GLU301 SER302 LEU303 ILE306 PHE307 MET310

    TABLE-US-00023 TABLE 5B Residues on RET that bind to GFRAL in RET/GFRAL/GDF15 Model Core interaction Boundary interaction interface amino acids interface amino acids GLY74 ASP34 THR75 ALA35 TYR76 TYR36 ARG77 HIS71 THR78 TYR73 ASN113 LEU72 ARG114 GLY74 PHE116 TYR76 TYR122 THR75 GLN138 ARG77 ARG144 THR78 PRO305 ARG79 ALA306 LEU80 LEU310 LEU109 SER110 VAL111 ARG112 ASN113 GLY115 ARG114 PHE116 PRO117 LEU118 THR120 VAL121 TYR122 LEU123 LYS124 CYS137 GLN138 TRP139 PRO140 GLY141 CYS142 ALA143 ARG144 VAL145 TYR146 PHE147 ARG231 ASP264 ASP300 VAL303 VAL304 PRO305 ALA306 SER307 GLY308 GLU309 LEU310 ARG312 VAL311 ASN336

    TABLE-US-00024 TABLE 6 1 2 3 4 5 6 7 8 9 10 11 12 13 ATOM 1 N ASP A 5 −29.647 −38.53 22.338 1 107.89 A N ATOM 2 CA ASP A 5 −29.096 −38.791 20.97 1 108.54 A C ATOM 3 CB ASP A 5 −29.843 −39.971 20.331 1 100.53 A C ATOM 4 CG ASP A 5 −29.07 −40.64 19.218 1 86.72 A C ATOM 5 OD1 ASP A 5 −27.842 −40.461 19.118 1 79.65 A O ATOM 6 OD2 ASP A 5 −29.702 −41.388 18.449 1 91.44 A O ATOM 7 C ASP A 5 −29.229 −37.55 20.075 1 107.46 A C ATOM 8 O ASP A 5 −30.341 −37.026 19.939 1 108.4 A O ATOM 9 N HIS A 6 −28.127 −37.121 19.436 1 105.39 A N ATOM 10 CA HIS A 6 −28.13 −35.922 18.544 1 100.79 A C ATOM 11 CB HIS A 6 −26.77 −35.188 18.564 1 109.43 A C ATOM 12 CG HIS A 6 −25.631 −35.935 17.932 1 118.36 A C ATOM 13 ND1 HIS A 6 −25.266 −35.76 16.614 1 123.98 A N ATOM 14 CE1 HIS A 6 −24.212 −36.512 16.344 1 124.11 A C ATOM 15 NE2 HIS A 6 −23.865 −37.151 17.448 1 122.91 A N ATOM 16 CD2 HIS A 6 −24.727 −36.798 18.458 1 121.3 A C ATOM 17 C HIS A 6 −28.657 −36.133 17.092 1 91.62 A C ATOM 18 O HIS A 6 −28.298 −35.402 16.164 1 93.2 A O ATOM 19 N CYS A 7 −29.508 −37.146 16.935 1 75.73 A N ATOM 20 CA CYS A 7 −30.401 −37.322 15.804 1 63.79 A C ATOM 21 CB CYS A 7 −30.888 −38.78 15.796 1 52.38 A C ATOM 22 SG CYS A 7 −32.172 −39.202 14.618 1 54.69 A S ATOM 23 C CYS A 7 −31.587 −36.369 15.975 1 61.67 A C ATOM 24 O CYS A 7 −32.353 −36.517 16.912 1 65.41 A O ATOM 25 N PRO A 8 −31.763 −35.403 15.061 1 68.82 A N ATOM 26 CA PRO A 8 −32.972 −34.563 15.074 1 69.64 A C ATOM 27 CB PRO A 8 −32.921 −33.847 13.718 1 69.48 A C ATOM 28 CG PRO A 8 −31.478 −33.831 13.327 1 70.01 A C ATOM 29 CD PRO A 8 −30.866 −35.064 13.935 1 72.51 A C ATOM 30 C PRO A 8 −34.292 −35.346 15.187 1 74.75 A C ATOM 31 O PRO A 8 −35.176 −34.932 15.91 1 78.12 A O ATOM 32 N LEU A 9 −34.397 −36.49 14.514 1 72.61 A N ATOM 33 CA LEU A 9 −35.657 −37.222 14.415 1 69.49 A C ATOM 34 CB LEU A 9 −35.634 −38.147 13.197 1 71.26 A C ATOM 35 CG LEU A 9 −35.228 −37.563 11.837 1 71.78 A C ATOM 36 CD1 LEU A 9 −35.448 −38.642 10.801 1 73.76 A C ATOM 37 CD2 LEU A 9 −35.975 −36.288 11.443 1 74.5 A C ATOM 38 C LEU A 9 −36.021 −38.065 15.64 1 71.64 A C ATOM 39 O LEU A 9 −37.008 −38.819 15.594 1 79.87 A O ATOM 40 N GLY A 10 −35.255 −37.948 16.722 1 61.99 A N ATOM 41 CA GLY A 10 −35.484 −38.736 17.919 1 65.08 A C ATOM 42 C GLY A 10 −34.43 −39.824 18.05 1 71.72 A C ATOM 43 O GLY A 10 −34.006 −40.383 17.046 1 67.95 A O ATOM 44 N PRO A 11 −33.986 −40.123 19.287 1 75.85 A N ATOM 45 CA PRO A 11 −33.041 −41.212 19.551 1 76.1 A C ATOM 46 CB PRO A 11 −33.286 −41.519 21.033 1 75.37 A C ATOM 47 CG PRO A 11 −33.644 −40.19 21.618 1 76.52 A C ATOM 48 CD PRO A 11 −34.217 −39.33 20.512 1 77.29 A C ATOM 49 C PRO A 11 −33.175 −42.48 18.698 1 74.27 A C ATOM 50 O PRO A 11 −34.303 −42.961 18.476 1 62.1 A O ATOM 51 N GLY A 12 −32.012 −42.952 18.198 1 74.34 A N ATOM 52 CA GLY A 12 −31.853 −44.216 17.445 1 62.04 A C ATOM 53 C GLY A 12 −32.325 −44.234 16.004 1 56.96 A C ATOM 54 O GLY A 12 −32.174 −45.249 15.332 1 74.7 A O ATOM 55 N ARG A 13 −32.861 −43.123 15.509 1 55.39 A N ATOM 56 CA ARG A 13 −33.578 −43.082 14.222 1 59.08 A C ATOM 57 CB ARG A 13 −34.705 −42.046 14.281 1 69.86 A C ATOM 58 CG ARG A 13 −35.749 −42.317 15.362 1 78.39 A C ATOM 59 CD ARG A 13 −36.853 −43.206 14.862 1 79.36 A C ATOM 60 NE ARG A 13 −38.026 −42.449 14.423 1 95.71 A N ATOM 61 CZ ARG A 13 −39.004 −42.009 15.222 1 103.01 A C ATOM 62 NH1 ARG A 13 −40.025 −41.344 14.686 1 107.76 A N ATOM 63 NH2 ARG A 13 −38.99 −42.228 16.545 1 98.59 A N ATOM 64 C ARG A 13 −32.711 −42.712 13.051 1 52.1 A C ATOM 65 O ARG A 13 −33.095 −42.929 11.889 1 55.9 A O ATOM 66 N CYS A 14 −31.573 −42.098 13.339 1 48.83 A N ATOM 67 CA CYS A 14 −30.707 −41.597 12.295 1 48.1 A C ATOM 68 CB CYS A 14 −30.112 −40.231 12.685 1 50.76 A C ATOM 69 SG CYS A 14 −31.304 −38.85 12.8 1 55.94 A S ATOM 70 C CYS A 14 −29.594 −42.605 11.955 1 45.31 A C ATOM 71 O CYS A 14 −29.34 −43.585 12.673 1 42.95 A O ATOM 72 N CYS A 15 −28.966 −42.34 10.818 1 46.46 A N ATOM 73 CA CYS A 15 −27.908 −43.165 10.243 1 42.86 A C ATOM 74 CB CYS A 15 −27.242 −42.39 9.123 1 43.42 A C ATOM 75 SG CYS A 15 −25.83 −43.198 8.361 1 44.21 A S ATOM 76 C CYS A 15 −26.855 −43.551 11.279 1 42.46 A C ATOM 77 O CYS A 15 −26.213 −42.685 11.849 1 39.72 A O ATOM 78 N ARG A 16 −26.71 −44.849 11.506 1 36.74 A N ATOM 79 CA ARG A 16 −25.828 −45.376 12.521 1 39.41 A C ATOM 80 CB ARG A 16 −26.413 −45.146 13.931 1 43.83 A C ATOM 81 CG ARG A 16 −27.496 −46.106 14.375 1 50.15 A C ATOM 82 CD ARG A 16 −28.045 −45.724 15.741 1 58.55 A C ATOM 83 NE ARG A 16 −29.3 −46.406 16.072 1 68.87 A N ATOM 84 CZ ARG A 16 −29.421 −47.682 16.466 1 77.43 A C ATOM 85 NH1 ARG A 16 −30.623 −48.158 16.75 1 80.99 A N ATOM 86 NH2 ARG A 16 −28.38 −48.509 16.547 1 79.65 A N ATOM 87 C ARG A 16 −25.569 −46.866 12.296 1 36.24 A C ATOM 88 O ARG A 16 −26.187 −47.468 11.467 1 37.37 A O ATOM 89 N LEU A 17 −24.699 −47.466 13.086 1 38.89 A N ATOM 90 CA LEU A 17 −24.268 −48.86 12.886 1 37.13 A C ATOM 91 CB LEU A 17 −22.905 −49.073 13.565 1 41.23 A C ATOM 92 CG LEU A 17 −22.1 −50.275 13.12 1 43.12 A C ATOM 93 CD1 LEU A 17 −21.629 −50.095 11.676 1 38.64 A C ATOM 94 CD2 LEU A 17 −20.902 −50.433 14.054 1 44.92 A C ATOM 95 C LEU A 17 −25.227 −49.813 13.53 1 41.04 A C ATOM 96 O LEU A 17 −25.53 −49.65 14.711 1 41.05 A O ATOM 97 N HIS A 18 −25.674 −50.823 12.775 1 43.98 A N ATOM 98 CA HIS A 18 −26.506 −51.928 13.269 1 43.71 A C ATOM 99 CB HIS A 18 −27.856 −51.935 12.514 1 46.48 A C ATOM 100 CG HIS A 18 −28.736 −50.775 12.849 1 58.05 A C ATOM 101 ND1 HIS A 18 −28.472 −49.489 12.411 1 60.73 A N ATOM 102 CE1 HIS A 18 −29.391 −48.673 12.886 1 59.23 A C ATOM 103 NE2 HIS A 18 −30.252 −49.384 13.593 1 64.69 A N ATOM 104 CD2 HIS A 18 −29.86 −50.698 13.599 1 56.48 A C ATOM 105 C HIS A 18 −25.802 −53.298 13.027 1 42.3 A C ATOM 106 O HIS A 18 −25.005 −53.445 12.115 1 36.07 A O ATOM 107 N THR A 19 −26.154 −54.295 13.818 1 39.75 A N ATOM 108 CA THR A 19 −25.625 −55.642 13.686 1 41.06 A C ATOM 109 CB THR A 19 −25.013 −56.059 15.015 1 41.9 A C ATOM 110 OG1 THR A 19 −24.086 −55.048 15.4 1 43.26 A O ATOM 111 CG2 THR A 19 −24.291 −57.393 14.911 1 40.13 A C ATOM 112 C THR A 19 −26.743 −56.596 13.279 1 41.71 A C ATOM 113 O THR A 19 −27.785 −56.584 13.906 1 38.18 A O ATOM 114 N VAL A 20 −26.536 −57.396 12.227 1 40.53 A N ATOM 115 CA VAL A 20 −27.484 −58.429 11.817 1 39.22 A C ATOM 116 CB VAL A 20 −28.044 −58.13 10.41 1 43.74 A C ATOM 117 CG1 VAL A 20 −28.987 −59.232 9.948 1 43.53 A C ATOM 118 CG2 VAL A 20 −28.75 −56.786 10.382 1 46.49 A C ATOM 119 C VAL A 20 −26.786 −59.777 11.741 1 40.46 A C ATOM 120 O VAL A 20 −25.85 −59.956 10.93 1 38.14 A O ATOM 121 N ARG A 21 −27.228 −60.745 12.54 1 39.82 A N ATOM 122 CA ARG A 21 −26.586 −62.066 12.535 1 43.73 A C ATOM 123 CB ARG A 21 −26.987 −62.963 13.685 1 45.08 A C ATOM 124 CG ARG A 21 −26.669 −62.384 15.052 1 58.75 A C ATOM 125 CD ARG A 21 −27.049 −63.345 16.206 1 66.8 A C ATOM 126 NE ARG A 21 −25.873 −63.877 16.923 1 74.5 A N ATOM 127 CZ ARG A 21 −25.32 −63.361 18.032 1 75.89 A C ATOM 128 NH1 ARG A 21 −25.811 −62.277 18.632 1 76.6 A N ATOM 129 NH2 ARG A 21 −24.247 −63.946 18.561 1 80.23 A N ATOM 130 C ARG A 21 −27.001 −62.704 11.276 1 39.92 A C ATOM 131 O ARG A 21 −28.143 −62.657 10.956 1 43.31 A O ATOM 132 N ALA A 22 −26.076 −63.254 10.524 1 39.79 A N ATOM 133 CA ALA A 22 −26.421 −64.017 9.337 1 38.46 A C ATOM 134 CB ALA A 22 −26.149 −63.193 8.114 1 39.22 A C ATOM 135 C ALA A 22 −25.592 −65.311 9.271 1 39.48 A C ATOM 136 O ALA A 22 −24.409 −65.296 9.527 1 41.3 A O ATOM 137 N SER A 23 −26.222 −66.403 8.881 1 37.08 A N ATOM 138 CA SER A 23 −25.546 −67.652 8.678 1 38.93 A C ATOM 139 CB SER A 23 −26.551 −68.796 8.803 1 38.61 A C ATOM 140 OG SER A 23 −27.502 −68.72 7.741 1 39.78 A O ATOM 141 C SER A 23 −25.018 −67.648 7.254 1 40.87 A C ATOM 142 O SER A 23 −25.426 −66.809 6.41 1 35.36 A O ATOM 143 N LEU A 24 −24.175 −68.635 6.98 1 36.42 A N ATOM 144 CA LEU A 24 −23.583 −68.795 5.666 1 42.13 A C ATOM 145 CB LEU A 24 −22.538 −69.956 5.614 1 44.12 A C ATOM 146 CG LEU A 24 −21.269 −69.826 6.452 1 43.49 A C ATOM 147 CD1 LEU A 24 −20.374 −71.041 6.264 1 42.41 A C ATOM 148 CD2 LEU A 24 −20.542 −68.532 6.109 1 43.21 A C ATOM 149 C LEU A 24 −24.665 −69.034 4.628 1 39.9 A C ATOM 150 O LEU A 24 −24.559 −68.556 3.508 1 38.41 A O ATOM 151 N GLU A 25 −25.706 −69.751 5.006 1 43.34 A N ATOM 152 CA GLU A 25 −26.795 −70.044 4.065 1 50.43 A C ATOM 153 CB GLU A 25 −27.66 −71.293 4.443 1 52.95 A C ATOM 154 CG GLU A 25 −27.505 −71.876 5.867 1 69.02 A C ATOM 155 CD GLU A 25 −26.088 −72.383 6.28 1 71.32 A C ATOM 156 OE1 GLU A 25 −25.555 −73.368 5.684 1 76.67 A O ATOM 157 OE2 GLU A 25 −25.522 −71.804 7.251 1 58.26 A O ATOM 158 C GLU A 25 −27.595 −68.747 3.781 1 42.68 A C ATOM 159 O GLU A 25 −27.94 −68.492 2.642 1 40.98 A O ATOM 160 N ASP A 26 −27.79 −67.883 4.772 1 40.77 A N ATOM 161 CA ASP A 26 −28.409 −66.564 4.532 1 37.13 A C ATOM 162 CB ASP A 26 −28.502 −65.741 5.82 1 43.25 A C ATOM 163 CG ASP A 26 −29.419 −66.366 6.876 1 45.1 A C ATOM 164 OD1 ASP A 26 −30.338 −67.123 6.493 1 46.96 A O ATOM 165 OD2 ASP A 26 −29.221 −66.103 8.091 1 46.84 A O ATOM 166 C ASP A 26 −27.591 −65.768 3.51 1 44.61 A C ATOM 167 O ASP A 26 −28.128 −65.041 2.694 1 44.99 A O ATOM 168 N LEU A 27 −26.271 −65.913 3.549 1 45.46 A N ATOM 169 CA LEU A 27 −25.417 −65.13 2.683 1 41.01 A C ATOM 170 CB LEU A 27 −24.07 −64.903 3.363 1 38.39 A C ATOM 171 CG LEU A 27 −24.124 −64.067 4.623 1 39.65 A C ATOM 172 CD1 LEU A 27 −22.738 −63.929 5.228 1 41.65 A C ATOM 173 CD2 LEU A 27 −24.69 −62.687 4.363 1 40.96 A C ATOM 174 C LEU A 27 −25.224 −65.789 1.34 1 40.76 A C ATOM 175 O LEU A 27 −24.78 −65.126 0.43 1 38.17 A O ATOM 176 N GLY A 28 −25.542 −67.081 1.23 1 39.95 A N ATOM 177 CA GLY A 28 −25.301 −67.873 0.016 1 36.14 A C ATOM 178 C GLY A 28 −23.887 −68.377 −0.086 1 35.77 A C ATOM 179 O GLY A 28 −23.379 −68.63 −1.17 1 36.04 A O ATOM 180 N TRP A 29 −23.212 −68.489 1.047 1 36.89 A N ATOM 181 CA TRP A 29 −21.766 −68.788 1.074 1 38.59 A C ATOM 182 CB TRP A 29 −21.065 −67.84 2.052 1 34.32 A C ATOM 183 CG TRP A 29 −20.968 −66.45 1.653 1 35.3 A C ATOM 184 CD1 TRP A 29 −21.518 −65.847 0.56 1 34.09 A C ATOM 185 NE1 TRP A 29 −21.241 −64.507 0.58 1 32.16 A N ATOM 186 CE2 TRP A 29 −20.499 −64.214 1.676 1 33.46 A C ATOM 187 CD2 TRP A 29 −20.334 −65.416 2.402 1 35 A C ATOM 188 CE3 TRP A 29 −19.65 −65.388 3.626 1 34.78 A C ATOM 189 CZ3 TRP A 29 −19.138 −64.173 4.08 1 36.79 A C ATOM 190 CH2 TRP A 29 −19.282 −62.979 3.303 1 36.42 A C ATOM 191 CZ2 TRP A 29 −19.973 −62.989 2.105 1 38.78 A C ATOM 192 C TRP A 29 −21.418 −70.246 1.515 1 42.81 A C ATOM 193 O TRP A 29 −20.244 −70.622 1.459 1 41.1 A O ATOM 194 N ALA A 30 −22.419 −71.034 1.93 1 41.02 A N ATOM 195 CA ALA A 30 −22.202 −72.329 2.636 1 46.07 A C ATOM 196 CB ALA A 30 −23.524 −72.952 3.074 1 49.03 A C ATOM 197 C ALA A 30 −21.364 −73.34 1.877 1 41.75 A C ATOM 198 O ALA A 30 −20.495 −73.957 2.445 1 41.25 A O ATOM 199 N ASP A 31 −21.544 −73.421 0.578 1 43.65 A N ATOM 200 CA ASP A 31 −20.684 −74.273 −0.237 1 43.75 A C ATOM 201 CB ASP A 31 −21.273 −74.376 −1.648 1 51.71 A C ATOM 202 CG ASP A 31 −22.617 −75.125 −1.683 1 53.98 A C ATOM 203 OD1 ASP A 31 −23.042 −75.654 −0.655 1 57.9 A O ATOM 204 OD2 ASP A 31 −23.236 −75.217 −2.758 1 58.38 A O ATOM 205 C ASP A 31 −19.238 −73.836 −0.349 1 44.79 A C ATOM 206 O ASP A 31 −18.398 −74.633 −0.735 1 46.95 A O ATOM 207 N TRP A 32 −18.932 −72.569 −0.075 1 43.94 A N ATOM 208 CA TRP A 32 −17.621 −72.011 −0.415 1 41.75 A C ATOM 209 CB TRP A 32 −17.825 −70.798 −1.339 1 47.2 A C ATOM 210 CG TRP A 32 −18.905 −71.052 −2.344 1 51.48 A C ATOM 211 CD1 TRP A 32 −20.181 −70.502 −2.398 1 49.12 A C ATOM 212 NE1 TRP A 32 −20.868 −71.014 −3.457 1 47.47 A N ATOM 213 CE2 TRP A 32 −20.059 −71.934 −4.085 1 54.26 A C ATOM 214 CD2 TRP A 32 −18.811 −71.958 −3.407 1 47.6 A C ATOM 215 CE3 TRP A 32 −17.793 −72.809 −3.852 1 46.91 A C ATOM 216 CZ3 TRP A 32 −18.021 −73.588 −4.949 1 53.12 A C ATOM 217 CH2 TRP A 32 −19.274 −73.557 −5.619 1 58.43 A C ATOM 218 CZ2 TRP A 32 −20.302 −72.72 −5.205 1 55.67 A C ATOM 219 C TRP A 32 −16.794 −71.573 0.809 1 42.61 A C ATOM 220 O TRP A 32 −15.616 −71.214 0.651 1 40.43 A O ATOM 221 N VAL A 33 −17.423 −71.512 1.985 1 38.54 A N ATOM 222 CA VAL A 33 −16.808 −70.938 3.167 1 41.98 A C ATOM 223 CB VAL A 33 −17.417 −69.558 3.522 1 38.54 A C ATOM 224 CG1 VAL A 33 −16.89 −69.04 4.862 1 43.37 A C ATOM 225 CG2 VAL A 33 −17.113 −68.583 2.414 1 38.78 A C ATOM 226 C VAL A 33 −16.989 −71.944 4.294 1 42.01 A C ATOM 227 O VAL A 33 −18.085 −72.397 4.562 1 41.04 A O ATOM 228 N LEU A 34 −15.895 −72.274 4.95 1 42.86 A N ATOM 229 CA LEU A 34 −15.911 −73.198 6.077 1 42.93 A C ATOM 230 CB LEU A 34 −14.572 −73.959 6.099 1 43.29 A C ATOM 231 CG LEU A 34 −14.42 −74.961 7.265 1 54.42 A C ATOM 232 CD1 LEU A 34 −15.301 −76.192 7.034 1 53.19 A C ATOM 233 CD2 LEU A 34 −12.954 −75.33 7.518 1 55.56 A C ATOM 234 C LEU A 34 −16.178 −72.433 7.413 1 40.42 A C ATOM 235 O LEU A 34 −16.79 −72.928 8.313 1 40.55 A O ATOM 236 N SER A 35 −15.717 −71.206 7.506 1 37.52 A N ATOM 237 CA SER A 35 −15.749 −70.47 8.724 1 39.64 A C ATOM 238 CB SER A 35 −14.534 −70.926 9.567 1 42.83 A C ATOM 239 OG SER A 35 −14.601 −70.373 10.865 1 44.11 A O ATOM 240 C SER A 35 −15.632 −68.968 8.441 1 32.13 A C ATOM 241 O SER A 35 −14.844 −68.604 7.605 1 35.53 A O ATOM 242 N PRO A 36 −16.332 −68.092 9.151 1 36.3 A N ATOM 243 CA PRO A 36 −17.211 −68.423 10.271 1 38.14 A C ATOM 244 CB PRO A 36 −17.351 −67.077 11.001 1 39.49 A C ATOM 245 CG PRO A 36 −17.254 −66.055 9.941 1 36.45 A C ATOM 246 CD PRO A 36 −16.395 −66.645 8.826 1 37.44 A C ATOM 247 C PRO A 36 −18.572 −68.885 9.874 1 38.93 A C ATOM 248 O PRO A 36 −19.075 −68.468 8.862 1 42.7 A O ATOM 249 N ARG A 37 −19.219 −69.679 10.711 1 44 A N ATOM 250 CA ARG A 37 −20.531 −70.215 10.356 1 45.51 A C ATOM 251 CB ARG A 37 −20.889 −71.414 11.228 1 45.67 A C ATOM 252 CG ARG A 37 −20.025 −72.651 11.007 1 55.76 A C ATOM 253 CD ARG A 37 −20.525 −73.774 11.919 1 69.94 A C ATOM 254 NE ARG A 37 −19.478 −74.724 12.336 1 81.13 A N ATOM 255 CZ ARG A 37 −19.415 −75.37 13.514 1 84.71 A C ATOM 256 NH1 ARG A 37 −20.321 −75.178 14.478 1 90.98 A N ATOM 257 NH2 ARG A 37 −18.413 −76.218 13.746 1 83.41 A N ATOM 258 C ARG A 37 −21.634 −69.177 10.456 1 39.03 A C ATOM 259 O ARG A 37 −22.654 −69.31 9.83 1 43.54 A O ATOM 260 N GLU A 38 −21.441 −68.194 11.31 1 41.18 A N ATOM 261 CA GLU A 38 −22.372 −67.098 11.516 1 48.45 A C ATOM 262 CB GLU A 38 −22.904 −67.113 12.964 1 54.37 A C ATOM 263 CG GLU A 38 −24.42 −67.26 13.185 1 69.9 A C ATOM 264 CD GLU A 38 −24.922 −66.513 14.439 1 71.65 A C ATOM 265 OE1 GLU A 38 −26.123 −66.145 14.507 1 69.26 A O ATOM 266 OE2 GLU A 38 −24.102 −66.26 15.356 1 72.37 A O ATOM 267 C GLU A 38 −21.525 −65.854 11.361 1 41.02 A C ATOM 268 O GLU A 38 −20.428 −65.807 11.896 1 43.5 A O ATOM 269 N VAL A 39 −22.047 −64.84 10.698 1 37.85 A N ATOM 270 CA VAL A 39 −21.364 −63.565 10.606 1 37.99 A C ATOM 271 CB VAL A 39 −21.206 −63.09 9.151 1 36.17 A C ATOM 272 CG1 VAL A 39 −20.492 −61.741 9.133 1 37.19 A C ATOM 273 CG2 VAL A 39 −20.386 −64.095 8.369 1 40.75 A C ATOM 274 C VAL A 39 −22.178 −62.531 11.305 1 36.27 A C ATOM 275 O VAL A 39 −23.343 −62.441 11.06 1 38.57 A O ATOM 276 N GLN A 40 −21.547 −61.722 12.132 1 37.54 A N ATOM 277 CA GLN A 40 −22.208 −60.605 12.778 1 40.96 A C ATOM 278 CB GLN A 40 −21.657 −60.366 14.166 1 47.52 A C ATOM 279 CG GLN A 40 −22.697 −60.446 15.259 1 65.12 A C ATOM 280 CD GLN A 40 −22.643 −61.756 15.981 1 68.79 A C ATOM 281 OE1 GLN A 40 −23.299 −62.703 15.59 1 81.84 A O ATOM 282 NE2 GLN A 40 −21.858 −61.815 17.051 1 75.03 A N ATOM 283 C GLN A 40 −21.992 −59.42 11.869 1 37.94 A C ATOM 284 O GLN A 40 −20.99 −58.716 11.959 1 35.73 A O ATOM 285 N VAL A 41 −22.914 −59.243 10.928 1 34.72 A N ATOM 286 CA VAL A 41 −22.721 −58.218 9.912 1 35.63 A C ATOM 287 CB VAL A 41 −23.597 −58.441 8.684 1 34.34 A C ATOM 288 CG1 VAL A 41 −23.267 −57.41 7.617 1 36.96 A C ATOM 289 CG2 VAL A 41 −23.377 −59.838 8.113 1 32.62 A C ATOM 290 C VAL A 41 −22.985 −56.838 10.494 1 34.63 A C ATOM 291 O VAL A 41 −24.095 −56.515 10.869 1 37.67 A O ATOM 292 N THR A 42 −21.974 −56.005 10.559 1 37.79 A N ATOM 293 CA THR A 42 −22.193 −54.597 10.968 1 34.49 A C ATOM 294 CB THR A 42 −21.026 −54.051 11.75 1 32.47 A C ATOM 295 OG1 THR A 42 −19.795 −54.381 11.08 1 34.31 A O ATOM 296 CG2 THR A 42 −21.043 −54.664 13.112 1 31.77 A C ATOM 297 C THR A 42 −22.507 −53.783 9.735 1 33.3 A C ATOM 298 O THR A 42 −21.801 −53.902 8.748 1 37.94 A O ATOM 299 N MET A 43 −23.623 −53.043 9.756 1 34.82 A N ATOM 300 CA MET A 43 −24.056 −52.241 8.614 1 35.4 A C ATOM 301 CB MET A 43 −25.006 −53.026 7.713 1 38.76 A C ATOM 302 CG MET A 43 −26.285 −53.481 8.392 1 46.61 A C ATOM 303 SD MET A 43 −27.435 −54.37 7.308 1 52.38 A S ATOM 304 CE MET A 43 −26.48 −55.75 6.691 1 44.11 A C ATOM 305 C MET A 43 −24.656 −50.914 9.025 1 36.95 A C ATOM 306 O MET A 43 −25.013 −50.707 10.196 1 38.3 A O ATOM 307 N CYS A 44 −24.737 −50.004 8.057 1 34.89 A N ATOM 308 CA CYS A 44 −25.214 −48.623 8.334 1 39.21 A C ATOM 309 CB CYS A 44 −24.336 −47.65 7.546 1 35.48 A C ATOM 310 SG CYS A 44 −22.622 −47.734 8.14 1 39.94 A S ATOM 311 C CYS A 44 −26.695 −48.463 7.953 1 34.27 A C ATOM 312 O CYS A 44 −27.022 −48.657 6.838 1 39.73 A O ATOM 313 N ILE A 45 −27.569 −48.138 8.883 1 36.41 A N ATOM 314 CA ILE A 45 −29.031 −48.012 8.613 1 37.02 A C ATOM 315 CB ILE A 45 −29.831 −49.215 9.153 1 40.52 A C ATOM 316 CG1 ILE A 45 −29.318 −50.557 8.589 1 43.65 A C ATOM 317 CD1 ILE A 45 −29.762 −51.759 9.419 1 45.06 A C ATOM 318 CG2 ILE A 45 −31.302 −49.133 8.768 1 43.05 A C ATOM 319 C ILE A 45 −29.526 −46.794 9.367 1 38.64 A C ATOM 320 O ILE A 45 −29.083 −46.541 10.488 1 37.35 A O ATOM 321 N GLY A 46 −30.435 −46.053 8.742 1 39.36 A N ATOM 322 CA GLY A 46 −31.108 −44.93 9.368 1 39.55 A C ATOM 323 C GLY A 46 −31.153 −43.703 8.512 1 39.12 A C ATOM 324 O GLY A 46 −30.482 −43.611 7.503 1 41.18 A O ATOM 325 N ALA A 47 −31.938 −42.728 8.95 1 46.44 A N ATOM 326 CA ALA A 47 −32.175 −41.514 8.169 1 44.38 A C ATOM 327 CB ALA A 47 −33.432 −40.816 8.651 1 48.42 A C ATOM 328 C ALA A 47 −31.026 −40.555 8.247 1 38.66 A C ATOM 329 O ALA A 47 −30.28 −40.518 9.216 1 39.82 A O ATOM 330 N CYS A 48 −30.944 −39.764 7.195 1 37.09 A N ATOM 331 CA CYS A 48 −29.936 −38.785 6.949 1 38.96 A C ATOM 332 CB CYS A 48 −29.142 −39.169 5.687 1 41.01 A C ATOM 333 SG CYS A 48 −27.897 −40.466 5.982 1 42.74 A S ATOM 334 C CYS A 48 −30.603 −37.404 6.778 1 36.79 A C ATOM 335 O CYS A 48 −30.596 −36.846 5.695 1 36.33 A O ATOM 336 N PRO A 49 −31.169 −36.851 7.856 1 35.37 A N ATOM 337 CA PRO A 49 −31.684 −35.459 7.77 1 39.45 A C ATOM 338 CB PRO A 49 −32.381 −35.257 9.129 1 37.94 A C ATOM 339 CG PRO A 49 −31.678 −36.199 10.063 1 37.45 A C ATOM 340 CD PRO A 49 −31.229 −37.38 9.234 1 36.05 A C ATOM 341 C PRO A 49 −30.565 −34.434 7.575 1 42.3 A C ATOM 342 O PRO A 49 −29.411 −34.759 7.839 1 45.9 A O ATOM 343 N SER A 50 −30.916 −33.209 7.159 1 42.24 A N ATOM 344 CA SER A 50 −29.959 −32.123 6.9 1 46.61 A C ATOM 345 CB SER A 50 −30.675 −30.775 6.741 1 48.12 A C ATOM 346 OG SER A 50 −31.835 −30.977 5.98 1 62.75 A O ATOM 347 C SER A 50 −28.936 −31.917 7.995 1 53.33 A C ATOM 348 O SER A 50 −29.292 −31.632 9.153 1 54.99 A O ATOM 349 N GLN A 51 −27.671 −32.031 7.608 1 52.54 A N ATOM 350 CA GLN A 51 −26.517 −31.74 8.455 1 49.77 A C ATOM 351 CB GLN A 51 −26.632 −30.362 9.115 1 52.68 A C ATOM 352 CG GLN A 51 −26.89 −29.266 8.087 1 56.89 A C ATOM 353 CD GLN A 51 −27.364 −28.036 8.766 1 62.12 A C ATOM 354 OE1 GLN A 51 −28.561 −27.843 8.96 1 86.28 A O ATOM 355 NE2 GLN A 51 −26.444 −27.24 9.216 1 59.61 A N ATOM 356 C GLN A 51 −26.223 −32.822 9.475 1 47.08 A C ATOM 357 O GLN A 51 −25.374 −32.638 10.346 1 47.4 A O ATOM 358 N PHE A 52 −26.89 −33.957 9.367 1 40.38 A N ATOM 359 CA PHE A 52 −26.507 −35.068 10.2 1 40.29 A C ATOM 360 CB PHE A 52 −27.701 −35.945 10.485 1 43.08 A C ATOM 361 CG PHE A 52 −27.436 −36.975 11.516 1 41.37 A C ATOM 362 CD1 PHE A 52 −27.457 −36.633 12.861 1 41.31 A C ATOM 363 CE1 PHE A 52 −27.182 −37.607 13.829 1 43.74 A C ATOM 364 CZ PHE A 52 −26.872 −38.914 13.435 1 41.63 A C ATOM 365 CE2 PHE A 52 −26.856 −39.257 12.085 1 39.25 A C ATOM 366 CD2 PHE A 52 −27.116 −38.289 11.134 1 41.38 A C ATOM 367 C PHE A 52 −25.404 −35.847 9.481 1 37.08 A C ATOM 368 O PHE A 52 −25.621 −36.336 8.345 1 36.06 A O ATOM 369 N ARG A 53 −24.223 −35.882 10.102 1 34.44 A N ATOM 370 CA ARG A 53 −23.075 −36.678 9.672 1 35.8 A C ATOM 371 CB ARG A 53 −23.319 −38.126 10.038 1 42.17 A C ATOM 372 CG ARG A 53 −23.292 −38.43 11.519 1 45.29 A C ATOM 373 CD ARG A 53 −23.184 −39.955 11.665 1 51.24 A C ATOM 374 NE ARG A 53 −23.299 −40.402 13.053 1 58.4 A N ATOM 375 CZ ARG A 53 −23.311 −41.672 13.462 1 57.44 A C ATOM 376 NH1 ARG A 53 −23.214 −42.657 12.601 1 60.06 A N ATOM 377 NH2 ARG A 53 −23.418 −41.948 14.75 1 64.66 A N ATOM 378 C ARG A 53 −22.786 −36.613 8.169 1 39.19 A C ATOM 379 O ARG A 53 −22.564 −37.643 7.489 1 35.45 A O ATOM 380 N ALA A 54 −22.824 −35.403 7.618 1 38.41 A N ATOM 381 CA ALA A 54 −22.53 −35.228 6.217 1 35.12 A C ATOM 382 CB ALA A 54 −22.646 −33.747 5.831 1 37.96 A C ATOM 383 C ALA A 54 −21.116 −35.763 5.987 1 39.88 A C ATOM 384 O ALA A 54 −20.209 −35.404 6.714 1 44.71 A O ATOM 385 N ALA A 55 −20.931 −36.651 5.012 1 39.44 A N ATOM 386 CA ALA A 55 −19.632 −37.292 4.805 1 36.66 A C ATOM 387 CB ALA A 55 −19.747 −38.392 3.783 1 37.03 A C ATOM 388 C ALA A 55 −18.561 −36.342 4.367 1 37.25 A C ATOM 389 O ALA A 55 −17.442 −36.553 4.669 1 41.75 A O ATOM 390 N ASN A 56 −18.909 −35.316 3.614 1 37.93 A N ATOM 391 CA ASN A 56 −17.955 −34.532 2.884 1 37.51 A C ATOM 392 CB ASN A 56 −17.235 −35.407 1.814 1 37.5 A C ATOM 393 CG ASN A 56 −18.18 −36.097 0.82 1 37.2 A C ATOM 394 OD1 ASN A 56 −19.364 −35.74 0.653 1 38.76 A O ATOM 395 ND2 ASN A 56 −17.634 −37.076 0.116 1 32.65 A N ATOM 396 C ASN A 56 −18.705 −33.375 2.267 1 39.91 A C ATOM 397 O ASN A 56 −19.894 −33.177 2.568 1 39.53 A O ATOM 398 N MET A 57 −18.051 −32.624 1.391 1 41.37 A N ATOM 399 CA MET A 57 −18.684 −31.453 0.794 1 43.15 A C ATOM 400 CB MET A 57 −17.664 −30.466 0.221 1 50.27 A C ATOM 401 CG MET A 57 −17.193 −29.531 1.319 1 56.71 A C ATOM 402 SD MET A 57 −16.075 −28.235 0.815 1 69.21 A S ATOM 403 CE MET A 57 −16.975 −27.396 −0.49 1 64.21 A C ATOM 404 C MET A 57 −19.695 −31.808 −0.245 1 41.13 A C ATOM 405 O MET A 57 −20.689 −31.109 −0.362 1 41.62 A O ATOM 406 N HIS A 58 −19.476 −32.897 −0.978 1 34.31 A N ATOM 407 CA HIS A 58 −20.508 −33.392 −1.854 1 33.98 A C ATOM 408 CB HIS A 58 −20.057 −34.69 −2.501 1 35.61 A C ATOM 409 CG HIS A 58 −21.001 −35.203 −3.535 1 34.01 A C ATOM 410 ND1 HIS A 58 −21.068 −34.684 −4.802 1 37.93 A N ATOM 411 CE1 HIS A 58 −21.982 −35.338 −5.504 1 33.69 A C ATOM 412 NE2 HIS A 58 −22.502 −36.266 −4.729 1 33.89 A N ATOM 413 CD2 HIS A 58 −21.933 −36.183 −3.483 1 34.79 A C ATOM 414 C HIS A 58 −21.818 −33.624 −1.086 1 31.95 A C ATOM 415 O HIS A 58 −22.865 −33.318 −1.556 1 32.21 A O ATOM 416 N ALA A 59 −21.735 −34.196 0.099 1 35.12 A N ATOM 417 CA ALA A 59 −22.898 −34.458 0.885 1 35.66 A C ATOM 418 CB ALA A 59 −22.532 −35.212 2.152 1 36.66 A C ATOM 419 C ALA A 59 −23.611 −33.129 1.203 1 36.32 A C ATOM 420 O ALA A 59 −24.859 −33.056 1.12 1 34.81 A O ATOM 421 N GLN A 60 −22.839 −32.109 1.572 1 33.39 A N ATOM 422 CA GLN A 60 −23.408 −30.766 1.887 1 37.53 A C ATOM 423 CB GLN A 60 −22.386 −29.831 2.48 1 37.43 A C ATOM 424 CG GLN A 60 −21.955 −30.368 3.838 1 46.78 A C ATOM 425 CD GLN A 60 −20.831 −29.594 4.484 1 51.97 A C ATOM 426 OE1 GLN A 60 −19.91 −29.14 3.816 1 50.51 A O ATOM 427 NE2 GLN A 60 −20.899 −29.461 5.815 1 56.35 A N ATOM 428 C GLN A 60 −24.098 −30.067 0.739 1 37.04 A C ATOM 429 O GLN A 60 −25.091 −29.397 0.95 1 36.44 A O ATOM 430 N ILE A 61 −23.576 −30.249 −0.461 1 35.1 A N ATOM 431 CA ILE A 61 −24.193 −29.73 −1.643 1 34.26 A C ATOM 432 CB ILE A 61 −23.194 −29.843 −2.787 1 35.08 A C ATOM 433 CG1 ILE A 61 −22.096 −28.803 −2.632 1 38.47 A C ATOM 434 CD1 ILE A 61 −20.825 −29.178 −3.387 1 43.35 A C ATOM 435 CG2 ILE A 61 −23.853 −29.666 −4.136 1 37.38 A C ATOM 436 C ILE A 61 −25.492 −30.482 −1.965 1 35.36 A C ATOM 437 O ILE A 61 −26.462 −29.893 −2.428 1 35.29 A O ATOM 438 N LYS A 62 −25.481 −31.804 −1.796 1 39.17 A N ATOM 439 CA LYS A 62 −26.612 −32.649 −2.153 1 38.21 A C ATOM 440 CB LYS A 62 −26.232 −34.108 −2 1 48.13 A C ATOM 441 CG LYS A 62 −27.126 −35.129 −2.692 1 53.06 A C ATOM 442 CD LYS A 62 −26.361 −36.422 −2.887 1 55.44 A C ATOM 443 CE LYS A 62 −27.208 −37.53 −3.448 1 58.35 A C ATOM 444 NZ LYS A 62 −27.571 −38.549 −2.391 1 65.81 A N ATOM 445 C LYS A 62 −27.796 −32.318 −1.249 1 36.2 A C ATOM 446 O LYS A 62 −28.911 −32.264 −1.691 1 38.08 A O ATOM 447 N THR A 63 −27.529 −32.097 0.022 1 33.98 A N ATOM 448 CA THR A 63 −28.513 −31.592 0.943 1 35.2 A C ATOM 449 CB THR A 63 −27.937 −31.498 2.349 1 35.65 A C ATOM 450 OG1 THR A 63 −27.875 −32.823 2.864 1 36.24 A O ATOM 451 CG2 THR A 63 −28.807 −30.681 3.312 1 34.62 A C ATOM 452 C THR A 63 −29.077 −30.256 0.539 1 38.25 A C ATOM 453 O THR A 63 −30.29 −30.088 0.558 1 38.9 A O ATOM 454 N SER A 64 −28.226 −29.305 0.182 1 38.7 A N ATOM 455 CA SER A 64 −28.742 −28.008 −0.252 1 39.6 A C ATOM 456 CB SER A 64 −27.625 −27.051 −0.609 1 38.63 A C ATOM 457 OG SER A 64 −26.894 −26.695 0.558 1 37.5 A O ATOM 458 C SER A 64 −29.667 −28.175 −1.436 1 38.99 A C ATOM 459 O SER A 64 −30.772 −27.621 −1.447 1 37.82 A O ATOM 460 N LEU A 65 −29.202 −28.931 −2.425 1 39.4 A N ATOM 461 CA LEU A 65 −29.982 −29.149 −3.648 1 38.08 A C ATOM 462 CB LEU A 65 −29.134 −29.691 −4.775 1 32.49 A C ATOM 463 CG LEU A 65 −28.031 −28.734 −5.222 1 39.3 A C ATOM 464 CD1 LEU A 65 −27.191 −29.373 −6.326 1 37.33 A C ATOM 465 CD2 LEU A 65 −28.496 −27.313 −5.631 1 39.44 A C ATOM 466 C LEU A 65 −31.213 −30.025 −3.484 1 39.79 A C ATOM 467 O LEU A 65 −32.151 −29.854 −4.21 1 40.29 A O ATOM 468 N HIS A 66 −31.165 −30.987 −2.573 1 40.28 A N ATOM 469 CA HIS A 66 −32.305 −31.756 −2.236 1 41.11 A C ATOM 470 CB HIS A 66 −31.892 −32.932 −1.368 1 38.52 A C ATOM 471 CG HIS A 66 −33.03 −33.595 −0.691 1 36.78 A C ATOM 472 ND1 HIS A 66 −33.983 −34.332 −1.371 1 35.49 A N ATOM 473 CE1 HIS A 66 −34.854 −34.808 −0.5 1 35.19 A C ATOM 474 NE2 HIS A 66 −34.495 −34.407 0.717 1 39 A N ATOM 475 CD2 HIS A 66 −33.369 −33.64 0.621 1 38.73 A C ATOM 476 C HIS A 66 −33.372 −30.871 −1.553 1 40.57 A C ATOM 477 O HIS A 66 −34.535 −30.962 −1.913 1 38.81 A O ATOM 478 N ARG A 67 −32.988 −29.995 −0.631 1 37.94 A N ATOM 479 CA ARG A 67 −33.98 −29.11 0.013 1 39.23 A C ATOM 480 CB ARG A 67 −33.488 −28.412 1.292 1 40.88 A C ATOM 481 CG ARG A 67 −32.936 −29.376 2.349 1 44.02 A C ATOM 482 CD ARG A 67 −32.318 −28.645 3.556 1 44.22 A C ATOM 483 NE ARG A 67 −33.39 −27.899 4.185 1 47.25 A N ATOM 484 CZ ARG A 67 −34.349 −28.42 4.963 1 48.97 A C ATOM 485 NH1 ARG A 67 −35.311 −27.638 5.409 1 51.18 A N ATOM 486 NH2 ARG A 67 −34.363 −29.703 5.307 1 51.87 A N ATOM 487 C ARG A 67 −34.55 −28.112 −0.969 1 42.98 A C ATOM 488 O ARG A 67 −35.708 −27.758 −0.894 1 46.54 A O ATOM 489 N LEU A 68 −33.775 −27.732 −1.951 1 44.17 A N ATOM 490 CA LEU A 68 −34.229 −26.797 −2.94 1 40.05 A C ATOM 491 CB LEU A 68 −32.992 −26.111 −3.507 1 47.84 A C ATOM 492 CG LEU A 68 −33.154 −24.932 −4.439 1 48.82 A C ATOM 493 CD1 LEU A 68 −33.711 −23.771 −3.65 1 50.19 A C ATOM 494 CD2 LEU A 68 −31.812 −24.59 −5.068 1 52.69 A C ATOM 495 C LEU A 68 −35.028 −27.448 −4.049 1 43.1 A C ATOM 496 O LEU A 68 −35.855 −26.795 −4.67 1 45.11 A O ATOM 497 N LYS A 69 −34.772 −28.719 −4.333 1 40.81 A N ATOM 498 CA LYS A 69 −35.273 −29.374 −5.545 1 41.64 A C ATOM 499 CB LYS A 69 −34.215 −29.239 −6.628 1 50.28 A C ATOM 500 CG LYS A 69 −34.568 −28.277 −7.717 1 61.5 A C ATOM 501 CD LYS A 69 −33.354 −27.88 −8.542 1 67.94 A C ATOM 502 CE LYS A 69 −32.875 −26.499 −8.138 1 79.13 A C ATOM 503 NZ LYS A 69 −32.569 −25.7 −9.353 1 77.8 A N ATOM 504 C LYS A 69 −35.575 −30.845 −5.256 1 39.68 A C ATOM 505 O LYS A 69 −34.951 −31.746 −5.824 1 40.69 A O ATOM 506 N PRO A 70 −36.525 −31.097 −4.343 1 39.23 A N ATOM 507 CA PRO A 70 −36.724 −32.425 −3.747 1 41.06 A C ATOM 508 CB PRO A 70 −37.749 −32.18 −2.655 1 40.27 A C ATOM 509 CG PRO A 70 −38.426 −30.937 −3.064 1 40.89 A C ATOM 510 CD PRO A 70 −37.432 −30.103 −3.783 1 40.01 A C ATOM 511 C PRO A 70 −37.175 −33.527 −4.695 1 40.12 A C ATOM 512 O PRO A 70 −36.947 −34.684 −4.402 1 40.59 A O ATOM 513 N ASP A 71 −37.792 −33.179 −5.812 1 43.12 A N ATOM 514 CA ASP A 71 −38.161 −34.182 −6.814 1 48.15 A C ATOM 515 CB ASP A 71 −39.373 −33.695 −7.628 1 45.93 A C ATOM 516 CG ASP A 71 −40.614 −33.537 −6.772 1 47.79 A C ATOM 517 OD1 ASP A 71 −40.649 −34.141 −5.7 1 45.88 A O ATOM 518 OD2 ASP A 71 −41.525 −32.762 −7.134 1 48.23 A O ATOM 519 C ASP A 71 −37.029 −34.56 −7.773 1 49.46 A C ATOM 520 O ASP A 71 −37.096 −35.595 −8.429 1 50.83 A O ATOM 521 N THR A 72 −36.03 −33.709 −7.895 1 48.85 A N ATOM 522 CA THR A 72 −34.875 −33.984 −8.754 1 48.71 A C ATOM 523 CB THR A 72 −34.318 −32.69 −9.347 1 49.41 A C ATOM 524 OG1 THR A 72 −35.374 −31.844 −9.8 1 57 A O ATOM 525 CG2 THR A 72 −33.364 −32.995 −10.489 1 57.6 A C ATOM 526 C THR A 72 −33.722 −34.606 −7.939 1 47.52 A C ATOM 527 O THR A 72 −33.076 −35.488 −8.417 1 45.82 A O ATOM 528 N VAL A 73 −33.445 −34.081 −6.738 1 44.05 A N ATOM 529 CA VAL A 73 −32.256 −34.445 −5.994 1 45.16 A C ATOM 530 CB VAL A 73 −31.427 −33.205 −5.632 1 45.49 A C ATOM 531 CG1 VAL A 73 −30.18 −33.613 −4.884 1 50.8 A C ATOM 532 CG2 VAL A 73 −31.041 −32.473 −6.89 1 45.69 A C ATOM 533 C VAL A 73 −32.681 −35.201 −4.744 1 40.58 A C ATOM 534 O VAL A 73 −33.359 −34.643 −3.899 1 37.48 A O ATOM 535 N PRO A 74 −32.318 −36.485 −4.641 1 41.21 A N ATOM 536 CA PRO A 74 −32.77 −37.241 −3.483 1 43.58 A C ATOM 537 CB PRO A 74 −32.476 −38.68 −3.889 1 43.61 A C ATOM 538 CG PRO A 74 −31.285 −38.561 −4.748 1 45.06 A C ATOM 539 CD PRO A 74 −31.459 −37.296 −5.525 1 44.93 A C ATOM 540 C PRO A 74 −32.004 −36.859 −2.225 1 46.17 A C ATOM 541 O PRO A 74 −30.96 −36.217 −2.299 1 42.53 A O ATOM 542 N ALA A 75 −32.543 −37.255 −1.079 1 53.66 A N ATOM 543 CA ALA A 75 −31.86 −37.107 0.21 1 54.13 A C ATOM 544 CB ALA A 75 −32.794 −37.547 1.306 1 56.52 A C ATOM 545 C ALA A 75 −30.567 −37.96 0.308 1 54.78 A C ATOM 546 O ALA A 75 −30.447 −38.994 −0.359 1 42.71 A O ATOM 547 N PRO A 76 −29.625 −37.558 1.185 1 55.5 A N ATOM 548 CA PRO A 76 −28.405 −38.361 1.337 1 52.04 A C ATOM 549 CB PRO A 76 −27.612 −37.549 2.369 1 58.18 A C ATOM 550 CG PRO A 76 −27.977 −36.117 2.055 1 53.52 A C ATOM 551 CD PRO A 76 −29.464 −36.238 1.846 1 57.77 A C ATOM 552 C PRO A 76 −28.67 −39.784 1.781 1 43.89 A C ATOM 553 O PRO A 76 −29.721 −40.039 2.341 1 46.97 A O ATOM 554 N CYS A 77 −27.782 −40.714 1.462 1 42.22 A N ATOM 555 CA CYS A 77 −27.911 −42.091 1.964 1 43.58 A C ATOM 556 CB CYS A 77 −27.806 −43.152 0.853 1 48.49 A C ATOM 557 SG CYS A 77 −27.618 −42.727 −0.912 1 77.89 A S ATOM 558 C CYS A 77 −26.92 −42.465 3.103 1 36.1 A C ATOM 559 O CYS A 77 −25.782 −42.028 3.125 1 36.88 A O ATOM 560 N CYS A 78 −27.36 −43.337 4.002 1 34.84 A N ATOM 561 CA CYS A 78 −26.552 −43.854 5.123 1 35.57 A C ATOM 562 CB CYS A 78 −27.464 −44.44 6.23 1 33.58 A C ATOM 563 SG CYS A 78 −26.603 −44.959 7.735 1 40.5 A S ATOM 564 C CYS A 78 −25.622 −44.961 4.586 1 36.81 A C ATOM 565 O CYS A 78 −26.116 −45.997 4.183 1 37.76 A O ATOM 566 N VAL A 79 −24.3 −44.707 4.567 1 37.99 A N ATOM 567 CA VAL A 79 −23.276 −45.643 4.063 1 39.76 A C ATOM 568 CB VAL A 79 −22.747 −45.25 2.67 1 43 A C ATOM 569 CG1 VAL A 79 −23.909 −45.236 1.693 1 45.91 A C ATOM 570 CG2 VAL A 79 −22.047 −43.893 2.688 1 46.23 A C ATOM 571 C VAL A 79 −22.095 −45.759 5.018 1 35.34 A C ATOM 572 O VAL A 79 −21.941 −44.929 5.902 1 36.25 A O ATOM 573 N PRO A 80 −21.273 −46.808 4.852 1 35.99 A N ATOM 574 CA PRO A 80 −20.101 −46.948 5.709 1 37.36 A C ATOM 575 CB PRO A 80 −19.546 −48.356 5.331 1 34.42 A C ATOM 576 CG PRO A 80 −20.733 −49.092 4.855 1 34.43 A C ATOM 577 CD PRO A 80 −21.459 −48.048 4.047 1 37.91 A C ATOM 578 C PRO A 80 −19.084 −45.888 5.402 1 35.53 A C ATOM 579 O PRO A 80 −18.785 −45.661 4.253 1 34.05 A O ATOM 580 N ALA A 81 −18.575 −45.256 6.445 1 39.9 A N ATOM 581 CA ALA A 81 −17.469 −44.302 6.339 1 38.67 A C ATOM 582 CB ALA A 81 −17.547 −43.327 7.507 1 39.8 A C ATOM 583 C ALA A 81 −16.132 −45.013 6.37 1 35.89 A C ATOM 584 O ALA A 81 −15.161 −44.485 5.922 1 36.72 A O ATOM 585 N SER A 82 −16.087 −46.19 6.971 1 37.5 A N ATOM 586 CA SER A 82 −14.881 −47.004 7.04 1 36.94 A C ATOM 587 CB SER A 82 −13.964 −46.46 8.146 1 35.17 A C ATOM 588 OG SER A 82 −14.627 −46.61 9.397 1 36.11 A O ATOM 589 C SER A 82 −15.316 −48.443 7.374 1 33.43 A C ATOM 590 O SER A 82 −16.449 −48.656 7.747 1 34.74 A O ATOM 591 N TYR A 83 −14.387 −49.388 7.315 1 33.39 A N ATOM 592 CA TYR A 83 −14.643 −50.823 7.566 1 34.64 A C ATOM 593 CB TYR A 83 −14.474 −51.58 6.238 1 36.17 A C ATOM 594 CG TYR A 83 −15.488 −51.216 5.175 1 33.18 A C ATOM 595 CD1 TYR A 83 −15.272 −50.121 4.32 1 30.47 A C ATOM 596 CE1 TYR A 83 −16.191 −49.766 3.336 1 29.01 A C ATOM 597 CZ TYR A 83 −17.382 −50.505 3.24 1 30.48 A C ATOM 598 OH TYR A 83 −18.303 −50.194 2.304 1 31.23 A O ATOM 599 CE2 TYR A 83 −17.621 −51.593 4.081 1 32.56 A C ATOM 600 CD2 TYR A 83 −16.673 −51.949 5.04 1 32.34 A C ATOM 601 C TYR A 83 −13.732 −51.489 8.6 1 33.76 A C ATOM 602 O TYR A 83 −12.627 −51.052 8.837 1 38.91 A O ATOM 603 N ASN A 84 −14.191 −52.569 9.204 1 37.63 A N ATOM 604 CA ASN A 84 −13.311 −53.443 10.02 1 37.16 A C ATOM 605 CB ASN A 84 −14.054 −53.941 11.257 1 37.76 A C ATOM 606 CG ASN A 84 −14.164 −52.887 12.323 1 39.1 A C ATOM 607 OD1 ASN A 84 −13.195 −52.226 12.631 1 43.1 A O ATOM 608 ND2 ASN A 84 −15.345 −52.722 12.884 1 43 A N ATOM 609 C ASN A 84 −12.941 −54.646 9.2 1 35.3 A C ATOM 610 O ASN A 84 −13.823 −55.322 8.674 1 40.42 A O ATOM 611 N PRO A 85 −11.662 −54.955 9.084 1 34.85 A N ATOM 612 CA PRO A 85 −11.325 −56.188 8.354 1 36.3 A C ATOM 613 CB PRO A 85 −9.79 −56.228 8.378 1 39.95 A C ATOM 614 CG PRO A 85 −9.347 −55.204 9.372 1 41.33 A C ATOM 615 CD PRO A 85 −10.481 −54.223 9.568 1 40.25 A C ATOM 616 C PRO A 85 −11.834 −57.488 8.988 1 37.32 A C ATOM 617 O PRO A 85 −11.908 −57.613 10.22 1 40.5 A O ATOM 618 N MET A 86 −12.075 −58.479 8.15 1 31.09 A N ATOM 619 CA MET A 86 −12.52 −59.771 8.622 1 33.25 A C ATOM 620 CB MET A 86 −14.038 −59.903 8.394 1 35.78 A C ATOM 621 CG MET A 86 −14.678 −61.094 9.082 1 44.89 A C ATOM 622 SD MET A 86 −16.413 −61.283 8.594 1 45.5 A S ATOM 623 CE MET A 86 −16.65 −63.013 8.871 1 51.89 A C ATOM 624 C MET A 86 −11.845 −60.885 7.859 1 34.02 A C ATOM 625 O MET A 86 −11.617 −60.777 6.647 1 34.69 A O ATOM 626 N VAL A 87 −11.65 −62.001 8.539 1 32.65 A N ATOM 627 CA VAL A 87 −11.083 −63.185 7.933 1 33.25 A C ATOM 628 CB VAL A 87 −10.057 −63.863 8.875 1 35.01 A C ATOM 629 CG1 VAL A 87 −9.347 −65.021 8.185 1 35.09 A C ATOM 630 CG2 VAL A 87 −9.054 −62.861 9.401 1 37.43 A C ATOM 631 C VAL A 87 −12.178 −64.202 7.647 1 34.02 A C ATOM 632 O VAL A 87 −13.132 −64.357 8.431 1 32.57 A O ATOM 633 N LEU A 88 −12.021 −64.903 6.521 1 31.52 A N ATOM 634 CA LEU A 88 −12.879 −65.992 6.115 1 35.17 A C ATOM 635 CB LEU A 88 −13.573 −65.644 4.764 1 37.86 A C ATOM 636 CG LEU A 88 −14.977 −65.088 4.707 1 42.6 A C ATOM 637 CD1 LEU A 88 −15.223 −64.077 5.807 1 52.34 A C ATOM 638 CD2 LEU A 88 −15.29 −64.472 3.361 1 44.16 A C ATOM 639 C LEU A 88 −11.963 −67.182 5.882 1 35.12 A C ATOM 640 O LEU A 88 −10.914 −66.995 5.325 1 37.27 A O ATOM 641 N ILE A 89 −12.375 −68.396 6.234 1 37.58 A N ATOM 642 CA ILE A 89 −11.708 −69.594 5.696 1 35.03 A C ATOM 643 CB ILE A 89 −11.548 −70.684 6.755 1 35.1 A C ATOM 644 CG1 ILE A 89 −10.824 −70.115 7.995 1 36.24 A C ATOM 645 CD1 ILE A 89 −10.73 −71.104 9.15 1 39.26 A C ATOM 646 CG2 ILE A 89 −10.78 −71.885 6.191 1 38.2 A C ATOM 647 C ILE A 89 −12.501 −70.11 4.487 1 37.35 A C ATOM 648 O ILE A 89 −13.569 −70.645 4.649 1 35.18 A O ATOM 649 N GLN A 90 −11.927 −69.958 3.293 1 40.15 A N ATOM 650 CA GLN A 90 −12.546 −70.392 2.029 1 45.36 A C ATOM 651 CB GLN A 90 −12.12 −69.503 0.865 1 44.4 A C ATOM 652 CG GLN A 90 −12.434 −68.052 1.115 1 50.18 A C ATOM 653 CD GLN A 90 −11.86 −67.108 0.074 1 56.38 A C ATOM 654 OE1 GLN A 90 −11.639 −65.932 0.368 1 61.3 A O ATOM 655 NE2 GLN A 90 −11.654 −67.592 −1.141 1 52.84 A N ATOM 656 C GLN A 90 −12.107 −71.799 1.67 1 47.78 A C ATOM 657 O GLN A 90 −10.916 −72.126 1.767 1 46.24 A O ATOM 658 N LYS A 91 −13.072 −72.6 1.241 1 44.79 A N ATOM 659 CA LYS A 91 −12.834 −73.921 0.62 1 48.76 A C ATOM 660 CB LYS A 91 −14.143 −74.683 0.567 1 45.67 A C ATOM 661 CG LYS A 91 −14.845 −74.835 1.91 1 48.89 A C ATOM 662 CD LYS A 91 −16.159 −75.583 1.732 1 52.05 A C ATOM 663 CE LYS A 91 −16.971 −75.654 3.007 1 54.44 A C ATOM 664 NZ LYS A 91 −18.386 −76.047 2.686 1 56.7 A N ATOM 665 C LYS A 91 −12.346 −73.755 −0.808 1 51.56 A C ATOM 666 O LYS A 91 −13.037 −73.144 −1.608 1 60.01 A O ATOM 667 N THR A 92 −11.156 −74.271 −1.124 1 61.45 A N ATOM 668 CA THR A 92 −10.583 −74.235 −2.483 1 55.7 A C ATOM 669 CB THR A 92 −9.159 −73.682 −2.471 1 57.04 A C ATOM 670 OG1 THR A 92 −8.351 −74.533 −1.657 1 61.11 A O ATOM 671 CG2 THR A 92 −9.112 −72.265 −1.92 1 60.2 A C ATOM 672 C THR A 92 −10.5 −75.639 −3.082 1 60.57 A C ATOM 673 O THR A 92 −10.833 −76.612 −2.424 1 58.72 A O ATOM 674 N ASP A 93 −10.057 −75.716 −4.34 1 73.89 A N ATOM 675 CA ASP A 93 −9.779 −76.992 −5.048 1 82.2 A C ATOM 676 CB ASP A 93 −9.252 −76.741 −6.486 1 85.53 A C ATOM 677 CG ASP A 93 −10.326 −76.19 −7.435 1 96.89 A C ATOM 678 OD1 ASP A 93 −11.515 −76.589 −7.333 1 97.88 A O ATOM 679 OD2 ASP A 93 −9.975 −75.354 −8.295 1 94.75 A O ATOM 680 C ASP A 93 −8.759 −77.854 −4.312 1 77.33 A C ATOM 681 O ASP A 93 −8.96 −79.057 −4.159 1 68.5 A O ATOM 682 N THR A 94 −7.677 −77.216 −3.869 1 70.86 A N ATOM 683 CA THR A 94 −6.571 −77.881 −3.175 1 74.25 A C ATOM 684 CB THR A 94 −5.271 −77.099 −3.422 1 82.12 A C ATOM 685 OG1 THR A 94 −5.446 −75.743 −2.995 1 82.46 A O ATOM 686 CG2 THR A 94 −4.906 −77.112 −4.91 1 84.53 A C ATOM 687 C THR A 94 −6.719 −78.058 −1.646 1 69.71 A C ATOM 688 O THR A 94 −5.967 −78.817 −1.04 1 72.97 A O ATOM 689 N GLY A 95 −7.661 −77.352 −1.025 1 62.53 A N ATOM 690 CA GLY A 95 −7.866 −77.445 0.413 1 61.21 A C ATOM 691 C GLY A 95 −8.607 −76.256 1.004 1 56.35 A C ATOM 692 O GLY A 95 −9.831 −76.193 0.949 1 58.04 A O ATOM 693 N VAL A 96 −7.86 −75.291 1.523 1 51.53 A N ATOM 694 CA VAL A 96 −8.442 −74.184 2.251 1 48.99 A C ATOM 695 CB VAL A 96 −8.608 −74.656 3.712 1 52.06 A C ATOM 696 CG1 VAL A 96 −7.85 −73.814 4.717 1 56.47 A C ATOM 697 CG2 VAL A 96 −10.08 −74.834 4.046 1 50.44 A C ATOM 698 C VAL A 96 −7.557 −72.976 2.047 1 45.61 A C ATOM 699 O VAL A 96 −6.402 −73.137 1.752 1 50.46 A O ATOM 700 N SER A 97 −8.103 −71.783 2.23 1 45.6 A N ATOM 701 CA SER A 97 −7.351 −70.536 2.21 1 41.88 A C ATOM 702 CB SER A 97 −7.371 −69.967 0.817 1 43.35 A C ATOM 703 OG SER A 97 −6.792 −68.678 0.749 1 49.24 A O ATOM 704 C SER A 97 −7.972 −69.501 3.158 1 49.62 A C ATOM 705 O SER A 97 −9.213 −69.299 3.151 1 50.27 A O ATOM 706 N LEU A 98 −7.115 −68.838 3.947 1 44.05 A N ATOM 707 CA LEU A 98 −7.541 −67.82 4.91 1 47.74 A C ATOM 708 CB LEU A 98 −6.685 −67.827 6.188 1 46.42 A C ATOM 709 CG LEU A 98 −7.099 −68.798 7.268 1 44.95 A C ATOM 710 CD1 LEU A 98 −7.051 −70.203 6.74 1 47.84 A C ATOM 711 CD2 LEU A 98 −6.177 −68.658 8.453 1 50.85 A C ATOM 712 C LEU A 98 −7.369 −66.474 4.271 1 44.62 A C ATOM 713 O LEU A 98 −6.269 −66.099 3.968 1 43.48 A O ATOM 714 N GLN A 99 −8.445 −65.751 4.063 1 42.45 A N ATOM 715 CA GLN A 99 −8.349 −64.472 3.384 1 43.16 A C ATOM 716 CB GLN A 99 −9.135 −64.513 2.072 1 48.52 A C ATOM 717 CG GLN A 99 −8.516 −65.359 0.956 1 56.02 A C ATOM 718 CD GLN A 99 −7.094 −64.952 0.631 1 59.86 A C ATOM 719 OE1 GLN A 99 −6.253 −65.809 0.371 1 62.92 A O ATOM 720 NE2 GLN A 99 −6.8 −63.644 0.715 1 64.5 A N ATOM 721 C GLN A 99 −8.934 −63.394 4.24 1 35.27 A C ATOM 722 O GLN A 99 −9.959 −63.578 4.87 1 35.18 A O ATOM 723 N THR A 100 −8.272 −62.264 4.23 1 35.32 A N ATOM 724 CA THR A 100 −8.701 −61.07 4.899 1 37.73 A C ATOM 725 CB THR A 100 −7.511 −60.345 5.513 1 41.27 A C ATOM 726 OG1 THR A 100 −6.964 −61.182 6.535 1 44.05 A O ATOM 727 CG2 THR A 100 −7.954 −59.086 6.223 1 50.63 A C ATOM 728 C THR A 100 −9.425 −60.218 3.899 1 36.68 A C ATOM 729 O THR A 100 −8.91 −60.005 2.828 1 36.68 A O ATOM 730 N TYR A 101 −10.636 −59.783 4.241 1 35.31 A N ATOM 731 CA TYR A 101 −11.435 −58.821 3.434 1 35.19 A C ATOM 732 CB TYR A 101 −12.82 −59.356 3.201 1 34.38 A C ATOM 733 CG TYR A 101 −12.796 −60.542 2.302 1 33.66 A C ATOM 734 CD1 TYR A 101 −12.567 −61.787 2.79 1 33.9 A C ATOM 735 CE1 TYR A 101 −12.498 −62.885 1.938 1 38.86 A C ATOM 736 CZ TYR A 101 −12.695 −62.705 0.583 1 42.24 A C ATOM 737 OH TYR A 101 −12.612 −63.748 −0.28 1 46.33 A O ATOM 738 CE2 TYR A 101 −12.939 −61.46 0.081 1 38.59 A C ATOM 739 CD2 TYR A 101 −12.987 −60.389 0.942 1 38.04 A C ATOM 740 C TYR A 101 −11.546 −57.51 4.157 1 34.93 A C ATOM 741 O TYR A 101 −11.833 −57.524 5.342 1 36.99 A O ATOM 742 N ASP A 102 −11.28 −56.394 3.469 1 35.42 A N ATOM 743 CA ASP A 102 −11.309 −55.056 4.083 1 44.08 A C ATOM 744 CB ASP A 102 −10.285 −54.092 3.443 1 47.73 A C ATOM 745 CG ASP A 102 −8.833 −54.368 3.851 1 56.95 A C ATOM 746 OD1 ASP A 102 −8.565 −55.129 4.808 1 59.13 A O ATOM 747 OD2 ASP A 102 −7.941 −53.808 3.165 1 62.44 A O ATOM 748 C ASP A 102 −12.665 −54.387 3.967 1 43.71 A C ATOM 749 O ASP A 102 −12.932 −53.492 4.722 1 57.62 A O ATOM 750 N ASP A 103 −13.51 −54.851 3.055 1 37.58 A N ATOM 751 CA ASP A 103 −14.717 −54.149 2.588 1 40.21 A C ATOM 752 CB ASP A 103 −14.653 −54.118 1.038 1 43.79 A C ATOM 753 CG ASP A 103 −14.615 −55.577 0.42 1 47.95 A C ATOM 754 OD1 ASP A 103 −14.001 −56.506 1.048 1 41.48 A O ATOM 755 OD2 ASP A 103 −15.22 −55.798 −0.658 1 52.61 A O ATOM 756 C ASP A 103 −15.992 −54.906 2.989 1 38.24 A C ATOM 757 O ASP A 103 −16.92 −55.039 2.188 1 39.02 A O ATOM 758 N LEU A 104 −16.037 −55.455 4.182 1 34.45 A N ATOM 759 CA LEU A 104 −17.081 −56.434 4.498 1 35.78 A C ATOM 760 CB LEU A 104 −16.418 −57.775 4.674 1 37.65 A C ATOM 761 CG LEU A 104 −17.274 −59.02 4.644 1 37.69 A C ATOM 762 CD1 LEU A 104 −16.37 −60.252 4.463 1 39.36 A C ATOM 763 CD2 LEU A 104 −18.128 −59.136 5.874 1 38.07 A C ATOM 764 C LEU A 104 −17.921 −56.073 5.692 1 35.62 A C ATOM 765 O LEU A 104 −19.132 −56.143 5.616 1 35.02 A O ATOM 766 N LEU A 105 −17.29 −55.696 6.802 1 36.57 A N ATOM 767 CA LEU A 105 −17.989 −55.289 7.996 1 31.36 A C ATOM 768 CB LEU A 105 −17.311 −55.899 9.201 1 32.04 A C ATOM 769 CG LEU A 105 −17.294 −57.43 9.315 1 35.48 A C ATOM 770 CD1 LEU A 105 −16.486 −57.82 10.554 1 34.34 A C ATOM 771 CD2 LEU A 105 −18.708 −57.945 9.447 1 35.44 A C ATOM 772 C LEU A 105 −17.857 −53.804 8.121 1 34.05 A C ATOM 773 O LEU A 105 −16.747 −53.296 8.14 1 32.83 A O ATOM 774 N ALA A 106 −18.959 −53.081 8.251 1 35.04 A N ATOM 775 CA ALA A 106 −18.844 −51.613 8.434 1 34.16 A C ATOM 776 CB ALA A 106 −20.169 −50.935 8.195 1 33.44 A C ATOM 777 C ALA A 106 −18.375 −51.311 9.832 1 33.98 A C ATOM 778 O ALA A 106 −18.742 −51.974 10.762 1 32.86 A O ATOM 779 N LYS A 107 −17.593 −50.266 9.962 1 36.29 A N ATOM 780 CA LYS A 107 −17.06 −49.822 11.233 1 37.95 A C ATOM 781 CB LYS A 107 −15.594 −49.484 11.021 1 39.49 A C ATOM 782 CG LYS A 107 −14.85 −48.81 12.127 1 42.53 A C ATOM 783 CD LYS A 107 −13.355 −48.953 11.812 1 49.03 A C ATOM 784 CE LYS A 107 −12.46 −47.988 12.538 1 50.92 A C ATOM 785 NZ LYS A 107 −12.987 −47.709 13.887 1 54.27 A N ATOM 786 C LYS A 107 −17.781 −48.611 11.74 1 37.57 A C ATOM 787 O LYS A 107 −18.04 −48.527 12.888 1 38.51 A O ATOM 788 N ASP A 108 −18.008 −47.62 10.896 1 41.51 A N ATOM 789 CA ASP A 108 −18.862 −46.475 11.252 1 45.33 A C ATOM 790 CB ASP A 108 −18.094 −45.376 12.012 1 50.5 A C ATOM 791 CG ASP A 108 −16.78 −45.073 11.416 1 58.08 A C ATOM 792 OD1 ASP A 108 −16.681 −45.084 10.184 1 61.77 A O ATOM 793 OD2 ASP A 108 −15.818 −44.825 12.185 1 74.18 A O ATOM 794 C ASP A 108 −19.594 −45.96 10.014 1 40.03 A C ATOM 795 O ASP A 108 −19.451 −46.518 8.937 1 41.17 A O ATOM 796 N CYS A 109 −20.432 −44.951 10.199 1 37.48 A N ATOM 797 CA CYS A 109 −21.428 −44.585 9.225 1 38.68 A C ATOM 798 CB CYS A 109 −22.756 −45.06 9.783 1 38.13 A C ATOM 799 SG CYS A 109 −22.768 −46.857 10.032 1 43.3 A S ATOM 800 C CYS A 109 −21.442 −43.074 8.967 1 38.48 A C ATOM 801 O CYS A 109 −21.252 −42.28 9.876 1 39.92 A O ATOM 802 N HIS A 110 −21.698 −42.666 7.728 1 37.77 A N ATOM 803 CA HIS A 110 −22.021 −41.261 7.481 1 35.38 A C ATOM 804 CB HIS A 110 −20.747 −40.415 7.336 1 38.02 A C ATOM 805 CG HIS A 110 −19.832 −40.852 6.243 1 39.63 A C ATOM 806 ND1 HIS A 110 −20.213 −41.687 5.21 1 47.3 A N ATOM 807 CE1 HIS A 110 −19.214 −41.819 4.356 1 41.43 A C ATOM 808 NE2 HIS A 110 −18.198 −41.106 4.804 1 37.91 A N ATOM 809 CD2 HIS A 110 −18.559 −40.49 5.976 1 39.91 A C ATOM 810 C HIS A 110 −22.995 −41.104 6.34 1 37.11 A C ATOM 811 O HIS A 110 −23.454 −42.125 5.766 1 32.86 A O ATOM 812 N CYS A 111 −23.386 −39.85 6.088 1 35.59 A N ATOM 813 CA CYS A 111 −24.429 −39.543 5.119 1 37.83 A C ATOM 814 CB CYS A 111 −25.502 −38.652 5.763 1 39.42 A C ATOM 815 SG CYS A 111 −26.387 −39.509 7.076 1 40.31 A S ATOM 816 C CYS A 111 −23.868 −38.905 3.862 1 39.56 A C ATOM 817 O CYS A 111 −23.048 −37.948 3.929 1 43.88 A O ATOM 818 N ILE A 112 −24.306 −39.408 2.706 1 39.08 A N ATOM 819 CA ILE A 112 −23.852 −38.835 1.419 1 42.88 A C ATOM 820 CB ILE A 112 −22.51 −39.437 0.965 1 43.81 A C ATOM 821 CG1 ILE A 112 −22.105 −38.811 −0.375 1 43.24 A C ATOM 822 CD1 ILE A 112 −20.626 −38.782 −0.534 1 42.73 A C ATOM 823 CG2 ILE A 112 −22.545 −40.946 0.826 1 41.93 A C ATOM 824 C ILE A 112 −24.891 −38.817 0.28 1 47.04 A C ATOM 825 O ILE A 112 −25.482 −39.859 −0.044 1 58.35 A O TER 826 ILE A 112 ATOM 827 N TRP B 129 −4.147 −80.481 18.979 1 84.64 B N ATOM 828 CA TRP B 129 −4.734 −79.241 18.366 1 77.53 B C ATOM 829 CB TRP B 129 −4.199 −77.995 19.083 1 89 B C ATOM 830 CG TRP B 129 −4.63 −77.832 20.53 1 102.56 B C ATOM 831 CD1 TRP B 129 −5.858 −78.141 21.078 1 100.87 B C ATOM 832 NE1 TRP B 129 −5.872 −77.821 22.418 1 102.38 B N ATOM 833 CE2 TRP B 129 −4.651 −77.293 22.767 1 111.5 B C ATOM 834 CD2 TRP B 129 −3.844 −77.272 21.598 1 107.85 B C ATOM 835 CE3 TRP B 129 −2.532 −76.763 21.685 1 103.13 B C ATOM 836 CZ3 TRP B 129 −2.07 −76.285 22.93 1 99.55 B C ATOM 837 CH2 TRP B 129 −2.898 −76.314 24.075 1 100.69 B C ATOM 838 CZ2 TRP B 129 −4.185 −76.811 24.017 1 107.52 B C ATOM 839 C TRP B 129 −4.397 −79.133 16.875 1 65.87 B C ATOM 840 O TRP B 129 −3.269 −78.774 16.529 1 64.3 B O ATOM 841 N SER B 130 −5.344 −79.465 15.992 1 63.64 B N ATOM 842 CA SER B 130 −5.178 −79.177 14.547 1 58.11 B C ATOM 843 CB SER B 130 −6.328 −79.697 13.703 1 58.52 B C ATOM 844 OG SER B 130 −6.075 −79.414 12.331 1 60.85 B O ATOM 845 C SER B 130 −5.154 −77.682 14.352 1 55.08 B C ATOM 846 O SER B 130 −6.012 −76.99 14.899 1 52.08 B O ATOM 847 N CYS B 131 −4.157 −77.201 13.604 1 57.32 B N ATOM 848 CA CYS B 131 −4.119 −75.827 13.142 1 55.51 B C ATOM 849 CB CYS B 131 −2.87 −75.569 12.302 1 55.66 B C ATOM 850 SG CYS B 131 −1.325 −75.591 13.285 1 55.06 B S ATOM 851 C CYS B 131 −5.423 −75.371 12.419 1 54 B C ATOM 852 O CYS B 131 −5.867 −74.248 12.639 1 60.47 B O ATOM 853 N LEU B 132 −6.059 −76.256 11.656 1 49.93 B N ATOM 854 CA LEU B 132 −7.361 −75.99 11.002 1 51.9 B C ATOM 855 CB LEU B 132 −7.81 −77.213 10.166 1 54.66 B C ATOM 856 CG LEU B 132 −9.125 −77.075 9.371 1 54.16 B C ATOM 857 CD1 LEU B 132 −9.138 −75.769 8.598 1 51.69 B C ATOM 858 CD2 LEU B 132 −9.333 −78.236 8.411 1 55.71 B C ATOM 859 C LEU B 132 −8.456 −75.675 12.001 1 48.94 B C ATOM 860 O LEU B 132 −9.108 −74.66 11.905 1 48.74 B O ATOM 861 N GLU B 133 −8.629 −76.56 12.969 1 48.27 B N ATOM 862 CA GLU B 133 −9.638 −76.419 14.011 1 47.85 B C ATOM 863 CB GLU B 133 −9.66 −77.647 14.911 1 51.5 B C ATOM 864 CG GLU B 133 −10.194 −78.864 14.177 1 61.81 B C ATOM 865 CD GLU B 133 −10.22 −80.105 15.042 1 71.01 B C ATOM 866 OE1 GLU B 133 −9.224 −80.331 15.763 1 80.29 B O ATOM 867 OE2 GLU B 133 −11.226 −80.851 14.991 1 72.66 B O ATOM 868 C GLU B 133 −9.456 −75.192 14.864 1 49.99 B C ATOM 869 O GLU B 133 −10.436 −74.56 15.216 1 51.03 B O ATOM 870 N VAL B 134 −8.21 −74.833 15.164 1 48.56 B N ATOM 871 CA VAL B 134 −7.93 −73.601 15.904 1 47.66 B C ATOM 872 CB VAL B 134 −6.451 −73.543 16.333 1 54.4 B C ATOM 873 CG1 VAL B 134 −6.113 −72.197 16.959 1 56.48 B C ATOM 874 CG2 VAL B 134 −6.134 −74.67 17.308 1 59.73 B C ATOM 875 C VAL B 134 −8.239 −72.408 15.01 1 42.81 B C ATOM 876 O VAL B 134 −8.775 −71.4 15.464 1 40.31 B O ATOM 877 N ALA B 135 −7.858 −72.523 13.737 1 42.75 B N ATOM 878 CA ALA B 135 −8.168 −71.5 12.765 1 42.24 B C ATOM 879 CB ALA B 135 −7.554 −71.8 11.422 1 40.45 B C ATOM 880 C ALA B 135 −9.703 −71.284 12.695 1 41.09 B C ATOM 881 O ALA B 135 −10.156 −70.13 12.843 1 40.83 B O ATOM 882 N GLU B 136 −10.478 −72.37 12.648 1 42.57 B N ATOM 883 CA GLU B 136 −11.985 −72.298 12.641 1 42.83 B C ATOM 884 CB GLU B 136 −12.624 −73.662 12.479 1 40.96 B C ATOM 885 CG GLU B 136 −12.383 −74.292 11.106 1 52.45 B C ATOM 886 CD GLU B 136 −13.049 −75.661 10.956 1 60.06 B C ATOM 887 OE1 GLU B 136 −12.448 −76.703 11.322 1 66.51 B O ATOM 888 OE2 GLU B 136 −14.199 −75.691 10.478 1 64.3 B O ATOM 889 C GLU B 136 −12.561 −71.659 13.884 1 45.4 B C ATOM 890 O GLU B 136 −13.49 −70.865 13.781 1 52.26 B O ATOM 891 N ALA B 137 −11.995 −71.99 15.048 1 43.05 B N ATOM 892 CA ALA B 137 −12.444 −71.417 16.32 1 44.49 B C ATOM 893 CB ALA B 137 −11.861 −72.175 17.518 1 44.93 B C ATOM 894 C ALA B 137 −12.087 −69.942 16.413 1 40.96 B C ATOM 895 O ALA B 137 −12.895 −69.19 16.88 1 39.85 B O ATOM 896 N CYS B 138 −10.89 −69.548 15.965 1 34.81 B N ATOM 897 CA CYS B 138 −10.475 −68.161 16.037 1 38.43 B C ATOM 898 CB CYS B 138 −8.98 −68.003 15.735 1 38.72 B C ATOM 899 SG CYS B 138 −8.441 −66.271 15.755 1 50.88 B S ATOM 900 C CYS B 138 −11.305 −67.331 15.067 1 39.96 B C ATOM 901 O CYS B 138 −11.791 −66.223 15.393 1 38.84 B O ATOM 902 N VAL B 139 −11.473 −67.868 13.863 1 43.03 B N ATOM 903 CA VAL B 139 −12.191 −67.133 12.803 1 41.3 B C ATOM 904 CB VAL B 139 −12.015 −67.824 11.433 1 43.29 B C ATOM 905 CG1 VAL B 139 −12.952 −67.208 10.375 1 44.13 B C ATOM 906 CG2 VAL B 139 −10.583 −67.688 10.973 1 40.84 B C ATOM 907 C VAL B 139 −13.661 −66.99 13.15 1 37.13 B C ATOM 908 O VAL B 139 −14.273 −65.958 12.867 1 34.89 B O ATOM 909 N GLY B 140 −14.202 −68.043 13.781 1 37.64 B N ATOM 910 CA GLY B 140 −15.569 −68.095 14.289 1 37.29 B C ATOM 911 C GLY B 140 −15.94 −67.152 15.417 1 41.77 B C ATOM 912 O GLY B 140 −17.11 −66.964 15.646 1 44.72 B O ATOM 913 N ASP B 141 −14.952 −66.554 16.08 1 39.39 B N ATOM 914 CA ASP B 141 −15.128 −65.668 17.185 1 37.52 B C ATOM 915 CB ASP B 141 −14.055 −66.037 18.226 1 39.33 B C ATOM 916 CG ASP B 141 −14.16 −65.181 19.494 1 47.58 B C ATOM 917 OD1 ASP B 141 −15.21 −65.284 20.177 1 51.89 B O ATOM 918 OD2 ASP B 141 −13.232 −64.391 19.787 1 49.26 B O ATOM 919 C ASP B 141 −14.968 −64.182 16.781 1 38.08 B C ATOM 920 O ASP B 141 −14.081 −63.828 16.014 1 39.23 B O ATOM 921 N VAL B 142 −15.781 −63.295 17.323 1 38.68 B N ATOM 922 CA VAL B 142 −15.784 −61.887 16.878 1 37.8 B C ATOM 923 CB VAL B 142 −16.869 −61.061 17.565 1 40.3 B C ATOM 924 CG1 VAL B 142 −16.685 −59.562 17.344 1 38.98 B C ATOM 925 CG2 VAL B 142 −18.219 −61.451 16.997 1 45.37 B C ATOM 926 C VAL B 142 −14.439 −61.221 17.098 1 37.65 B C ATOM 927 O VAL B 142 −13.864 −60.696 16.163 1 34.4 B O ATOM 928 N VAL B 143 −13.932 −61.289 18.314 1 35.35 B N ATOM 929 CA VAL B 143 −12.681 −60.624 18.682 1 39.43 B C ATOM 930 CB VAL B 143 −12.564 −60.47 20.239 1 42.03 B C ATOM 931 CG1 VAL B 143 −11.13 −60.189 20.709 1 37.07 B C ATOM 932 CG2 VAL B 143 −13.479 −59.341 20.706 1 42.47 B C ATOM 933 C VAL B 143 −11.429 −61.299 18.098 1 38.55 B C ATOM 934 O VAL B 143 −10.522 −60.608 17.673 1 39.69 B O ATOM 935 N CYS B 144 −11.377 −62.629 18.106 1 33.67 B N ATOM 936 CA CYS B 144 −10.221 −63.31 17.624 1 39.77 B C ATOM 937 CB CYS B 144 −10.261 −64.822 17.963 1 42.41 B C ATOM 938 SG CYS B 144 −8.653 −65.673 17.776 1 50.74 B S ATOM 939 C CYS B 144 −10.07 −63.076 16.118 1 37.13 B C ATOM 940 O CYS B 144 −8.938 −62.823 15.662 1 35.09 B O ATOM 941 N ASN B 145 −11.204 −63.16 15.393 1 34.92 B N ATOM 942 CA ASN B 145 −11.285 −62.835 13.958 1 32.26 B C ATOM 943 CB ASN B 145 −12.708 −62.881 13.429 1 35.06 B C ATOM 944 CG ASN B 145 −12.764 −62.816 11.914 1 35.15 B C ATOM 945 OD1 ASN B 145 −12.267 −61.857 11.308 1 34.04 B O ATOM 946 ND2 ASN B 145 −13.297 −63.86 11.288 1 31.36 B N ATOM 947 C ASN B 145 −10.685 −61.475 13.68 1 35.76 B C ATOM 948 O ASN B 145 −9.768 −61.347 12.851 1 32.04 B O ATOM 949 N ALA B 146 −11.16 −60.466 14.405 1 36.14 B N ATOM 950 CA ALA B 146 −10.621 −59.095 14.249 1 36.78 B C ATOM 951 CB ALA B 146 −11.378 −58.096 15.114 1 34.28 B C ATOM 952 C ALA B 146 −9.127 −59.014 14.524 1 38.43 B C ATOM 953 O ALA B 146 −8.387 −58.379 13.74 1 38.21 B O ATOM 954 N GLN B 147 −8.659 −59.667 15.596 1 34.9 B N ATOM 955 CA GLN B 147 −7.246 −59.573 15.903 1 37.1 B C ATOM 956 CB GLN B 147 −6.93 −60.007 17.326 1 40.1 B C ATOM 957 CG GLN B 147 −7.554 −59.137 18.405 1 42.04 B C ATOM 958 CD GLN B 147 −7.049 −57.705 18.445 1 45.64 B C ATOM 959 OE1 GLN B 147 −6.134 −57.31 17.745 1 46.97 B O ATOM 960 NE2 GLN B 147 −7.674 −56.916 19.281 1 51.25 B N ATOM 961 C GLN B 147 −6.409 −60.383 14.928 1 37.32 B C ATOM 962 O GLN B 147 −5.284 −59.991 14.573 1 36.6 B O ATOM 963 N LEU B 148 −6.938 −61.517 14.506 1 36.07 B N ATOM 964 CA LEU B 148 −6.256 −62.287 13.514 1 38.39 B C ATOM 965 CB LEU B 148 −6.992 −63.607 13.259 1 36.05 B C ATOM 966 CG LEU B 148 −6.35 −64.506 12.213 1 40.43 B C ATOM 967 CD1 LEU B 148 −5.011 −65.041 12.703 1 45.08 B C ATOM 968 CD2 LEU B 148 −7.25 −65.689 11.951 1 41.59 B C ATOM 969 C LEU B 148 −6.13 −61.433 12.218 1 40.4 B C ATOM 970 O LEU B 148 −5.074 −61.397 11.592 1 39.66 B O ATOM 971 N ALA B 149 −7.186 −60.727 11.827 1 35.23 B N ATOM 972 CA ALA B 149 −7.104 −59.95 10.581 1 36.99 B C ATOM 973 CB ALA B 149 −8.418 −59.276 10.238 1 34.78 B C ATOM 974 C ALA B 149 −5.985 −58.927 10.607 1 39.14 B C ATOM 975 O ALA B 149 −5.286 −58.786 9.607 1 39.83 B O ATOM 976 N SER B 150 −5.764 −58.254 11.729 1 39.56 B N ATOM 977 CA SER B 150 −4.718 −57.23 11.767 1 43.78 B C ATOM 978 CB SER B 150 −4.693 −56.499 13.079 1 46.9 B C ATOM 979 OG SER B 150 −5.887 −55.815 13.239 1 46.21 B O ATOM 980 C SER B 150 −3.356 −57.83 11.57 1 48.49 B C ATOM 981 O SER B 150 −2.488 −57.249 10.906 1 47.09 B O ATOM 982 N TYR B 151 −3.192 −59.011 12.133 1 46.28 B N ATOM 983 CA TYR B 151 −1.93 −59.708 12.073 1 46.04 B C ATOM 984 CB TYR B 151 −1.856 −60.733 13.26 1 49.6 B C ATOM 985 CG TYR B 151 −1.175 −62.018 12.973 1 53.58 B C ATOM 986 CD1 TYR B 151 0.071 −62.021 12.392 1 54.29 B C ATOM 987 CE1 TYR B 151 0.721 −63.186 12.1 1 61.09 B C ATOM 988 CZ TYR B 151 0.147 −64.385 12.393 1 67.39 B C ATOM 989 OH TYR B 151 0.89 −65.488 12.062 1 80.4 B O ATOM 990 CE2 TYR B 151 −1.104 −64.438 13.002 1 67.14 B C ATOM 991 CD2 TYR B 151 −1.755 −63.24 13.298 1 64.93 B C ATOM 992 C TYR B 151 −1.706 −60.285 10.647 1 42.07 B C ATOM 993 O TYR B 151 −0.64 −60.114 10.059 1 39.45 B O ATOM 994 N LEU B 152 −2.676 −60.995 10.1 1 40.01 B N ATOM 995 CA LEU B 152 −2.539 −61.511 8.729 1 38.13 B C ATOM 996 CB LEU B 152 −3.781 −62.263 8.298 1 38.49 B C ATOM 997 CG LEU B 152 −4.1 −63.552 9.033 1 40.64 B C ATOM 998 CD1 LEU B 152 −5.257 −64.28 8.379 1 38.96 B C ATOM 999 CD2 LEU B 152 −2.868 −64.438 9.041 1 42.98 B C ATOM 1000 C LEU B 152 −2.23 −60.426 7.703 1 39.75 B C ATOM 1001 O LEU B 152 −1.408 −60.62 6.794 1 40.43 B O ATOM 1002 N LYS B 153 −2.843 −59.274 7.876 1 41.28 B N ATOM 1003 CA LYS B 153 −2.566 −58.147 7.002 1 48.39 B C ATOM 1004 CB LYS B 153 −3.53 −56.971 7.209 1 47.96 B C ATOM 1005 CG LYS B 153 −4.831 −57.21 6.477 1 56.5 B C ATOM 1006 CD LYS B 153 −5.938 −56.24 6.878 1 62.78 B C ATOM 1007 CE LYS B 153 −5.721 −54.869 6.253 1 63.98 B C ATOM 1008 NZ LYS B 153 −6.228 −53.841 7.196 1 71.29 B N ATOM 1009 C LYS B 153 −1.145 −57.686 7.168 1 46.97 B C ATOM 1010 O LYS B 153 −0.434 −57.612 6.206 1 50.41 B O ATOM 1011 N ALA B 154 −0.724 −57.393 8.384 1 46.25 B N ATOM 1012 CA ALA B 154 0.582 −56.813 8.582 1 49.44 B C ATOM 1013 CB ALA B 154 0.766 −56.419 10.041 1 54.7 B C ATOM 1014 C ALA B 154 1.709 −57.732 8.126 1 47.24 B C ATOM 1015 O ALA B 154 2.796 −57.276 7.876 1 57.26 B O ATOM 1016 N CYS B 155 1.443 −59.019 8.031 1 46.82 B N ATOM 1017 CA CYS B 155 2.431 −60.008 7.692 1 47.64 B C ATOM 1018 CB CYS B 155 2.364 −61.138 8.74 1 45.94 B C ATOM 1019 SG CYS B 155 2.85 −60.645 10.43 1 45.42 B S ATOM 1020 C CYS B 155 2.244 −60.616 6.291 1 53.03 B C ATOM 1021 O CYS B 155 2.713 −61.719 6.043 1 56.8 B O ATOM 1022 N SER B 156 1.552 −59.922 5.388 1 57.31 B N ATOM 1023 CA SER B 156 1.301 −60.43 4.04 1 63.29 B C ATOM 1024 CB SER B 156 −0.152 −60.156 3.637 1 67.38 B C ATOM 1025 OG SER B 156 −0.468 −58.756 3.747 1 64.8 B O ATOM 1026 C SER B 156 2.235 −59.713 3.068 1 68.43 B C ATOM 1027 O SER B 156 2.737 −58.624 3.372 1 62.04 B O ATOM 1028 N ALA B 157 2.414 −60.306 1.887 1 86.18 B N ATOM 1029 CA ALA B 157 3.248 −59.737 0.794 1 97.02 B C ATOM 1030 CB ALA B 157 3.403 −60.769 −0.34 1 98.84 B C ATOM 1031 C ALA B 157 2.78 −58.339 0.246 1 98.22 B C ATOM 1032 O ALA B 157 1.895 −57.713 0.828 1 89.22 B O ATOM 1033 N ASN B 158 3.355 −57.881 −0.879 1 112.93 B N ATOM 1034 CA ASN B 158 3.349 −56.449 −1.304 1 120.5 B C ATOM 1035 CB ASN B 158 1.909 −55.873 −1.456 1 127.93 B C ATOM 1036 CG ASN B 158 1.648 −54.641 −0.595 1 137.85 B C ATOM 1037 OD1 ASN B 158 1.613 −53.517 −1.1 1 141.42 B O ATOM 1038 ND2 ASN B 158 1.469 −54.849 0.71 1 144.72 B N ATOM 1039 C ASN B 158 4.334 −55.557 −0.473 1 125.83 B C ATOM 1040 O ASN B 158 4.32 −54.326 −0.576 1 130.25 B O ATOM 1041 N GLY B 159 5.226 −56.199 0.288 1 123.24 B N ATOM 1042 CA GLY B 159 6.186 −55.526 1.17 1 114.52 B C ATOM 1043 C GLY B 159 7.37 −54.789 0.558 1 116.39 B C ATOM 1044 O GLY B 159 7.513 −53.6 0.827 1 135.54 B O ATOM 1045 N ASN B 160 8.259 −55.435 −0.213 1 111.89 B N ATOM 1046 CA ASN B 160 8.264 −56.869 −0.528 1 101.95 B C ATOM 1047 CB ASN B 160 7.967 −57.091 −2.019 1 103.89 B C ATOM 1048 CG ASN B 160 6.588 −57.712 −2.278 1 109.29 B C ATOM 1049 OD1 ASN B 160 6.226 −58.733 −1.695 1 98.47 B O ATOM 1050 ND2 ASN B 160 5.829 −57.114 −3.191 1 114.85 B N ATOM 1051 C ASN B 160 9.592 −57.562 −0.105 1 99.55 B C ATOM 1052 O ASN B 160 10.662 −56.955 −0.265 1 79 B O ATOM 1053 N PRO B 161 9.542 −58.818 0.412 1 104.41 B N ATOM 1054 CA PRO B 161 8.305 −59.642 0.495 1 85.67 B C ATOM 1055 CB PRO B 161 8.786 −60.981 1.084 1 86.49 B C ATOM 1056 CG PRO B 161 10.089 −60.684 1.767 1 91.58 B C ATOM 1057 CD PRO B 161 10.573 −59.298 1.363 1 96.4 B C ATOM 1058 C PRO B 161 7.234 −58.985 1.365 1 76.44 B C ATOM 1059 O PRO B 161 6.175 −58.663 0.86 1 84.26 B O ATOM 1060 N CYS B 162 7.534 −58.728 2.632 1 65.64 B N ATOM 1061 CA CYS B 162 6.619 −58.032 3.561 1 68.76 B C ATOM 1062 CB CYS B 162 6.107 −59.01 4.615 1 71.14 B C ATOM 1063 SG CYS B 162 7.474 −59.86 5.454 1 75.18 B S ATOM 1064 C CYS B 162 7.446 −56.972 4.248 1 56.83 B C ATOM 1065 O CYS B 162 8.643 −56.925 4.024 1 65.14 B O ATOM 1066 N ASP B 163 6.816 −56.154 5.081 1 52.73 B N ATOM 1067 CA ASP B 163 7.507 −55.25 5.991 1 52.92 B C ATOM 1068 CB ASP B 163 6.694 −53.957 6.138 1 57.11 B C ATOM 1069 CG ASP B 163 7.26 −52.991 7.214 1 63.98 B C ATOM 1070 OD1 ASP B 163 8.132 −53.372 8.023 1 63.77 B O ATOM 1071 OD2 ASP B 163 6.783 −51.843 7.278 1 71.07 B O ATOM 1072 C ASP B 163 7.681 −55.975 7.331 1 52.76 B C ATOM 1073 O ASP B 163 6.73 −56.049 8.104 1 60.97 B O ATOM 1074 N LEU B 164 8.886 −56.485 7.604 1 49.99 B N ATOM 1075 CA LEU B 164 9.164 −57.335 8.781 1 48.89 B C ATOM 1076 CB LEU B 164 10.579 −57.903 8.758 1 51.78 B C ATOM 1077 CG LEU B 164 10.975 −58.873 9.9 1 57.32 B C ATOM 1078 CD1 LEU B 164 10.026 −60.056 10.052 1 60 B C ATOM 1079 CD2 LEU B 164 12.366 −59.411 9.637 1 57.6 B C ATOM 1080 C LEU B 164 8.964 −56.695 10.135 1 47.44 B C ATOM 1081 O LEU B 164 8.403 −57.324 11.024 1 46.96 B O ATOM 1082 N LYS B 165 9.428 −55.462 10.295 1 50.52 B N ATOM 1083 CA LYS B 165 9.207 −54.699 11.523 1 53.94 B C ATOM 1084 CB LYS B 165 9.846 −53.311 11.43 1 58.73 B C ATOM 1085 CG LYS B 165 11.348 −53.373 11.223 1 73.59 B C ATOM 1086 CD LYS B 165 12.156 −52.406 12.079 1 81.38 B C ATOM 1087 CE LYS B 165 13.636 −52.775 12.011 1 86.48 B C ATOM 1088 NZ LYS B 165 14.476 −51.82 12.776 1 91.26 B N ATOM 1089 C LYS B 165 7.715 −54.565 11.84 1 51.6 B C ATOM 1090 O LYS B 165 7.308 −54.751 12.98 1 49.6 B O ATOM 1091 N GLN B 166 6.923 −54.264 10.807 1 49.41 B N ATOM 1092 CA GLN B 166 5.471 −54.157 10.925 1 52.87 B C ATOM 1093 CB GLN B 166 4.879 −53.605 9.611 1 63.88 B C ATOM 1094 CG GLN B 166 3.385 −53.873 9.411 1 73.01 B C ATOM 1095 CD GLN B 166 2.679 −52.905 8.465 1 77.98 B C ATOM 1096 OE1 GLN B 166 3.31 −52.144 7.712 1 69.61 B O ATOM 1097 NE2 GLN B 166 1.339 −52.935 8.508 1 76.38 B N ATOM 1098 C GLN B 166 4.834 −55.5 11.287 1 44.34 B C ATOM 1099 O GLN B 166 3.994 −55.572 12.175 1 48.1 B O ATOM 1100 N CYS B 167 5.246 −56.562 10.611 1 41.5 B N ATOM 1101 CA CYS B 167 4.703 −57.903 10.875 1 40.85 B C ATOM 1102 CB CYS B 167 5.342 −58.935 9.975 1 39.5 B C ATOM 1103 SG CYS B 167 4.926 −60.658 10.33 1 44.1 B S ATOM 1104 C CYS B 167 4.966 −58.275 12.323 1 39.76 B C ATOM 1105 O CYS B 167 4.077 −58.714 13.026 1 40.44 B O ATOM 1106 N GLN B 168 6.174 −58.012 12.777 1 39.45 B N ATOM 1107 CA GLN B 168 6.591 −58.372 14.159 1 40.53 B C ATOM 1108 CB GLN B 168 8.108 −58.213 14.287 1 42.35 B C ATOM 1109 CG GLN B 168 8.862 −59.354 13.6 1 46.29 B C ATOM 1110 CD GLN B 168 10.388 −59.207 13.697 1 49.83 B C ATOM 1111 OE1 GLN B 168 10.916 −58.115 13.648 1 45.58 B O ATOM 1112 NE2 GLN B 168 11.087 −60.325 13.832 1 52.47 B N ATOM 1113 C GLN B 168 5.842 −57.608 15.237 1 40.56 B C ATOM 1114 O GLN B 168 5.483 −58.154 16.255 1 37.84 B O ATOM 1115 N ALA B 169 5.609 −56.33 15.014 1 45.74 B N ATOM 1116 CA ALA B 169 4.838 −55.519 15.954 1 49.57 B C ATOM 1117 CB ALA B 169 4.899 −54.041 15.54 1 46.23 B C ATOM 1118 C ALA B 169 3.381 −56.026 16.009 1 48.45 B C ATOM 1119 O ALA B 169 2.778 −56.15 17.077 1 47.76 B O ATOM 1120 N ALA B 170 2.826 −56.349 14.849 1 47.07 B N ATOM 1121 CA ALA B 170 1.456 −56.866 14.808 1 45.45 B C ATOM 1122 CB ALA B 170 0.939 −56.897 13.369 1 45.27 B C ATOM 1123 C ALA B 170 1.332 −58.251 15.472 1 41.61 B C ATOM 1124 O ALA B 170 0.3 −58.568 16.016 1 43.57 B O ATOM 1125 N ILE B 171 2.387 −59.06 15.442 1 44.84 B N ATOM 1126 CA ILE B 171 2.39 −60.353 16.121 1 40.1 B C ATOM 1127 CB ILE B 171 3.542 −61.247 15.66 1 41.01 B C ATOM 1128 CG1 ILE B 171 3.37 −61.579 14.167 1 44.02 B C ATOM 1129 CD1 ILE B 171 4.553 −62.333 13.553 1 46.95 B C ATOM 1130 CG2 ILE B 171 3.518 −62.613 16.393 1 45.1 B C ATOM 1131 C ILE B 171 2.397 −60.188 17.626 1 40.08 B C ATOM 1132 O ILE B 171 1.657 −60.845 18.329 1 40.04 B O ATOM 1133 N ARG B 172 3.227 −59.291 18.107 1 45.58 B N ATOM 1134 CA ARG B 172 3.257 −58.93 19.523 1 46.46 B C ATOM 1135 CB ARG B 172 4.37 −57.909 19.791 1 46.22 B C ATOM 1136 CG ARG B 172 5.772 −58.491 19.73 1 49.52 B C ATOM 1137 CD ARG B 172 6.868 −57.504 20.198 1 46.28 B C ATOM 1138 NE ARG B 172 7.624 −57.171 19.007 1 58.43 B N ATOM 1139 CZ ARG B 172 7.71 −55.975 18.421 1 58.61 B C ATOM 1140 NH1 ARG B 172 7.203 −54.883 18.958 1 53.14 B N ATOM 1141 NH2 ARG B 172 8.369 −55.878 17.286 1 62.38 B N ATOM 1142 C ARG B 172 1.908 −58.379 19.996 1 49.77 B C ATOM 1143 O ARG B 172 1.4 −58.762 21.049 1 53.25 B O ATOM 1144 N PHE B 173 1.306 −57.501 19.207 1 49.75 B N ATOM 1145 CA PHE B 173 0.027 −56.945 19.586 1 49.26 B C ATOM 1146 CB PHE B 173 −0.359 −55.824 18.613 1 52.98 B C ATOM 1147 CG PHE B 173 −1.567 −55.052 19.032 1 52.42 B C ATOM 1148 CD1 PHE B 173 −2.831 −55.46 18.652 1 49.14 B C ATOM 1149 CE1 PHE B 173 −3.944 −54.743 19.059 1 51.98 B C ATOM 1150 CZ PHE B 173 −3.799 −53.612 19.846 1 52.24 B C ATOM 1151 CE2 PHE B 173 −2.539 −53.201 20.242 1 47.25 B C ATOM 1152 CD2 PHE B 173 −1.435 −53.908 19.818 1 54.59 B C ATOM 1153 C PHE B 173 −1.029 −58.05 19.63 1 50.95 B C ATOM 1154 O PHE B 173 −1.83 −58.124 20.566 1 49.81 B O ATOM 1155 N PHE B 174 −1.028 −58.918 18.622 1 42.7 B N ATOM 1156 CA PHE B 174 −1.977 −60.032 18.602 1 42.57 B C ATOM 1157 CB PHE B 174 −1.761 −60.892 17.359 1 41.06 B C ATOM 1158 CG PHE B 174 −2.638 −62.078 17.27 1 41.99 B C ATOM 1159 CD1 PHE B 174 −3.917 −61.963 16.813 1 46.31 B C ATOM 1160 CE1 PHE B 174 −4.734 −63.074 16.682 1 48.07 B C ATOM 1161 CZ PHE B 174 −4.26 −64.328 16.998 1 51.45 B C ATOM 1162 CE2 PHE B 174 −2.965 −64.456 17.457 1 50.82 B C ATOM 1163 CD2 PHE B 174 −2.166 −63.334 17.59 1 49.07 B C ATOM 1164 C PHE B 174 −1.889 −60.869 19.876 1 45.11 B C ATOM 1165 O PHE B 174 −2.911 −61.1 20.531 1 45.28 B O ATOM 1166 N TYR B 175 −0.689 −61.298 20.266 1 45.39 B N ATOM 1167 CA TYR B 175 −0.614 −62.219 21.415 1 48.53 B C ATOM 1168 CB TYR B 175 0.685 −63.002 21.406 1 43.19 B C ATOM 1169 CG TYR B 175 0.639 −64.146 20.427 1 43.94 B C ATOM 1170 CD1 TYR B 175 −0.117 −65.27 20.7 1 41.93 B C ATOM 1171 CE1 TYR B 175 −0.173 −66.325 19.845 1 39.55 B C ATOM 1172 CZ TYR B 175 0.553 −66.303 18.689 1 44.93 B C ATOM 1173 OH TYR B 175 0.48 −67.389 17.823 1 48.57 B O ATOM 1174 CE2 TYR B 175 1.328 −65.197 18.381 1 46.09 B C ATOM 1175 CD2 TYR B 175 1.361 −64.12 19.238 1 42.3 B C ATOM 1176 C TYR B 175 −0.865 −61.542 22.782 1 55.58 B C ATOM 1177 O TYR B 175 −1.227 −62.218 23.729 1 60.65 B O ATOM 1178 N GLN B 176 −0.71 −60.222 22.865 1 53.67 B N ATOM 1179 CA GLN B 176 −1.148 −59.478 24.02 1 60.16 B C ATOM 1180 CB GLN B 176 −0.25 −58.264 24.197 1 64.26 B C ATOM 1181 CG GLN B 176 1.172 −58.593 24.614 1 67.62 B C ATOM 1182 CD GLN B 176 2.143 −57.554 24.12 1 74.94 B C ATOM 1183 OE1 GLN B 176 1.767 −56.411 23.838 1 83.26 B O ATOM 1184 NE2 GLN B 176 3.4 −57.943 23.988 1 86.57 B N ATOM 1185 C GLN B 176 −2.604 −58.98 23.96 1 63.93 B C ATOM 1186 O GLN B 176 −2.98 −58.178 24.794 1 71.6 B O ATOM 1187 N ASN B 177 −3.406 −59.384 22.979 1 56.98 B N ATOM 1188 CA ASN B 177 −4.779 −58.898 22.873 1 52.82 B C ATOM 1189 CB ASN B 177 −4.868 −57.792 21.842 1 55.87 B C ATOM 1190 CG ASN B 177 −4.333 −56.495 22.362 1 54.56 B C ATOM 1191 OD1 ASN B 177 −3.257 −56.07 22.009 1 55.98 B O ATOM 1192 ND2 ASN B 177 −5.089 −55.869 23.215 1 56.45 B N ATOM 1193 C ASN B 177 −5.729 −60.017 22.547 1 52.45 B C ATOM 1194 O ASN B 177 −6.773 −59.815 21.909 1 54.86 B O ATOM 1195 N ILE B 178 −5.384 −61.195 23.05 1 50.55 B N ATOM 1196 CA ILE B 178 −6.178 −62.383 22.855 1 50.34 B C ATOM 1197 CB ILE B 178 −5.699 −63.131 21.563 1 59.17 B C ATOM 1198 CG1 ILE B 178 −6.877 −63.424 20.675 1 60.02 B C ATOM 1199 CD1 ILE B 178 −7.267 −62.175 19.944 1 64.99 B C ATOM 1200 CG2 ILE B 178 −4.806 −64.353 21.765 1 57.65 B C ATOM 1201 C ILE B 178 −5.975 −63.125 24.156 1 53.58 B C ATOM 1202 O ILE B 178 −4.874 −63.089 24.698 1 52.87 B O ATOM 1203 N PRO B 179 −7.026 −63.767 24.682 1 59.37 B N ATOM 1204 CA PRO B 179 −6.821 −64.495 25.925 1 65.12 B C ATOM 1205 CB PRO B 179 −8.194 −65.133 26.192 1 67.72 B C ATOM 1206 CG PRO B 179 −9.159 −64.453 25.279 1 66.95 B C ATOM 1207 CD PRO B 179 −8.357 −64.026 24.098 1 62.5 B C ATOM 1208 C PRO B 179 −5.756 −65.575 25.765 1 65.21 B C ATOM 1209 O PRO B 179 −5.638 −66.136 24.674 1 62.76 B O ATOM 1210 N PHE B 180 −5 −65.832 26.837 1 64.23 B N ATOM 1211 CA PHE B 180 −3.96 −66.882 26.892 1 62.82 B C ATOM 1212 CB PHE B 180 −3.332 −66.947 28.31 1 64.6 B C ATOM 1213 CG PHE B 180 −2.349 −68.082 28.503 1 69.56 B C ATOM 1214 CD1 PHE B 180 −2.788 −69.356 28.897 1 73.32 B C ATOM 1215 CE1 PHE B 180 −1.886 −70.411 29.063 1 75.21 B C ATOM 1216 CZ PHE B 180 −0.526 −70.212 28.834 1 75.02 B C ATOM 1217 CE2 PHE B 180 −0.076 −68.959 28.435 1 76.14 B C ATOM 1218 CD2 PHE B 180 −0.983 −67.899 28.274 1 73.14 B C ATOM 1219 C PHE B 180 −4.453 −68.28 26.456 1 65.97 B C ATOM 1220 O PHE B 180 −3.693 −69.053 25.854 1 68.73 B O ATOM 1221 N ASN B 181 −5.7 −68.622 26.762 1 70.01 B N ATOM 1222 CA ASN B 181 −6.215 −69.967 26.411 1 73.87 B C ATOM 1223 CB ASN B 181 −7.587 −70.346 27.071 1 78.98 B C ATOM 1224 CG ASN B 181 −8.382 −69.139 27.641 1 89.31 B C ATOM 1225 OD1 ASN B 181 −7.947 −68.476 28.589 1 82.44 B O ATOM 1226 ND2 ASN B 181 −9.575 −68.892 27.096 1 97.28 B N ATOM 1227 C ASN B 181 −6.235 −70.144 24.888 1 69.59 B C ATOM 1228 O ASN B 181 −5.875 −71.198 24.364 1 68.28 B O ATOM 1229 N ILE B 182 −6.59 −69.077 24.186 1 63.15 B N ATOM 1230 CA ILE B 182 −6.667 −69.083 22.715 1 63.74 B C ATOM 1231 CB ILE B 182 −7.604 −67.938 22.193 1 66.17 B C ATOM 1232 CG1 ILE B 182 −9.065 −68.196 22.601 1 74.9 B C ATOM 1233 CD1 ILE B 182 −9.438 −67.767 24.007 1 75.65 B C ATOM 1234 CG2 ILE B 182 −7.537 −67.809 20.687 1 61.77 B C ATOM 1235 C ILE B 182 −5.253 −68.947 22.141 1 53.94 B C ATOM 1236 O ILE B 182 −4.877 −69.634 21.175 1 53.75 B O ATOM 1237 N ALA B 183 −4.484 −68.037 22.733 1 48.16 B N ATOM 1238 CA ALA B 183 −3.119 −67.823 22.336 1 48.24 B C ATOM 1239 CB ALA B 183 −2.456 −66.811 23.228 1 44.6 B C ATOM 1240 C ALA B 183 −2.328 −69.122 22.299 1 48.09 B C ATOM 1241 O ALA B 183 −1.649 −69.39 21.326 1 47.73 B O ATOM 1242 N GLN B 184 −2.461 −69.957 23.315 1 55.71 B N ATOM 1243 CA GLN B 184 −1.652 −71.185 23.372 1 55.12 B C ATOM 1244 CB GLN B 184 −1.578 −71.785 24.781 1 57.57 B C ATOM 1245 CG GLN B 184 −2.764 −72.607 25.229 1 64.02 B C ATOM 1246 CD GLN B 184 −2.686 −72.912 26.716 1 86.43 B C ATOM 1247 OE1 GLN B 184 −1.591 −73.071 27.276 1 89.95 B O ATOM 1248 NE2 GLN B 184 −3.843 −72.986 27.369 1 94.41 B N ATOM 1249 C GLN B 184 −2.115 −72.203 22.366 1 45.84 B C ATOM 1250 O GLN B 184 −1.292 −72.925 21.832 1 49.16 B O ATOM 1251 N MET B 185 −3.409 −72.264 22.088 1 47.29 B N ATOM 1252 CA MET B 185 −3.885 −73.175 21.033 1 53.23 B C ATOM 1253 CB MET B 185 −5.39 −73.234 20.991 1 60.76 B C ATOM 1254 CG MET B 185 −5.959 −73.874 22.24 1 65.64 B C ATOM 1255 SD MET B 185 −7.73 −74.059 22.101 1 71.68 B S ATOM 1256 CE MET B 185 −8.356 −72.459 22.587 1 70.06 B C ATOM 1257 C MET B 185 −3.343 −72.796 19.651 1 52.74 B C ATOM 1258 O MET B 185 −2.972 −73.667 18.881 1 50.46 B O ATOM 1259 N LEU B 186 −3.256 −71.496 19.373 1 52.44 B N ATOM 1260 CA LEU B 186 −2.648 −71.022 18.148 1 50.77 B C ATOM 1261 CB LEU B 186 −2.898 −69.522 17.972 1 51.34 B C ATOM 1262 CG LEU B 186 −4.333 −69.131 17.619 1 57.24 B C ATOM 1263 CD1 LEU B 186 −4.702 −67.788 18.209 1 57.57 B C ATOM 1264 CD2 LEU B 186 −4.535 −69.1 16.11 1 60.68 B C ATOM 1265 C LEU B 186 −1.149 −71.282 18.14 1 52.74 B C ATOM 1266 O LEU B 186 −0.594 −71.713 17.148 1 50.08 B O ATOM 1267 N ALA B 187 −0.479 −70.953 19.233 1 54.61 B N ATOM 1268 CA ALA B 187 0.981 −71.006 19.257 1 54.45 B C ATOM 1269 CB ALA B 187 1.525 −70.386 20.538 1 59.9 B C ATOM 1270 C ALA B 187 1.488 −72.407 19.091 1 47.38 B C ATOM 1271 O ALA B 187 2.471 −72.618 18.411 1 53.43 B O ATOM 1272 N PHE B 188 0.787 −73.366 19.672 1 53.03 B N ATOM 1273 CA PHE B 188 1.255 −74.749 19.715 1 53.46 B C ATOM 1274 CB PHE B 188 1.254 −75.265 21.179 1 53.65 B C ATOM 1275 CG PHE B 188 2.08 −74.401 22.098 1 53.95 B C ATOM 1276 CD1 PHE B 188 3.438 −74.276 21.895 1 57.34 B C ATOM 1277 CE1 PHE B 188 4.201 −73.439 22.685 1 60.31 B C ATOM 1278 CZ PHE B 188 3.603 −72.704 23.687 1 57.25 B C ATOM 1279 CE2 PHE B 188 2.249 −72.811 23.897 1 55.85 B C ATOM 1280 CD2 PHE B 188 1.496 −73.647 23.099 1 58.14 B C ATOM 1281 C PHE B 188 0.53 −75.683 18.787 1 55.48 B C ATOM 1282 O PHE B 188 0.866 −76.862 18.755 1 55.92 B O ATOM 1283 N CYS B 189 −0.412 −75.182 17.985 1 55.03 B N ATOM 1284 CA CYS B 189 −1.143 −76.056 17.026 1 53.99 B C ATOM 1285 CB CYS B 189 −2.223 −75.259 16.209 1 53.92 B C ATOM 1286 SG CYS B 189 −1.575 −74.201 14.852 1 52.05 B S ATOM 1287 C CYS B 189 −0.134 −76.737 16.069 1 47.38 B C ATOM 1288 O CYS B 189 0.885 −76.149 15.684 1 43.82 B O ATOM 1289 N ASP B 190 −0.432 −77.958 15.661 1 51.77 B N ATOM 1290 CA ASP B 190 0.402 −78.647 14.683 1 57.63 B C ATOM 1291 CB ASP B 190 1.408 −79.561 15.403 1 63.18 B C ATOM 1292 CG ASP B 190 2.592 −79.963 14.522 1 67.21 B C ATOM 1293 OD1 ASP B 190 2.941 −79.209 13.574 1 58.51 B O ATOM 1294 OD2 ASP B 190 3.152 −81.056 14.763 1 79.87 B O ATOM 1295 C ASP B 190 −0.47 −79.445 13.725 1 58.05 B C ATOM 1296 O ASP B 190 −1.675 −79.531 13.909 1 62.51 B O ATOM 1297 N CYS B 191 0.14 −80.003 12.689 1 64.27 B N ATOM 1298 CA CYS B 191 −0.58 −80.768 11.682 1 71.75 B C ATOM 1299 CB CYS B 191 −0.587 −79.99 10.362 1 69.9 B C ATOM 1300 SG CYS B 191 −1.43 −78.411 10.435 1 73.19 B S ATOM 1301 C CYS B 191 0.084 −82.104 11.399 1 73.29 B C ATOM 1302 O CYS B 191 1.324 −82.162 11.275 1 75.73 B O ATOM 1303 N ALA B 192 −0.746 −83.146 11.242 1 73.48 B N ATOM 1304 CA ALA B 192 −0.37 −84.37 10.506 1 74.57 B C ATOM 1305 CB ALA B 192 −1.611 −85.186 10.186 1 67.42 B C ATOM 1306 C ALA B 192 0.371 −83.993 9.215 1 78.28 B C ATOM 1307 O ALA B 192 0.022 −82.997 8.579 1 86.12 B O ATOM 1308 N GLN B 193 1.406 −84.748 8.847 1 86.15 B N ATOM 1309 CA GLN B 193 2.189 −84.45 7.62 1 95.78 B C ATOM 1310 CB GLN B 193 3.411 −85.382 7.514 1 98.28 B C ATOM 1311 CG GLN B 193 4.273 −85.198 6.263 1 103.53 B C ATOM 1312 CD GLN B 193 4.754 −83.764 6.07 1 112.66 B C ATOM 1313 OE1 GLN B 193 4.985 −83.034 7.04 1 121.3 B O ATOM 1314 NE2 GLN B 193 4.917 −83.356 4.815 1 112.47 B N ATOM 1315 C GLN B 193 1.311 −84.547 6.349 1 95.46 B C ATOM 1316 O GLN B 193 1.425 −83.73 5.427 1 80.54 B O ATOM 1317 N SER B 194 0.461 −85.574 6.333 1 96.23 B N ATOM 1318 CA SER B 194 −0.644 −85.72 5.38 1 93.44 B C ATOM 1319 CB SER B 194 −1.542 −86.916 5.818 1 90.15 B C ATOM 1320 OG SER B 194 −2.93 −86.615 5.837 1 88.17 B O ATOM 1321 C SER B 194 −1.472 −84.419 5.159 1 87.76 B C ATOM 1322 O SER B 194 −1.531 −83.905 4.046 1 95.38 B O ATOM 1323 N ASP B 195 −2.03 −83.868 6.235 1 78.51 B N ATOM 1324 CA ASP B 195 −3.197 −82.954 6.184 1 75.66 B C ATOM 1325 CB ASP B 195 −3.774 −82.827 7.592 1 71.8 B C ATOM 1326 CG ASP B 195 −5.114 −82.209 7.606 1 75.31 B C ATOM 1327 OD1 ASP B 195 −5.516 −81.587 6.596 1 82.32 B O ATOM 1328 OD2 ASP B 195 −5.773 −82.338 8.648 1 77.88 B O ATOM 1329 C ASP B 195 −2.97 −81.544 5.553 1 73 B C ATOM 1330 O ASP B 195 −2.546 −80.586 6.228 1 63.09 B O ATOM 1331 N ILE B 196 −3.297 −81.438 4.262 1 67.49 B N ATOM 1332 CA ILE B 196 −2.993 −80.247 3.47 1 65.54 B C ATOM 1333 CB ILE B 196 −3.176 −80.496 1.932 1 66.74 B C ATOM 1334 CG1 ILE B 196 −2.214 −81.591 1.41 1 69.06 B C ATOM 1335 CD1 ILE B 196 −0.744 −81.247 1.455 1 74.54 B C ATOM 1336 CG2 ILE B 196 −2.989 −79.218 1.119 1 65.37 B C ATOM 1337 C ILE B 196 −3.789 −79.029 3.968 1 58.53 B C ATOM 1338 O ILE B 196 −3.216 −77.93 4.055 1 54.61 B O ATOM 1339 N PRO B 197 −5.095 −79.208 4.274 1 54.87 B N ATOM 1340 CA PRO B 197 −5.834 −78.068 4.828 1 57.6 B C ATOM 1341 CB PRO B 197 −7.275 −78.595 4.971 1 58.82 B C ATOM 1342 CG PRO B 197 −7.35 −79.886 4.202 1 56.94 B C ATOM 1343 CD PRO B 197 −6.008 −80.154 3.6 1 54.63 B C ATOM 1344 C PRO B 197 −5.296 −77.59 6.168 1 57.88 B C ATOM 1345 O PRO B 197 −5.23 −76.353 6.409 1 48.36 B O ATOM 1346 N CYS B 198 −4.91 −78.54 7.03 1 54.2 B N ATOM 1347 CA CYS B 198 −4.291 −78.174 8.304 1 53.53 B C ATOM 1348 CB CYS B 198 −4.029 −79.381 9.184 1 56.05 B C ATOM 1349 SG CYS B 198 −3.412 −78.923 10.822 1 58.84 B S ATOM 1350 C CYS B 198 −3.001 −77.406 8.026 1 51.97 B C ATOM 1351 O CYS B 198 −2.771 −76.334 8.571 1 52.83 B O ATOM 1352 N GLN B 199 −2.209 −77.937 7.119 1 47.79 B N ATOM 1353 CA GLN B 199 −0.902 −77.385 6.78 1 52.43 B C ATOM 1354 CB GLN B 199 −0.185 −78.37 5.793 1 58.44 B C ATOM 1355 CG GLN B 199 1.33 −78.546 5.935 1 73.01 B C ATOM 1356 CD GLN B 199 1.782 −79.426 7.115 1 74.68 B C ATOM 1357 OE1 GLN B 199 1.185 −80.477 7.425 1 75.27 B O ATOM 1358 NE2 GLN B 199 2.86 −79 7.77 1 74.04 B N ATOM 1359 C GLN B 199 −1.058 −75.967 6.193 1 49.15 B C ATOM 1360 O GLN B 199 −0.213 −75.071 6.419 1 47.93 B O ATOM 1361 N GLN B 200 −2.122 −75.765 5.412 1 48.73 B N ATOM 1362 CA GLN B 200 −2.41 −74.437 4.827 1 46.88 B C ATOM 1363 CB GLN B 200 −3.532 −74.512 3.797 1 43.45 B C ATOM 1364 CG GLN B 200 −3.065 −75.186 2.504 1 50.1 B C ATOM 1365 CD GLN B 200 −4.157 −75.825 1.653 1 49.03 B C ATOM 1366 OE1 GLN B 200 −5.169 −76.353 2.14 1 52.56 B O ATOM 1367 NE2 GLN B 200 −3.932 −75.82 0.372 1 53.41 B N ATOM 1368 C GLN B 200 −2.739 −73.445 5.943 1 46.96 B C ATOM 1369 O GLN B 200 −2.29 −72.306 5.913 1 51.15 B O ATOM 1370 N SER B 201 −3.495 −73.894 6.929 1 43.94 B N ATOM 1371 CA SER B 201 −3.8 −73.07 8.102 1 46.83 B C ATOM 1372 CB SER B 201 −4.78 −73.797 9.003 1 45.32 B C ATOM 1373 OG SER B 201 −5.879 −74.221 8.232 1 44.17 B O ATOM 1374 C SER B 201 −2.559 −72.712 8.904 1 46.79 B C ATOM 1375 O SER B 201 −2.353 −71.532 9.271 1 42.69 B O ATOM 1376 N LYS B 202 −1.709 −73.718 9.12 1 49.4 B N ATOM 1377 CA LYS B 202 −0.425 −73.512 9.793 1 47.05 B C ATOM 1378 CB LYS B 202 0.42 −74.784 9.857 1 51.18 B C ATOM 1379 CG LYS B 202 1.588 −74.627 10.861 1 55.38 B C ATOM 1380 CD LYS B 202 2.777 −75.542 10.59 1 63 B C ATOM 1381 CE LYS B 202 2.715 −76.857 11.374 1 67.06 B C ATOM 1382 NZ LYS B 202 3.977 −77.067 12.16 1 73.1 B N ATOM 1383 C LYS B 202 0.379 −72.414 9.141 1 45.09 B C ATOM 1384 O LYS B 202 0.823 −71.466 9.799 1 49.56 B O ATOM 1385 N GLU B 203 0.572 −72.533 7.844 1 48.11 B N ATOM 1386 CA GLU B 203 1.378 −71.561 7.163 1 52.95 B C ATOM 1387 CB GLU B 203 1.463 −71.848 5.658 1 67.8 B C ATOM 1388 CG GLU B 203 2.39 −70.851 4.936 1 83.09 B C ATOM 1389 CD GLU B 203 2.568 −71.13 3.456 1 91.01 B C ATOM 1390 OE1 GLU B 203 3.221 −70.29 2.802 1 89.48 B O ATOM 1391 OE2 GLU B 203 2.067 −72.171 2.957 1 90.34 B O ATOM 1392 C GLU B 203 0.853 −70.155 7.397 1 47.85 B C ATOM 1393 O GLU B 203 1.633 −69.259 7.611 1 46.98 B O ATOM 1394 N ALA B 204 −0.467 −69.983 7.357 1 48.71 B N ATOM 1395 CA ALA B 204 −1.107 −68.684 7.518 1 46.92 B C ATOM 1396 CB ALA B 204 −2.604 −68.797 7.174 1 49.41 B C ATOM 1397 C ALA B 204 −0.945 −68.221 8.935 1 47.26 B C ATOM 1398 O ALA B 204 −0.606 −67.079 9.202 1 46.67 B O ATOM 1399 N LEU B 205 −1.23 −69.136 9.855 1 44.98 B N ATOM 1400 CA LEU B 205 −1.37 −68.777 11.234 1 47.1 B C ATOM 1401 CB LEU B 205 −2.06 −69.881 12.042 1 45.17 B C ATOM 1402 CG LEU B 205 −3.575 −70.024 11.944 1 42.73 B C ATOM 1403 CD1 LEU B 205 −4.038 −71.106 12.904 1 45.26 B C ATOM 1404 CD2 LEU B 205 −4.283 −68.704 12.236 1 43.41 B C ATOM 1405 C LEU B 205 −0.034 −68.471 11.846 1 53.3 B C ATOM 1406 O LEU B 205 0.007 −67.777 12.844 1 61.02 B O ATOM 1407 N HIS B 206 1.051 −68.998 11.293 1 54.96 B N ATOM 1408 CA HIS B 206 2.375 −68.74 11.886 1 61.58 B C ATOM 1409 CB HIS B 206 3.056 −70.067 12.226 1 57.82 B C ATOM 1410 CG HIS B 206 2.336 −70.838 13.296 1 59.97 B C ATOM 1411 ND1 HIS B 206 2.543 −72.186 13.517 1 60.06 B N ATOM 1412 CE1 HIS B 206 1.762 −72.591 14.503 1 60.33 B C ATOM 1413 NE2 HIS B 206 1.058 −71.555 14.931 1 59.19 B N ATOM 1414 CD2 HIS B 206 1.399 −70.447 14.198 1 56.57 B C ATOM 1415 C HIS B 206 3.273 −67.77 11.088 1 61.5 B C ATOM 1416 O HIS B 206 4.45 −67.606 11.416 1 72.4 B O ATOM 1417 N SER B 207 2.678 −67.083 10.105 1 64.07 B N ATOM 1418 CA SER B 207 3.314 −66.013 9.326 1 68.12 B C ATOM 1419 CB SER B 207 3.451 −64.755 10.191 1 79.2 B C ATOM 1420 OG SER B 207 2.496 −63.801 9.775 1 90.22 B O ATOM 1421 C SER B 207 4.643 −66.423 8.707 1 64.74 B C ATOM 1422 O SER B 207 5.654 −65.71 8.762 1 59.99 B O ATOM 1423 N LYS B 208 4.632 −67.598 8.118 1 55.13 B N ATOM 1424 CA LYS B 208 5.874 −68.231 7.785 1 58.17 B C ATOM 1425 CB LYS B 208 5.637 −69.626 7.206 1 55.91 B C ATOM 1426 CG LYS B 208 4.904 −70.554 8.15 1 59.38 B C ATOM 1427 CD LYS B 208 5.667 −70.885 9.43 1 68.94 B C ATOM 1428 CE LYS B 208 6.486 −72.171 9.327 1 69.92 B C ATOM 1429 NZ LYS B 208 5.643 −73.323 8.862 1 76.72 B N ATOM 1430 C LYS B 208 6.713 −67.349 6.846 1 54.5 B C ATOM 1431 O LYS B 208 7.799 −66.88 7.214 1 60.6 B O ATOM 1432 N THR B 209 6.193 −67.055 5.676 1 48.52 B N ATOM 1433 CA THR B 209 7.018 −66.411 4.657 1 55.6 B C ATOM 1434 CB THR B 209 6.317 −66.434 3.279 1 58.26 B C ATOM 1435 OG1 THR B 209 4.984 −65.915 3.403 1 57.27 B O ATOM 1436 CG2 THR B 209 6.236 −67.869 2.768 1 60.72 B C ATOM 1437 C THR B 209 7.419 −64.964 5.016 1 54.63 B C ATOM 1438 O THR B 209 8.321 −64.421 4.409 1 63.72 B O ATOM 1439 N CYS B 210 6.756 −64.332 5.971 1 43.07 B N ATOM 1440 CA CYS B 210 7.209 −63.03 6.414 1 48.49 B C ATOM 1441 CB CYS B 210 6.039 −62.094 6.679 1 49.92 B C ATOM 1442 SG CYS B 210 6.613 −60.434 7.149 1 66.9 B S ATOM 1443 C CYS B 210 8.065 −63.107 7.666 1 46.66 B C ATOM 1444 O CYS B 210 9.156 −62.569 7.7 1 48.31 B O ATOM 1445 N ALA B 211 7.552 −63.752 8.711 1 52.73 B N ATOM 1446 CA ALA B 211 8.148 −63.671 10.058 1 49.93 B C ATOM 1447 CB ALA B 211 7.033 −63.804 11.092 1 55.41 B C ATOM 1448 C ALA B 211 9.245 −64.705 10.356 1 47.06 B C ATOM 1449 O ALA B 211 10.049 −64.513 11.272 1 46.57 B O ATOM 1450 N VAL B 212 9.255 −65.796 9.605 1 41.81 B N ATOM 1451 CA VAL B 212 10.039 −66.943 9.931 1 46.06 B C ATOM 1452 CB VAL B 212 9.123 −68.176 10.156 1 46.19 B C ATOM 1453 CG1 VAL B 212 9.953 −69.361 10.62 1 50.47 B C ATOM 1454 CG2 VAL B 212 8.09 −67.873 11.236 1 48.47 B C ATOM 1455 C VAL B 212 11.145 −67.221 8.894 1 46.16 B C ATOM 1456 O VAL B 212 12.287 −67.473 9.259 1 46.25 B O ATOM 1457 N ASN B 213 10.808 −67.222 7.623 1 43.22 B N ATOM 1458 CA ASN B 213 11.761 −67.621 6.581 1 47.45 B C ATOM 1459 CB ASN B 213 11.023 −68.281 5.415 1 51.03 B C ATOM 1460 CG ASN B 213 10.238 −69.509 5.862 1 54.07 B C ATOM 1461 OD1 ASN B 213 10.593 −70.151 6.849 1 71.04 B O ATOM 1462 ND2 ASN B 213 9.15 −69.8 5.182 1 59.22 B N ATOM 1463 C ASN B 213 12.493 −66.4 6.108 1 44.58 B C ATOM 1464 O ASN B 213 11.878 −65.372 5.933 1 52.29 B O ATOM 1465 N MET B 214 13.804 −66.515 5.942 1 44.41 B N ATOM 1466 CA MET B 214 14.648 −65.436 5.451 1 47.37 B C ATOM 1467 CB MET B 214 15.526 −64.867 6.569 1 54.35 B C ATOM 1468 CG MET B 214 14.767 −64.394 7.773 1 61.23 B C ATOM 1469 SD MET B 214 13.69 −63.064 7.235 1 71.27 B S ATOM 1470 CE MET B 214 12.336 −63.241 8.402 1 76.54 B C ATOM 1471 C MET B 214 15.559 −66.004 4.409 1 41.8 B C ATOM 1472 O MET B 214 15.947 −67.185 4.505 1 42.11 B O ATOM 1473 N VAL B 215 15.952 −65.16 3.455 1 38.97 B N ATOM 1474 CA VAL B 215 17.019 −65.527 2.509 1 39.26 B C ATOM 1475 CB VAL B 215 16.545 −65.327 1.033 1 37.45 B C ATOM 1476 CG1 VAL B 215 17.626 −65.773 0.049 1 35.85 B C ATOM 1477 CG2 VAL B 215 15.246 −66.088 0.784 1 38.92 B C ATOM 1478 C VAL B 215 18.299 −64.714 2.783 1 39.17 B C ATOM 1479 O VAL B 215 18.308 −63.499 2.56 1 40.63 B O ATOM 1480 N PRO B 216 19.374 −65.329 3.261 1 40.45 B N ATOM 1481 CA PRO B 216 19.405 −66.651 3.881 1 39.85 B C ATOM 1482 CB PRO B 216 20.894 −66.996 3.9 1 39.29 B C ATOM 1483 CG PRO B 216 21.562 −65.661 4.029 1 38.91 B C ATOM 1484 CD PRO B 216 20.696 −64.665 3.305 1 38.69 B C ATOM 1485 C PRO B 216 18.943 −66.55 5.312 1 38.35 B C ATOM 1486 O PRO B 216 18.862 −65.42 5.843 1 35.46 B O ATOM 1487 N PRO B 217 18.659 −67.707 5.936 1 37.06 B N ATOM 1488 CA PRO B 217 18.389 −67.725 7.346 1 41.55 B C ATOM 1489 CB PRO B 217 18.232 −69.217 7.678 1 40.56 B C ATOM 1490 CG PRO B 217 18.018 −69.895 6.383 1 37.84 B C ATOM 1491 CD PRO B 217 18.758 −69.073 5.388 1 39.17 B C ATOM 1492 C PRO B 217 19.576 −67.195 8.101 1 41.29 B C ATOM 1493 O PRO B 217 20.685 −67.537 7.786 1 42.44 B O ATOM 1494 N PRO B 218 19.352 −66.357 9.101 1 42.2 B N ATOM 1495 CA PRO B 218 20.5 −66.017 9.964 1 42.35 B C ATOM 1496 CB PRO B 218 19.912 −65.029 10.934 1 39.93 B C ATOM 1497 CG PRO B 218 18.498 −65.42 11.034 1 43.97 B C ATOM 1498 CD PRO B 218 18.084 −65.897 9.662 1 43.63 B C ATOM 1499 C PRO B 218 21.066 −67.226 10.733 1 38.6 B C ATOM 1500 O PRO B 218 20.371 −68.194 10.957 1 38.82 B O ATOM 1501 N THR B 219 22.315 −67.153 11.155 1 41.75 B N ATOM 1502 CA THR B 219 22.804 −68.159 12.132 1 48.26 B C ATOM 1503 CB THR B 219 24.3 −68.045 12.45 1 47.5 B C ATOM 1504 OG1 THR B 219 24.478 −66.901 13.295 1 53.94 B O ATOM 1505 CG2 THR B 219 25.161 −67.94 11.171 1 49.45 B C ATOM 1506 C THR B 219 22.073 −67.969 13.491 1 44.27 B C ATOM 1507 O THR B 219 21.701 −66.849 13.879 1 40.81 B O ATOM 1508 N CYS B 220 21.874 −69.057 14.204 1 43.12 B N ATOM 1509 CA CYS B 220 21.302 −68.984 15.564 1 49.09 B C ATOM 1510 CB CYS B 220 21.106 −70.392 16.123 1 49.08 B C ATOM 1511 SG CYS B 220 20.04 −71.439 15.065 1 52.72 B S ATOM 1512 C CYS B 220 22.135 −68.088 16.528 1 49.31 B C ATOM 1513 O CYS B 220 21.556 −67.36 17.341 1 46.31 B O ATOM 1514 N LEU B 221 23.464 −68.076 16.382 1 47.69 B N ATOM 1515 CA LEU B 221 24.304 −67.158 17.153 1 51.5 B C ATOM 1516 CB LEU B 221 25.778 −67.328 16.787 1 54.75 B C ATOM 1517 CG LEU B 221 26.424 −68.698 17.048 1 61.07 B C ATOM 1518 CD1 LEU B 221 27.93 −68.535 17.101 1 67.76 B C ATOM 1519 CD2 LEU B 221 25.975 −69.387 18.32 1 62.43 B C ATOM 1520 C LEU B 221 23.922 −65.703 16.896 1 53.46 B C ATOM 1521 O LEU B 221 23.772 −64.88 17.819 1 51.1 B O ATOM 1522 N SER B 222 23.766 −65.399 15.619 1 47.09 B N ATOM 1523 CA SER B 222 23.421 −64.074 15.204 1 49.79 B C ATOM 1524 CB SER B 222 23.438 −64.03 13.687 1 51.28 B C ATOM 1525 OG SER B 222 23.087 −62.738 13.252 1 62.16 B O ATOM 1526 C SER B 222 22.04 −63.682 15.757 1 55.49 B C ATOM 1527 O SER B 222 21.797 −62.517 16.099 1 48.23 B O ATOM 1528 N VAL B 223 21.151 −64.675 15.854 1 51.98 B N ATOM 1529 CA VAL B 223 19.821 −64.478 16.411 1 55.43 B C ATOM 1530 CB VAL B 223 18.917 −65.72 16.133 1 54.4 B C ATOM 1531 CG1 VAL B 223 17.837 −65.912 17.204 1 52.12 B C ATOM 1532 CG2 VAL B 223 18.313 −65.608 14.726 1 54.49 B C ATOM 1533 C VAL B 223 19.863 −64.13 17.909 1 51.19 B C ATOM 1534 O VAL B 223 19.207 −63.179 18.359 1 50.51 B O ATOM 1535 N ILE B 224 20.586 −64.918 18.679 1 50.34 B N ATOM 1536 CA ILE B 224 20.663 −64.651 20.118 1 57.69 B C ATOM 1537 CB ILE B 224 21.334 −65.782 20.905 1 57.66 B C ATOM 1538 CG1 ILE B 224 20.28 −66.826 21.232 1 58.47 B C ATOM 1539 CD1 ILE B 224 20.151 −67.791 20.122 1 62.49 B C ATOM 1540 CG2 ILE B 224 21.931 −65.295 22.222 1 60.62 B C ATOM 1541 C ILE B 224 21.321 −63.305 20.391 1 55.25 B C ATOM 1542 O ILE B 224 20.786 −62.52 21.148 1 52.45 B O ATOM 1543 N ARG B 225 22.43 −63.037 19.727 1 57.04 B N ATOM 1544 CA ARG B 225 23.126 −61.775 19.926 1 61.8 B C ATOM 1545 CB ARG B 225 24.487 −61.757 19.218 1 62.73 B C ATOM 1546 CG ARG B 225 25.489 −62.614 20.002 1 66.98 B C ATOM 1547 CD ARG B 225 26.751 −62.946 19.243 1 69.61 B C ATOM 1548 NE ARG B 225 27.349 −64.187 19.728 1 73.27 B N ATOM 1549 CZ ARG B 225 28.253 −64.909 19.061 1 76.17 B C ATOM 1550 NH1 ARG B 225 28.733 −66.015 19.606 1 75.26 B N ATOM 1551 NH2 ARG B 225 28.682 −64.545 17.854 1 79.05 B N ATOM 1552 C ARG B 225 22.275 −60.593 19.578 1 58.51 B C ATOM 1553 O ARG B 225 22.108 −59.697 20.406 1 62.26 B O ATOM 1554 N SER B 226 21.676 −60.616 18.397 1 60.94 B N ATOM 1555 CA SER B 226 20.847 −59.488 17.941 1 57.22 B C ATOM 1556 CB SER B 226 20.294 −59.778 16.534 1 57.35 B C ATOM 1557 OG SER B 226 19.201 −58.933 16.231 1 63.61 B O ATOM 1558 C SER B 226 19.731 −59.193 18.971 1 55.74 B C ATOM 1559 O SER B 226 19.383 −58.041 19.226 1 56.31 B O ATOM 1560 N CYS B 227 19.217 −60.25 19.587 1 50.68 B N ATOM 1561 CA CYS B 227 18.222 −60.127 20.634 1 57.7 B C ATOM 1562 CB CYS B 227 17.735 −61.513 21.054 1 55 B C ATOM 1563 SG CYS B 227 16.422 −61.442 22.266 1 59.65 B S ATOM 1564 C CYS B 227 18.763 −59.421 21.872 1 60.4 B C ATOM 1565 O CYS B 227 18.096 −58.535 22.419 1 59.19 B O ATOM 1566 N GLN B 228 19.96 −59.834 22.303 1 59.75 B N ATOM 1567 CA GLN B 228 20.642 −59.216 23.466 1 63.98 B C ATOM 1568 CB GLN B 228 22.051 −59.764 23.75 1 65.86 B C ATOM 1569 CG GLN B 228 22.346 −61.271 23.698 1 71.33 B C ATOM 1570 CD GLN B 228 21.696 −62.106 24.79 1 72.08 B C ATOM 1571 OE1 GLN B 228 20.603 −61.783 25.265 1 75.94 B O ATOM 1572 NE2 GLN B 228 22.363 −63.217 25.177 1 68.73 B N ATOM 1573 C GLN B 228 20.788 −57.699 23.296 1 65.31 B C ATOM 1574 O GLN B 228 20.733 −56.984 24.288 1 63.24 B O ATOM 1575 N ASN B 229 20.96 −57.217 22.057 1 64.32 B N ATOM 1576 CA ASN B 229 21.12 −55.763 21.785 1 66.24 B C ATOM 1577 CB ASN B 229 21.998 −55.507 20.547 1 66.43 B C ATOM 1578 CG ASN B 229 23.294 −56.284 20.574 1 72.5 B C ATOM 1579 OD1 ASN B 229 23.814 −56.62 21.643 1 78.79 B O ATOM 1580 ND2 ASN B 229 23.82 −56.59 19.39 1 76.78 B N ATOM 1581 C ASN B 229 19.832 −54.981 21.595 1 60.27 B C ATOM 1582 O ASN B 229 19.895 −53.845 21.181 1 61.72 B O ATOM 1583 N ASP B 230 18.678 −55.58 21.851 1 64.23 B N ATOM 1584 CA ASP B 230 17.404 −54.854 21.818 1 69.88 B C ATOM 1585 CB ASP B 230 16.466 −55.5 20.789 1 70.79 B C ATOM 1586 CG ASP B 230 15.059 −54.94 20.855 1 69.9 B C ATOM 1587 OD1 ASP B 230 14.886 −53.817 20.378 1 75.3 B O ATOM 1588 OD2 ASP B 230 14.131 −55.598 21.395 1 68.56 B O ATOM 1589 C ASP B 230 16.794 −54.926 23.215 1 73.46 B C ATOM 1590 O ASP B 230 16.878 −55.983 23.856 1 72.37 B O ATOM 1591 N GLU B 231 16.172 −53.826 23.672 1 77.53 B N ATOM 1592 CA GLU B 231 15.547 −53.759 25.023 1 78.12 B C ATOM 1593 CB GLU B 231 14.932 −52.38 25.282 1 82.98 B C ATOM 1594 CG GLU B 231 15.89 −51.354 25.879 1 98.09 B C ATOM 1595 CD GLU B 231 15.236 −50.505 26.963 1 101.71 B C ATOM 1596 OE1 GLU B 231 14.782 −51.09 27.967 1 96.89 B O ATOM 1597 OE2 GLU B 231 15.179 −49.261 26.817 1 101.61 B O ATOM 1598 C GLU B 231 14.465 −54.831 25.304 1 74.28 B C ATOM 1599 O GLU B 231 14.634 −55.702 26.184 1 63.5 B O ATOM 1600 N LEU B 232 13.371 −54.755 24.549 1 63.39 B N ATOM 1601 CA LEU B 232 12.25 −55.673 24.695 1 61.1 B C ATOM 1602 CB LEU B 232 11.137 −55.247 23.727 1 65.21 B C ATOM 1603 CG LEU B 232 9.772 −55.957 23.686 1 71.8 B C ATOM 1604 CD1 LEU B 232 8.72 −54.963 23.21 1 72.13 B C ATOM 1605 CD2 LEU B 232 9.758 −57.201 22.785 1 71.7 B C ATOM 1606 C LEU B 232 12.673 −57.145 24.473 1 59.97 B C ATOM 1607 O LEU B 232 12.348 −58.022 25.288 1 63.34 B O ATOM 1608 N CYS B 233 13.414 −57.418 23.398 1 56.46 B N ATOM 1609 CA CYS B 233 13.854 −58.79 23.132 1 56.16 B C ATOM 1610 CB CYS B 233 14.601 −58.933 21.793 1 52.64 B C ATOM 1611 SG CYS B 233 14.738 −60.677 21.271 1 55.85 B S ATOM 1612 C CYS B 233 14.697 −59.373 24.294 1 58.07 B C ATOM 1613 O CYS B 233 14.414 −60.498 24.75 1 52.08 B O ATOM 1614 N ARG B 234 15.705 −58.618 24.76 1 58.38 B N ATOM 1615 CA ARG B 234 16.612 −59.075 25.847 1 59.04 B C ATOM 1616 CB ARG B 234 17.627 −57.989 26.223 1 63.8 B C ATOM 1617 CG ARG B 234 18.612 −58.327 27.364 1 69.14 B C ATOM 1618 CD ARG B 234 19.167 −57.049 27.998 1 72.12 B C ATOM 1619 NE ARG B 234 19.563 −56.118 26.928 1 79.05 B N ATOM 1620 CZ ARG B 234 19.202 −54.837 26.781 1 75.36 B C ATOM 1621 NH1 ARG B 234 19.661 −54.16 25.727 1 73.44 B N ATOM 1622 NH2 ARG B 234 18.423 −54.206 27.663 1 76.39 B N ATOM 1623 C ARG B 234 15.806 −59.484 27.071 1 60.41 B C ATOM 1624 O ARG B 234 15.963 −60.61 27.582 1 57.03 B O ATOM 1625 N ARG B 235 14.9 −58.612 27.505 1 57.02 B N ATOM 1626 CA ARG B 235 14.072 −58.951 28.659 1 66.3 B C ATOM 1627 CB ARG B 235 13.117 −57.813 29.008 1 79.61 B C ATOM 1628 CG ARG B 235 13.789 −56.674 29.763 1 89.89 B C ATOM 1629 CD ARG B 235 13.247 −55.328 29.318 1 94.35 B C ATOM 1630 NE ARG B 235 13.547 −54.263 30.267 1 102.33 B N ATOM 1631 CZ ARG B 235 13.286 −52.969 30.069 1 103.92 B C ATOM 1632 NH1 ARG B 235 12.727 −52.54 28.929 1 97.07 B N ATOM 1633 NH2 ARG B 235 13.594 −52.088 31.022 1 97.99 B N ATOM 1634 C ARG B 235 13.284 −60.221 28.416 1 61.7 B C ATOM 1635 O ARG B 235 13.244 −61.102 29.271 1 57.45 B O ATOM 1636 N HIS B 236 12.674 −60.325 27.235 1 57.83 B N ATOM 1637 CA HIS B 236 11.803 −61.466 26.965 1 52.2 B C ATOM 1638 CB HIS B 236 10.859 −61.186 25.776 1 57.98 B C ATOM 1639 CG HIS B 236 9.747 −60.261 26.139 1 63.41 B C ATOM 1640 ND1 HIS B 236 9.722 −58.938 25.761 1 71.46 B N ATOM 1641 CE1 HIS B 236 8.648 −58.357 26.265 1 69.43 B C ATOM 1642 NE2 HIS B 236 8 −59.246 26.994 1 76.52 B N ATOM 1643 CD2 HIS B 236 8.676 −60.441 26.943 1 73.54 B C ATOM 1644 C HIS B 236 12.594 −62.747 26.817 1 43.46 B C ATOM 1645 O HIS B 236 12.14 −63.785 27.237 1 39.42 B O ATOM 1646 N TYR B 237 13.791 −62.666 26.24 1 44.69 B N ATOM 1647 CA TYR B 237 14.661 −63.827 26.188 1 48.16 B C ATOM 1648 CB TYR B 237 15.941 −63.544 25.389 1 43.81 B C ATOM 1649 CG TYR B 237 16.795 −64.789 25.305 1 50.24 B C ATOM 1650 CD1 TYR B 237 16.295 −65.953 24.695 1 48.61 B C ATOM 1651 CE1 TYR B 237 17.06 −67.116 24.635 1 51.92 B C ATOM 1652 CZ TYR B 237 18.34 −67.14 25.21 1 53.26 B C ATOM 1653 OH TYR B 237 19.075 −68.316 25.154 1 60.59 B O ATOM 1654 CE2 TYR B 237 18.846 −66.011 25.841 1 50.02 B C ATOM 1655 CD2 TYR B 237 18.084 −64.84 25.887 1 50.95 B C ATOM 1656 C TYR B 237 14.993 −64.3 27.623 1 50.61 B C ATOM 1657 O TYR B 237 14.859 −65.503 27.948 1 45.82 B O ATOM 1658 N ARG B 238 15.373 −63.34 28.476 1 52.59 B N ATOM 1659 CA ARG B 238 15.795 −63.625 29.866 1 52.11 B C ATOM 1660 CB ARG B 238 16.094 −62.309 30.606 1 57.58 B C ATOM 1661 CG ARG B 238 16.975 −62.4 31.867 1 70.39 B C ATOM 1662 CD ARG B 238 18.068 −61.316 31.891 1 76.46 B C ATOM 1663 NE ARG B 238 17.553 −59.937 31.755 1 84.04 B N ATOM 1664 CZ ARG B 238 18.248 −58.876 31.302 1 92.92 B C ATOM 1665 NH1 ARG B 238 17.66 −57.673 31.238 1 89.77 B N ATOM 1666 NH2 ARG B 238 19.522 −58.989 30.898 1 92.96 B N ATOM 1667 C ARG B 238 14.697 −64.428 30.55 1 50.23 B C ATOM 1668 O ARG B 238 14.95 −65.515 31.085 1 50.31 B O ATOM 1669 N THR B 239 13.462 −63.924 30.48 1 45.71 B N ATOM 1670 CA THR B 239 12.336 −64.608 31.089 1 44.91 B C ATOM 1671 CB THR B 239 11.055 −63.823 30.876 1 48.93 B C ATOM 1672 OG1 THR B 239 11.294 −62.457 31.197 1 54.27 B O ATOM 1673 CG2 THR B 239 9.904 −64.371 31.712 1 47.59 B C ATOM 1674 C THR B 239 12.138 −65.986 30.498 1 54.66 B C ATOM 1675 O THR B 239 11.867 −66.967 31.233 1 56.96 B O ATOM 1676 N PHE B 240 12.242 −66.046 29.165 1 48.48 B N ATOM 1677 CA PHE B 240 12.064 −67.27 28.451 1 47.12 B C ATOM 1678 CB PHE B 240 12.255 −67.039 26.945 1 47.04 B C ATOM 1679 CG PHE B 240 12.375 −68.308 26.141 1 44.93 B C ATOM 1680 CD1 PHE B 240 11.29 −69.162 26.013 1 43.59 B C ATOM 1681 CE1 PHE B 240 11.376 −70.317 25.235 1 46.67 B C ATOM 1682 CZ PHE B 240 12.555 −70.63 24.592 1 47.72 B C ATOM 1683 CE2 PHE B 240 13.649 −69.78 24.717 1 46.71 B C ATOM 1684 CD2 PHE B 240 13.559 −68.634 25.493 1 44.77 B C ATOM 1685 C PHE B 240 13.02 −68.333 28.935 1 46.87 B C ATOM 1686 O PHE B 240 12.609 −69.47 29.203 1 47.31 B O ATOM 1687 N GLN B 241 14.296 −67.959 28.957 1 49.9 B N ATOM 1688 CA GLN B 241 15.378 −68.788 29.52 1 56.37 B C ATOM 1689 CB GLN B 241 16.703 −68.026 29.52 1 58.66 B C ATOM 1690 CG GLN B 241 17.413 −68.01 28.183 1 70.29 B C ATOM 1691 CD GLN B 241 17.812 −69.391 27.723 1 80.28 B C ATOM 1692 OE1 GLN B 241 17.539 −69.808 26.565 1 79.86 B O ATOM 1693 NE2 GLN B 241 18.451 −70.126 28.624 1 82.86 B N ATOM 1694 C GLN B 241 15.107 −69.272 30.937 1 52.32 B C ATOM 1695 O GLN B 241 15.297 −70.445 31.234 1 50.25 B O ATOM 1696 N SER B 242 14.686 −68.358 31.799 1 55.28 B N ATOM 1697 CA SER B 242 14.368 −68.708 33.173 1 65.14 B C ATOM 1698 CB SER B 242 13.923 −67.476 33.962 1 65.22 B C ATOM 1699 OG SER B 242 14.894 −66.471 33.845 1 65.15 B O ATOM 1700 C SER B 242 13.295 −69.799 33.256 1 69.35 B C ATOM 1701 O SER B 242 13.487 −70.799 33.947 1 77.41 B O ATOM 1702 N LYS B 243 12.194 −69.634 32.527 1 64.41 B N ATOM 1703 CA LYS B 243 11.041 −70.506 32.725 1 59.29 B C ATOM 1704 CB LYS B 243 9.74 −69.744 32.433 1 66.22 B C ATOM 1705 CG LYS B 243 9.51 −68.509 33.308 1 73.5 B C ATOM 1706 CD LYS B 243 9.562 −68.863 34.808 1 78.23 B C ATOM 1707 CE LYS B 243 9.345 −67.666 35.722 1 86.66 B C ATOM 1708 NZ LYS B 243 8.068 −67.796 36.483 1 96.67 B N ATOM 1709 C LYS B 243 11.114 −71.799 31.946 1 56.26 B C ATOM 1710 O LYS B 243 10.514 −72.787 32.332 1 62.26 B O ATOM 1711 N CYS B 244 11.844 −71.806 30.847 1 55.61 B N ATOM 1712 CA CYS B 244 11.888 −72.974 29.975 1 56.53 B C ATOM 1713 CB CYS B 244 11.679 −72.529 28.494 1 59.59 B C ATOM 1714 SG CYS B 244 10.05 −71.723 28.183 1 59.79 B S ATOM 1715 C CYS B 244 13.183 −73.757 30.195 1 53.86 B C ATOM 1716 O CYS B 244 13.188 −74.98 30.138 1 56.54 B O ATOM 1717 N TRP B 245 14.281 −73.042 30.441 1 54.71 B N ATOM 1718 CA TRP B 245 15.603 −73.621 30.514 1 55.17 B C ATOM 1719 CB TRP B 245 16.394 −73.139 29.301 1 54.2 B C ATOM 1720 CG TRP B 245 15.687 −73.481 28.011 1 52.88 B C ATOM 1721 CD1 TRP B 245 14.96 −72.621 27.223 1 53.79 B C ATOM 1722 NE1 TRP B 245 14.446 −73.292 26.136 1 52.15 B N ATOM 1723 CE2 TRP B 245 14.826 −74.607 26.194 1 50.77 B C ATOM 1724 CD2 TRP B 245 15.61 −74.772 27.366 1 51.74 B C ATOM 1725 CE3 TRP B 245 16.121 −76.051 27.666 1 52.06 B C ATOM 1726 CZ3 TRP B 245 15.842 −77.114 26.79 1 50.59 B C ATOM 1727 CH2 TRP B 245 15.051 −76.917 25.647 1 53.71 B C ATOM 1728 CZ2 TRP B 245 14.524 −75.671 25.338 1 51.5 B C ATOM 1729 C TRP B 245 16.235 −73.242 31.881 1 57.41 B C ATOM 1730 O TRP B 245 17.279 −72.583 31.951 1 60.76 B O ATOM 1731 N GLN B 246 15.547 −73.651 32.96 1 61.29 B N ATOM 1732 CA GLN B 246 15.959 −73.382 34.354 1 64.61 B C ATOM 1733 CB GLN B 246 15.007 −74.083 35.34 1 73.7 B C ATOM 1734 CG GLN B 246 15.251 −73.768 36.824 1 87.61 B C ATOM 1735 CD GLN B 246 15.382 −75.022 37.712 1 99.98 B C ATOM 1736 OE1 GLN B 246 16.305 −75.844 37.543 1 96.3 B O ATOM 1737 NE2 GLN B 246 14.468 −75.163 38.679 1 101.16 B N ATOM 1738 C GLN B 246 17.408 −73.829 34.617 1 56.51 B C ATOM 1739 O GLN B 246 18.2 −73.047 35.145 1 57.89 B O ATOM 1740 N ARG B 247 17.748 −75.057 34.207 1 50.96 B N ATOM 1741 CA ARG B 247 19.061 −75.622 34.458 1 53.72 B C ATOM 1742 CB ARG B 247 19.175 −77.065 34.011 1 61.5 B C ATOM 1743 CG ARG B 247 18.144 −78.036 34.586 1 72.17 B C ATOM 1744 CD ARG B 247 18.741 −79.447 34.651 1 82.68 B C ATOM 1745 NE ARG B 247 17.838 −80.547 34.304 1 85.52 B N ATOM 1746 CZ ARG B 247 16.83 −80.995 35.059 1 92.61 B C ATOM 1747 NH1 ARG B 247 16.511 −80.401 36.216 1 91.54 B N ATOM 1748 NH2 ARG B 247 16.108 −82.037 34.634 1 88.8 B N ATOM 1749 C ARG B 247 20.126 −74.852 33.739 1 57.77 B C ATOM 1750 O ARG B 247 21.212 −74.678 34.26 1 58.43 B O ATOM 1751 N VAL B 248 19.819 −74.4 32.526 1 57.32 B N ATOM 1752 CA VAL B 248 20.779 −73.626 31.736 1 55.31 B C ATOM 1753 CB VAL B 248 20.286 −73.388 30.276 1 55.38 B C ATOM 1754 CG1 VAL B 248 21.155 −72.369 29.537 1 52.27 B C ATOM 1755 CG2 VAL B 248 20.237 −74.698 29.507 1 55.65 B C ATOM 1756 C VAL B 248 21.006 −72.292 32.409 1 51.1 B C ATOM 1757 O VAL B 248 22.143 −71.813 32.502 1 49.02 B O ATOM 1758 N THR B 249 19.923 −71.669 32.843 1 48.56 B N ATOM 1759 CA THR B 249 20.045 −70.334 33.44 1 54.69 B C ATOM 1760 CB THR B 249 18.664 −69.713 33.67 1 52.47 B C ATOM 1761 OG1 THR B 249 18.017 −69.582 32.397 1 56.62 B O ATOM 1762 CG2 THR B 249 18.779 −68.352 34.334 1 55.42 B C ATOM 1763 C THR B 249 20.832 −70.395 34.767 1 61.51 B C ATOM 1764 O THR B 249 21.72 −69.568 34.994 1 63.58 B O ATOM 1765 N ARG B 250 20.519 −71.382 35.613 1 61.06 B N ATOM 1766 CA ARG B 250 21.153 −71.466 36.916 1 64.92 B C ATOM 1767 CB ARG B 250 20.343 −72.35 37.872 1 69.17 B C ATOM 1768 CG ARG B 250 20.491 −73.879 37.81 1 75.94 B C ATOM 1769 CD ARG B 250 19.602 −74.516 38.902 1 85.03 B C ATOM 1770 NE ARG B 250 18.44 −73.638 39.171 1 90.33 B N ATOM 1771 CZ ARG B 250 17.775 −73.5 40.321 1 86.23 B C ATOM 1772 NH1 ARG B 250 18.041 −74.247 41.389 1 83.37 B N ATOM 1773 NH2 ARG B 250 16.784 −72.605 40.379 1 85.47 B N ATOM 1774 C ARG B 250 22.633 −71.859 36.799 1 63.15 B C ATOM 1775 O ARG B 250 23.457 −71.359 37.548 1 58.93 B O ATOM 1776 N LYS B 251 22.97 −72.693 35.817 1 64.02 B N ATOM 1777 CA LYS B 251 24.343 −73.147 35.637 1 58.66 B C ATOM 1778 CB LYS B 251 24.391 −74.411 34.797 1 65.94 B C ATOM 1779 CG LYS B 251 25.216 −75.515 35.403 1 79.06 B C ATOM 1780 CD LYS B 251 24.376 −76.332 36.386 1 82.06 B C ATOM 1781 CE LYS B 251 23.651 −77.463 35.676 1 86 B C ATOM 1782 NZ LYS B 251 24.621 −78.449 35.127 1 84.52 B N ATOM 1783 C LYS B 251 25.187 −72.068 34.963 1 58.16 B C ATOM 1784 O LYS B 251 26.35 −71.885 35.308 1 52.69 B O ATOM 1785 N CYS B 252 24.618 −71.351 33.988 1 61.02 B N ATOM 1786 CA CYS B 252 25.448 −70.532 33.101 1 59.85 B C ATOM 1787 CB CYS B 252 25.4 −71.051 31.67 1 59.08 B C ATOM 1788 SG CYS B 252 26.086 −72.703 31.512 1 65.84 B S ATOM 1789 C CYS B 252 25.167 −69.073 33.086 1 56.69 B C ATOM 1790 O CYS B 252 26.07 −68.335 32.766 1 57.83 B O ATOM 1791 N HIS B 253 23.952 −68.665 33.446 1 62.28 B N ATOM 1792 CA HIS B 253 23.429 −67.329 33.121 1 69.15 B C ATOM 1793 CB HIS B 253 24.04 −66.277 34.053 1 70.3 B C ATOM 1794 CG HIS B 253 23.658 −66.509 35.482 1 83.02 B C ATOM 1795 ND1 HIS B 253 22.354 −66.386 35.927 1 87.63 B N ATOM 1796 CE1 HIS B 253 22.299 −66.707 37.206 1 85.12 B C ATOM 1797 NE2 HIS B 253 23.509 −67.068 37.597 1 80.07 B N ATOM 1798 CD2 HIS B 253 24.375 −66.965 36.537 1 77.72 B C ATOM 1799 C HIS B 253 23.501 −67.031 31.603 1 71.88 B C ATOM 1800 O HIS B 253 22.916 −67.79 30.817 1 66.3 B O ATOM 1801 N GLU B 254 24.207 −65.985 31.185 1 77.82 B N ATOM 1802 CA GLU B 254 24.321 −65.654 29.764 1 79 B C ATOM 1803 CB GLU B 254 23.894 −64.189 29.569 1 85.87 B C ATOM 1804 CG GLU B 254 22.391 −63.98 29.826 1 92.05 B C ATOM 1805 CD GLU B 254 21.966 −62.524 30.038 1 102.75 B C ATOM 1806 OE1 GLU B 254 22.759 −61.716 30.569 1 101.46 B O ATOM 1807 OE2 GLU B 254 20.808 −62.184 29.7 1 102.92 B O ATOM 1808 C GLU B 254 25.734 −65.96 29.217 1 78.28 B C ATOM 1809 O GLU B 254 26.071 −65.593 28.1 1 80.04 B O ATOM 1810 N ASP B 255 26.541 −66.689 29.989 1 79.32 B N ATOM 1811 CA ASP B 255 27.914 −67.011 29.604 1 77.89 B C ATOM 1812 CB ASP B 255 28.718 −67.492 30.817 1 80.03 B C ATOM 1813 CG ASP B 255 30.196 −67.675 30.514 1 78.48 B C ATOM 1814 OD1 ASP B 255 30.56 −68.574 29.724 1 70.82 B O ATOM 1815 OD2 ASP B 255 31.004 −66.93 31.092 1 86.82 B O ATOM 1816 C ASP B 255 27.917 −68.073 28.501 1 71.22 B C ATOM 1817 O ASP B 255 27.624 −69.284 28.743 1 58.47 B O ATOM 1818 N GLU B 256 28.286 −67.61 27.307 1 64.05 B N ATOM 1819 CA GLU B 256 28.216 −68.428 26.093 1 63.27 B C ATOM 1820 CB GLU B 256 28.523 −67.588 24.849 1 66.56 B C ATOM 1821 CG GLU B 256 27.55 −66.427 24.619 1 66.96 B C ATOM 1822 CD GLU B 256 27.536 −65.894 23.181 1 72.02 B C ATOM 1823 OE1 GLU B 256 26.817 −64.901 22.892 1 69.46 B O ATOM 1824 OE2 GLU B 256 28.229 −66.468 22.323 1 66.55 B O ATOM 1825 C GLU B 256 29.127 −69.649 26.187 1 61.08 B C ATOM 1826 O GLU B 256 28.695 −70.767 25.874 1 54.96 B O ATOM 1827 N ASN B 257 30.337 −69.441 26.715 1 60.82 B N ATOM 1828 CA ASN B 257 31.34 −70.526 26.936 1 67.28 B C ATOM 1829 CB ASN B 257 32.646 −69.949 27.501 1 74.03 B C ATOM 1830 CG ASN B 257 32.968 −68.566 26.94 1 83.48 B C ATOM 1831 OD1 ASN B 257 32.145 −67.637 27.037 1 84.17 B O ATOM 1832 ND2 ASN B 257 34.146 −68.419 26.349 1 85.42 B N ATOM 1833 C ASN B 257 30.844 −71.617 27.877 1 63.6 B C ATOM 1834 O ASN B 257 30.998 −72.837 27.632 1 59.11 B O ATOM 1835 N CYS B 258 30.235 −71.161 28.966 1 62.33 B N ATOM 1836 CA CYS B 258 29.546 −72.054 29.863 1 61.37 B C ATOM 1837 CB CYS B 258 28.931 −71.33 31.073 1 63.61 B C ATOM 1838 SG CYS B 258 28.067 −72.514 32.15 1 67.39 B S ATOM 1839 C CYS B 258 28.469 −72.756 29.073 1 59.91 B C ATOM 1840 O CYS B 258 28.398 −73.98 29.125 1 64.46 B O ATOM 1841 N ILE B 259 27.627 −72 28.346 1 59.37 B N ATOM 1842 CA ILE B 259 26.481 −72.636 27.633 1 59.51 B C ATOM 1843 CB ILE B 259 25.542 −71.616 26.926 1 63.22 B C ATOM 1844 CG1 ILE B 259 24.783 −70.796 27.958 1 57.51 B C ATOM 1845 CD1 ILE B 259 24.292 −69.491 27.392 1 57.91 B C ATOM 1846 CG2 ILE B 259 24.504 −72.317 26.027 1 58.36 B C ATOM 1847 C ILE B 259 26.999 −73.665 26.642 1 52.47 B C ATOM 1848 O ILE B 259 26.458 −74.758 26.515 1 50.11 B O ATOM 1849 N SER B 260 28.083 −73.294 25.986 1 56.13 B N ATOM 1850 CA SER B 260 28.778 −74.135 25.005 1 60.21 B C ATOM 1851 CB SER B 260 30.068 −73.442 24.564 1 65.3 B C ATOM 1852 OG SER B 260 31.171 −74.322 24.625 1 74.91 B O ATOM 1853 C SER B 260 29.128 −75.537 25.428 1 61.1 B C ATOM 1854 O SER B 260 29.314 −76.38 24.571 1 63.41 B O ATOM 1855 N THR B 261 29.294 −75.779 26.726 1 71.34 B N ATOM 1856 CA THR B 261 29.716 −77.103 27.223 1 70.79 B C ATOM 1857 CB THR B 261 31 −76.973 28.069 1 67.73 B C ATOM 1858 OG1 THR B 261 30.73 −76.145 29.207 1 56.84 B O ATOM 1859 CG2 THR B 261 32.147 −76.384 27.229 1 66.27 B C ATOM 1860 C THR B 261 28.667 −77.802 28.071 1 71.66 B C ATOM 1861 O THR B 261 28.992 −78.731 28.805 1 73.46 B O ATOM 1862 N LEU B 262 27.412 −77.384 27.961 1 71.62 B N ATOM 1863 CA LEU B 262 26.361 −77.962 28.781 1 71.15 B C ATOM 1864 CB LEU B 262 25.095 −77.117 28.702 1 71.6 B C ATOM 1865 CG LEU B 262 25.131 −75.853 29.557 1 73.22 B C ATOM 1866 CD1 LEU B 262 23.891 −75.052 29.227 1 74.93 B C ATOM 1867 CD2 LEU B 262 25.197 −76.16 31.054 1 74.32 B C ATOM 1868 C LEU B 262 26.058 −79.391 28.369 1 78.93 B C ATOM 1869 O LEU B 262 26.269 −79.754 27.208 1 75.4 B O ATOM 1870 N SER B 263 25.557 −80.181 29.329 1 82.51 B N ATOM 1871 CA SER B 263 25.221 −81.602 29.114 1 86.95 B C ATOM 1872 CB SER B 263 25.238 −82.391 30.446 1 86.43 B C ATOM 1873 OG SER B 263 23.973 −82.392 31.116 1 84.17 B O ATOM 1874 C SER B 263 23.865 −81.765 28.417 1 87.28 B C ATOM 1875 O SER B 263 23.132 −80.804 28.246 1 78.91 B O ATOM 1876 N LYS B 264 23.534 −82.995 28.041 1 87.4 B N ATOM 1877 CA LYS B 264 22.251 −83.281 27.41 1 91.84 B C ATOM 1878 CB LYS B 264 22.236 −84.697 26.82 1 98.53 B C ATOM 1879 CG LYS B 264 21.344 −84.849 25.6 1 107.35 B C ATOM 1880 CD LYS B 264 22.037 −84.35 24.334 1 108.82 B C ATOM 1881 CE LYS B 264 21.174 −84.597 23.102 1 113.01 B C ATOM 1882 NZ LYS B 264 21.958 −84.575 21.835 1 111.46 B N ATOM 1883 C LYS B 264 21.103 −83.121 28.413 1 92.53 B C ATOM 1884 O LYS B 264 19.987 −82.773 28.025 1 97.03 B O ATOM 1885 N GLN B 265 21.372 −83.373 29.695 1 87.5 B N ATOM 1886 CA GLN B 265 20.319 −83.328 30.716 1 91.93 B C ATOM 1887 CB GLN B 265 20.567 −84.372 31.811 1 103.9 B C ATOM 1888 CG GLN B 265 20.047 −85.769 31.461 1 111.32 B C ATOM 1889 CD GLN B 265 20.77 −86.413 30.274 1 115.42 B C ATOM 1890 OE1 GLN B 265 21.914 −86.87 30.403 1 107.03 B O ATOM 1891 NE2 GLN B 265 20.1 −86.46 29.112 1 116.77 B N ATOM 1892 C GLN B 265 20.162 −81.929 31.298 1 89.22 B C ATOM 1893 O GLN B 265 19.119 −81.605 31.884 1 85.25 B O ATOM 1894 N ASP B 266 21.2 −81.108 31.142 1 86.51 B N ATOM 1895 CA ASP B 266 21.077 −79.654 31.324 1 86.54 B C ATOM 1896 CB ASP B 266 22.446 −78.958 31.213 1 88.39 B C ATOM 1897 CG ASP B 266 23.438 −79.41 32.294 1 91.97 B C ATOM 1898 OD1 ASP B 266 23.021 −79.658 33.458 1 87.29 B O ATOM 1899 OD2 ASP B 266 24.646 −79.508 31.972 1 85.33 B O ATOM 1900 C ASP B 266 20.098 −79.046 30.304 1 81.55 B C ATOM 1901 O ASP B 266 19.343 −78.13 30.649 1 75.33 B O ATOM 1902 N LEU B 267 20.124 −79.564 29.067 1 75.82 B N ATOM 1903 CA LEU B 267 19.202 −79.16 27.992 1 79.45 B C ATOM 1904 CB LEU B 267 19.846 −79.346 26.62 1 77.92 B C ATOM 1905 CG LEU B 267 21.151 −78.609 26.322 1 80.4 B C ATOM 1906 CD1 LEU B 267 21.433 −78.726 24.822 1 80.52 B C ATOM 1907 CD2 LEU B 267 21.137 −77.151 26.771 1 77.32 B C ATOM 1908 C LEU B 267 17.908 −79.951 28.027 1 74.86 B C ATOM 1909 O LEU B 267 17.657 −80.773 27.17 1 80.78 B O ATOM 1910 N THR B 268 17.098 −79.669 29.035 1 74.15 B N ATOM 1911 CA THR B 268 15.797 −80.288 29.243 1 73.89 B C ATOM 1912 CB THR B 268 15.883 −81.355 30.361 1 80.45 B C ATOM 1913 OG1 THR B 268 16.199 −82.619 29.764 1 84.66 B O ATOM 1914 CG2 THR B 268 14.579 −81.49 31.179 1 85.35 B C ATOM 1915 C THR B 268 14.892 −79.124 29.595 1 73.15 B C ATOM 1916 O THR B 268 15.291 −78.238 30.366 1 70.7 B O ATOM 1917 N CYS B 269 13.701 −79.107 29.005 1 74.77 B N ATOM 1918 CA CYS B 269 12.799 −77.959 29.106 1 69.68 B C ATOM 1919 CB CYS B 269 12.028 −77.717 27.796 1 64 B C ATOM 1920 SG CYS B 269 11.038 −76.182 27.837 1 70.38 B S ATOM 1921 C CYS B 269 11.785 −78.211 30.196 1 63.51 B C ATOM 1922 O CYS B 269 11.292 −79.327 30.313 1 56.37 B O ATOM 1923 N SER B 270 11.446 −77.165 30.949 1 55.48 B N ATOM 1924 CA SER B 270 10.246 −77.19 31.781 1 65.92 B C ATOM 1925 CB SER B 270 10.205 −75.966 32.715 1 66.81 B C ATOM 1926 OG SER B 270 8.994 −75.232 32.577 1 72.63 B O ATOM 1927 C SER B 270 8.993 −77.237 30.892 1 78.26 B C ATOM 1928 O SER B 270 8.793 −76.366 30.035 1 92.88 B O ATOM 1929 N GLY B 271 8.117 −78.211 31.116 1 83.93 B N ATOM 1930 CA GLY B 271 6.841 −78.252 30.387 1 80.99 B C ATOM 1931 C GLY B 271 5.795 −77.252 30.867 1 78 B C ATOM 1932 O GLY B 271 4.633 −77.365 30.492 1 79.34 B O ATOM 1933 N SER B 272 6.189 −76.243 31.649 1 78.71 B N ATOM 1934 CA SER B 272 5.237 −75.512 32.488 1 72.94 B C ATOM 1935 CB SER B 272 5.956 −74.897 33.677 1 69.32 B C ATOM 1936 OG SER B 272 6.457 −73.632 33.335 1 66.77 B O ATOM 1937 C SER B 272 4.488 −74.419 31.73 1 75.15 B C ATOM 1938 O SER B 272 4.789 −74.119 30.576 1 72.98 B O ATOM 1939 N ASP B 273 3.509 −73.837 32.409 1 76.08 B N ATOM 1940 CA ASP B 273 2.65 −72.804 31.847 1 78.69 B C ATOM 1941 CB ASP B 273 1.37 −72.664 32.675 1 82.12 B C ATOM 1942 CG ASP B 273 0.475 −73.856 32.54 1 87.81 B C ATOM 1943 OD1 ASP B 273 −0.169 −73.979 31.476 1 96.56 B O ATOM 1944 OD2 ASP B 273 0.428 −74.671 33.486 1 90.35 B O ATOM 1945 C ASP B 273 3.337 −71.469 31.808 1 74.03 B C ATOM 1946 O ASP B 273 3.012 −70.633 30.971 1 73.33 B O ATOM 1947 N ASP B 274 4.244 −71.243 32.748 1 72.88 B N ATOM 1948 CA ASP B 274 5.054 −70.033 32.728 1 70.28 B C ATOM 1949 CB ASP B 274 5.845 −69.898 34.027 1 72.68 B C ATOM 1950 CG ASP B 274 4.986 −69.494 35.199 1 75.17 B C ATOM 1951 OD1 ASP B 274 3.746 −69.642 35.143 1 75.62 B O ATOM 1952 OD2 ASP B 274 5.575 −69.032 36.2 1 82.45 B O ATOM 1953 C ASP B 274 6.008 −70.057 31.53 1 62.69 B C ATOM 1954 O ASP B 274 6.292 −69.012 30.945 1 54.56 B O ATOM 1955 N CYS B 275 6.528 −71.249 31.212 1 55.4 B N ATOM 1956 CA CYS B 275 7.294 −71.479 29.992 1 61.46 B C ATOM 1957 CB CYS B 275 7.834 −72.912 29.946 1 58.81 B C ATOM 1958 SG CYS B 275 8.77 −73.324 28.451 1 65.73 B S ATOM 1959 C CYS B 275 6.465 −71.202 28.714 1 61.34 B C ATOM 1960 O CYS B 275 6.953 −70.525 27.796 1 63.2 B O ATOM 1961 N LYS B 276 5.237 −71.72 28.67 1 55.59 B N ATOM 1962 CA LYS B 276 4.328 −71.501 27.536 1 60.46 B C ATOM 1963 CB LYS B 276 2.953 −72.129 27.769 1 63.33 B C ATOM 1964 CG LYS B 276 2.929 −73.639 27.622 1 72.11 B C ATOM 1965 CD LYS B 276 1.606 −74.238 28.085 1 84.68 B C ATOM 1966 CE LYS B 276 1.567 −75.757 27.935 1 91.28 B C ATOM 1967 NZ LYS B 276 0.79 −76.144 26.724 1 99.33 B N ATOM 1968 C LYS B 276 4.151 −70.021 27.291 1 58.34 B C ATOM 1969 O LYS B 276 4.341 −69.542 26.161 1 51.53 B O ATOM 1970 N ALA B 277 3.835 −69.299 28.36 1 51.27 B N ATOM 1971 CA ALA B 277 3.647 −67.86 28.269 1 51.23 B C ATOM 1972 CB ALA B 277 3.109 −67.305 29.572 1 51.4 B C ATOM 1973 C ALA B 277 4.899 −67.101 27.83 1 54.22 B C ATOM 1974 O ALA B 277 4.793 −66.134 27.068 1 53.3 B O ATOM 1975 N ALA B 278 6.084 −67.522 28.288 1 54.48 B N ATOM 1976 CA ALA B 278 7.318 −66.78 27.944 1 49.47 B C ATOM 1977 CB ALA B 278 8.452 −67.119 28.899 1 46.82 B C ATOM 1978 C ALA B 278 7.749 −67.053 26.507 1 45.05 B C ATOM 1979 O ALA B 278 8.44 −66.231 25.901 1 46.65 B O ATOM 1980 N TYR B 279 7.397 −68.237 26.02 1 40.37 B N ATOM 1981 CA TYR B 279 7.563 −68.614 24.631 1 47.33 B C ATOM 1982 CB TYR B 279 7.216 −70.093 24.387 1 47.12 B C ATOM 1983 CG TYR B 279 7.209 −70.377 22.923 1 53.68 B C ATOM 1984 CD1 TYR B 279 8.403 −70.367 22.17 1 58.31 B C ATOM 1985 CE1 TYR B 279 8.393 −70.607 20.785 1 54.68 B C ATOM 1986 CZ TYR B 279 7.159 −70.816 20.139 1 62.06 B C ATOM 1987 OH TYR B 279 7.043 −71.03 18.771 1 56.98 B O ATOM 1988 CE2 TYR B 279 5.983 −70.796 20.875 1 62.25 B C ATOM 1989 CD2 TYR B 279 6.013 −70.567 22.249 1 58.9 B C ATOM 1990 C TYR B 279 6.703 −67.726 23.728 1 42.07 B C ATOM 1991 O TYR B 279 7.196 −67.115 22.762 1 46.8 B O ATOM 1992 N ILE B 280 5.432 −67.631 24.074 1 41.62 B N ATOM 1993 CA ILE B 280 4.485 −66.769 23.353 1 44.35 B C ATOM 1994 CB ILE B 280 3.071 −66.869 23.98 1 45.22 B C ATOM 1995 CG1 ILE B 280 2.494 −68.245 23.602 1 46.68 B C ATOM 1996 CD1 ILE B 280 1.283 −68.703 24.374 1 46.49 B C ATOM 1997 CG2 ILE B 280 2.159 −65.747 23.505 1 46.41 B C ATOM 1998 C ILE B 280 4.998 −65.337 23.294 1 48.53 B C ATOM 1999 O ILE B 280 4.835 −64.662 22.27 1 47.98 B O ATOM 2000 N ASP B 281 5.667 −64.898 24.365 1 50.22 B N ATOM 2001 CA ASP B 281 6.192 −63.539 24.441 1 51.71 B C ATOM 2002 CB ASP B 281 6.28 −63.073 25.899 1 61.01 B C ATOM 2003 CG ASP B 281 4.922 −63.109 26.605 1 72.44 B C ATOM 2004 OD1 ASP B 281 3.89 −63.365 25.943 1 88.81 B O ATOM 2005 OD2 ASP B 281 4.869 −62.902 27.833 1 82.45 B O ATOM 2006 C ASP B 281 7.51 −63.336 23.712 1 47.62 B C ATOM 2007 O ASP B 281 7.969 −62.188 23.571 1 50.43 B O ATOM 2008 N ILE B 282 8.12 −64.401 23.201 1 44.51 B N ATOM 2009 CA ILE B 282 9.223 −64.179 22.253 1 46.31 B C ATOM 2010 CB ILE B 282 10.44 −65.109 22.473 1 48.05 B C ATOM 2011 CG1 ILE B 282 10.074 −66.58 22.36 1 51.06 B C ATOM 2012 CD1 ILE B 282 11.273 −67.509 22.296 1 48.95 B C ATOM 2013 CG2 ILE B 282 11.058 −64.81 23.828 1 57.56 B C ATOM 2014 C ILE B 282 8.769 −64.177 20.771 1 45.2 B C ATOM 2015 O ILE B 282 9.583 −63.872 19.862 1 47.2 B O ATOM 2016 N LEU B 283 7.499 −64.484 20.528 1 40.33 B N ATOM 2017 CA LEU B 283 6.983 −64.445 19.175 1 43.21 B C ATOM 2018 CB LEU B 283 5.689 −65.172 19.079 1 42.67 B C ATOM 2019 CG LEU B 283 5.762 −66.657 19.392 1 43.36 B C ATOM 2020 CD1 LEU B 283 4.341 −67.186 19.438 1 45.13 B C ATOM 2021 CD2 LEU B 283 6.595 −67.449 18.404 1 44.09 B C ATOM 2022 C LEU B 283 6.831 −62.98 18.772 1 44.95 B C ATOM 2023 O LEU B 283 6.53 −62.133 19.577 1 47.39 B O ATOM 2024 N GLY B 284 7.133 −62.682 17.527 1 46.39 B N ATOM 2025 CA GLY B 284 7.137 −61.311 17.055 1 44.37 B C ATOM 2026 C GLY B 284 8.436 −60.638 17.357 1 44.3 B C ATOM 2027 O GLY B 284 8.481 −59.39 17.41 1 47.29 B O ATOM 2028 N THR B 285 9.491 −61.451 17.541 1 44.46 B N ATOM 2029 CA THR B 285 10.867 −60.963 17.763 1 41.33 B C ATOM 2030 CB THR B 285 11.384 −61.215 19.238 1 43.83 B C ATOM 2031 OG1 THR B 285 11.737 −62.609 19.474 1 41.17 B O ATOM 2032 CG2 THR B 285 10.329 −60.763 20.271 1 45.7 B C ATOM 2033 C THR B 285 11.78 −61.701 16.821 1 43.02 B C ATOM 2034 O THR B 285 11.364 −62.698 16.239 1 45.28 B O ATOM 2035 N VAL B 286 13.049 −61.273 16.77 1 45.07 B N ATOM 2036 CA VAL B 286 14.097 −61.946 16.021 1 44.16 B C ATOM 2037 CB VAL B 286 15.459 −61.176 16.16 1 44.39 B C ATOM 2038 CG1 VAL B 286 16.117 −61.41 17.521 1 44.15 B C ATOM 2039 CG2 VAL B 286 16.43 −61.58 15.076 1 41.98 B C ATOM 2040 C VAL B 286 14.213 −63.455 16.384 1 43.33 B C ATOM 2041 O VAL B 286 14.614 −64.291 15.54 1 45.19 B O ATOM 2042 N LEU B 287 13.803 −63.811 17.597 1 43.65 B N ATOM 2043 CA LEU B 287 13.904 −65.209 18.078 1 44.96 B C ATOM 2044 CB LEU B 287 13.717 −65.287 19.617 1 47.77 B C ATOM 2045 CG LEU B 287 14.653 −64.383 20.455 1 48.53 B C ATOM 2046 CD1 LEU B 287 14.159 −64.209 21.878 1 54.36 B C ATOM 2047 CD2 LEU B 287 16.096 −64.876 20.474 1 50.54 B C ATOM 2048 C LEU B 287 12.965 −66.172 17.366 1 42.36 B C ATOM 2049 O LEU B 287 13.177 −67.401 17.4 1 46.16 B O ATOM 2050 N GLN B 288 11.91 −65.633 16.763 1 38.71 B N ATOM 2051 CA GLN B 288 10.988 −66.402 15.919 1 43.11 B C ATOM 2052 CB GLN B 288 9.752 −65.53 15.685 1 46.91 B C ATOM 2053 CG GLN B 288 8.634 −66.188 14.89 1 51.62 B C ATOM 2054 CD GLN B 288 7.331 −65.448 15.016 1 53.17 B C ATOM 2055 OE1 GLN B 288 7.306 −64.26 15.349 1 55.32 B O ATOM 2056 NE2 GLN B 288 6.245 −66.135 14.738 1 57.04 B N ATOM 2057 C GLN B 288 11.532 −66.799 14.52 1 47.79 B C ATOM 2058 O GLN B 288 10.978 −67.669 13.849 1 53.98 B O ATOM 2059 N VAL B 289 12.59 −66.143 14.07 1 47.6 B N ATOM 2060 CA VAL B 289 13.104 −66.322 12.712 1 49.86 B C ATOM 2061 CB VAL B 289 14.057 −65.176 12.346 1 49.81 B C ATOM 2062 CG1 VAL B 289 14.729 −65.433 10.999 1 51.02 B C ATOM 2063 CG2 VAL B 289 13.322 −63.84 12.392 1 44.39 B C ATOM 2064 C VAL B 289 13.902 −67.593 12.668 1 47.18 B C ATOM 2065 O VAL B 289 14.82 −67.763 13.476 1 43.82 B O ATOM 2066 N GLN B 290 13.61 −68.448 11.703 1 48.4 B N ATOM 2067 CA GLN B 290 14.293 −69.752 11.623 1 57.86 B C ATOM 2068 CB GLN B 290 13.734 −70.611 10.505 1 66.85 B C ATOM 2069 CG GLN B 290 13.869 −72.104 10.756 1 78.97 B C ATOM 2070 CD GLN B 290 12.848 −72.896 9.947 1 85.48 B C ATOM 2071 OE1 GLN B 290 12.878 −72.891 8.714 1 92.17 B O ATOM 2072 NE2 GLN B 290 11.919 −73.54 10.633 1 84.51 B N ATOM 2073 C GLN B 290 15.779 −69.537 11.395 1 54.93 B C ATOM 2074 O GLN B 290 16.174 −68.762 10.535 1 47.22 B O ATOM 2075 N CYS B 291 16.602 −70.189 12.199 1 51.11 B N ATOM 2076 CA CYS B 291 18.03 −69.936 12.16 1 45.32 B C ATOM 2077 CB CYS B 291 18.487 −69.339 13.489 1 50.61 B C ATOM 2078 SG CYS B 291 18.262 −70.423 14.915 1 50.63 B S ATOM 2079 C CYS B 291 18.742 −71.229 11.87 1 47.34 B C ATOM 2080 O CYS B 291 18.217 −72.318 12.134 1 44.04 B O ATOM 2081 N THR B 292 19.961 −71.092 11.358 1 47.54 B N ATOM 2082 CA THR B 292 20.756 −72.22 10.891 1 47.23 B C ATOM 2083 CB THR B 292 21.021 −72.081 9.368 1 45.55 B C ATOM 2084 OG1 THR B 292 21.755 −73.206 8.9 1 52.8 B O ATOM 2085 CG2 THR B 292 21.786 −70.811 9.017 1 39.81 B C ATOM 2086 C THR B 292 22.085 −72.324 11.664 1 50.44 B C ATOM 2087 O THR B 292 22.593 −71.3 12.188 1 41.49 B O ATOM 2088 N CYS B 293 22.644 −73.543 11.74 1 45.73 B N ATOM 2089 CA CYS B 293 24.027 −73.711 12.224 1 49.18 B C ATOM 2090 CB CYS B 293 24.049 −74.681 13.411 1 52.62 B C ATOM 2091 SG CYS B 293 23.219 −73.935 14.859 1 52.05 B S ATOM 2092 C CYS B 293 25.108 −74.037 11.16 1 55.13 B C ATOM 2093 O CYS B 293 26.287 −74.085 11.48 1 57.44 B O ATOM 2094 N ARG B 294 24.728 −74.182 9.895 1 57.21 B N ATOM 2095 CA ARG B 294 25.7 −74.118 8.789 1 61.43 B C ATOM 2096 CB ARG B 294 24.996 −74.318 7.457 1 61.02 B C ATOM 2097 CG ARG B 294 24.203 −75.588 7.349 1 57.21 B C ATOM 2098 CD ARG B 294 23.287 −75.537 6.147 1 55.49 B C ATOM 2099 NE ARG B 294 22.003 −76.163 6.442 1 60.25 B N ATOM 2100 CZ ARG B 294 21.111 −76.536 5.524 1 71.23 B C ATOM 2101 NH1 ARG B 294 19.953 −77.072 5.89 1 73.42 B N ATOM 2102 NH2 ARG B 294 21.37 −76.393 4.237 1 77.11 B N ATOM 2103 C ARG B 294 26.235 −72.693 8.781 1 67.09 B C ATOM 2104 O ARG B 294 25.586 −71.798 9.342 1 79.76 B O ATOM 2105 N THR B 295 27.359 −72.464 8.119 1 61.68 B N ATOM 2106 CA THR B 295 28.039 −71.149 8.086 1 70.86 B C ATOM 2107 CB THR B 295 27.126 −69.922 8.366 1 71.01 B C ATOM 2108 OG1 THR B 295 25.879 −70.065 7.686 1 90.81 B O ATOM 2109 CG2 THR B 295 27.793 −68.595 7.922 1 76.24 B C ATOM 2110 C THR B 295 29.139 −71.037 9.138 1 79.69 B C ATOM 2111 O THR B 295 30.075 −70.245 8.98 1 82.47 B O ATOM 2112 N ILE B 296 29.024 −71.827 10.203 1 77.89 B N ATOM 2113 CA ILE B 296 29.57 −71.458 11.501 1 74.35 B C ATOM 2114 CB ILE B 296 28.526 −71.832 12.602 1 71.68 B C ATOM 2115 CG1 ILE B 296 28.293 −70.663 13.54 1 72.96 B C ATOM 2116 CD1 ILE B 296 27.492 −69.55 12.921 1 70.06 B C ATOM 2117 CG2 ILE B 296 28.889 −73.09 13.404 1 74.06 B C ATOM 2118 C ILE B 296 30.944 −72.114 11.698 1 75.95 B C ATOM 2119 O ILE B 296 31.163 −73.235 11.245 1 78.99 B O ATOM 2120 N THR B 297 31.866 −71.433 12.377 1 81.17 B N ATOM 2121 CA THR B 297 33.196 −72.024 12.645 1 84.16 B C ATOM 2122 CB THR B 297 34.152 −71.035 13.313 1 83 B C ATOM 2123 OG1 THR B 297 33.546 −70.575 14.524 1 80.52 B O ATOM 2124 CG2 THR B 297 34.478 −69.86 12.382 1 78.19 B C ATOM 2125 C THR B 297 33.103 −73.256 13.556 1 82.52 B C ATOM 2126 O THR B 297 32.245 −73.326 14.435 1 84.61 B O ATOM 2127 N GLN B 298 33.981 −74.223 13.309 1 83.17 B N ATOM 2128 CA GLN B 298 34.059 −75.464 14.079 1 88.99 B C ATOM 2129 CB GLN B 298 35.404 −76.159 13.777 1 97.97 B C ATOM 2130 CG GLN B 298 35.922 −77.181 14.79 1 103.12 B C ATOM 2131 CD GLN B 298 35.061 −78.423 14.894 1 104.5 B C ATOM 2132 OE1 GLN B 298 35.404 −79.469 14.345 1 108.32 B O ATOM 2133 NE2 GLN B 298 33.948 −78.322 15.607 1 101.78 B N ATOM 2134 C GLN B 298 33.89 −75.203 15.579 1 94.1 B C ATOM 2135 O GLN B 298 33.079 −75.878 16.24 1 88.07 B O ATOM 2136 N SER B 299 34.647 −74.222 16.094 1 92.42 B N ATOM 2137 CA SER B 299 34.642 −73.872 17.528 1 85.58 B C ATOM 2138 CB SER B 299 35.562 −72.671 17.824 1 79.87 B C ATOM 2139 OG SER B 299 35.504 −71.686 16.809 1 77.13 B O ATOM 2140 C SER B 299 33.221 −73.63 18.071 1 88.52 B C ATOM 2141 O SER B 299 32.744 −74.416 18.903 1 80.35 B O ATOM 2142 N GLU B 300 32.534 −72.608 17.538 1 82.61 B N ATOM 2143 CA GLU B 300 31.222 −72.152 18.069 1 78.03 B C ATOM 2144 CB GLU B 300 31.087 −70.628 17.915 1 77.53 B C ATOM 2145 CG GLU B 300 31.04 −70.088 16.495 1 80.94 B C ATOM 2146 CD GLU B 300 31.387 −68.595 16.384 1 79.64 B C ATOM 2147 OE1 GLU B 300 31.581 −68.109 15.245 1 83.2 B O ATOM 2148 OE2 GLU B 300 31.469 −67.894 17.415 1 79.64 B O ATOM 2149 C GLU B 300 29.967 −72.91 17.558 1 74.01 B C ATOM 2150 O GLU B 300 28.85 −72.383 17.572 1 75.67 B O ATOM 2151 N GLU B 301 30.154 −74.187 17.228 1 71.82 B N ATOM 2152 CA GLU B 301 29.174 −74.997 16.539 1 68.92 B C ATOM 2153 CB GLU B 301 29.874 −76.082 15.722 1 73.12 B C ATOM 2154 CG GLU B 301 28.99 −76.788 14.711 1 80.11 B C ATOM 2155 CD GLU B 301 29.569 −78.117 14.25 1 85.28 B C ATOM 2156 OE1 GLU B 301 30.755 −78.136 13.866 1 92.5 B O ATOM 2157 OE2 GLU B 301 28.841 −79.141 14.263 1 82.96 B O ATOM 2158 C GLU B 301 28.21 −75.62 17.511 1 66.28 B C ATOM 2159 O GLU B 301 27.01 −75.549 17.293 1 73.59 B O ATOM 2160 N SER B 302 28.711 −76.249 18.571 1 67.68 B N ATOM 2161 CA SER B 302 27.822 −76.77 19.644 1 69.12 B C ATOM 2162 CB SER B 302 28.573 −77.507 20.78 1 69.64 B C ATOM 2163 OG SER B 302 29.948 −77.656 20.501 1 75.15 B O ATOM 2164 C SER B 302 27.023 −75.63 20.261 1 56.28 B C ATOM 2165 O SER B 302 25.845 −75.827 20.549 1 63.02 B O ATOM 2166 N LEU B 303 27.669 −74.466 20.472 1 49.66 B N ATOM 2167 CA LEU B 303 26.989 −73.289 21.017 1 50.12 B C ATOM 2168 CB LEU B 303 27.901 −72.075 21.13 1 46.8 B C ATOM 2169 CG LEU B 303 27.163 −70.823 21.666 1 51.82 B C ATOM 2170 CD1 LEU B 303 26.509 −71.065 23.018 1 51.97 B C ATOM 2171 CD2 LEU B 303 28.039 −69.569 21.733 1 50.71 B C ATOM 2172 C LEU B 303 25.785 −72.881 20.158 1 56.02 B C ATOM 2173 O LEU B 303 24.71 −72.562 20.708 1 54.67 B O ATOM 2174 N CYS B 304 26 −72.844 18.834 1 56.11 B N ATOM 2175 CA CYS B 304 24.921 −72.617 17.852 1 50.82 B C ATOM 2176 CB CYS B 304 25.475 −72.535 16.431 1 53.5 B C ATOM 2177 SG CYS B 304 24.226 −72.068 15.19 1 53.28 B S ATOM 2178 C CYS B 304 23.82 −73.675 17.963 1 50.65 B C ATOM 2179 O CYS B 304 22.647 −73.323 18.168 1 49.96 B O ATOM 2180 N LYS B 305 24.177 −74.958 17.927 1 49.41 B N ATOM 2181 CA LYS B 305 23.149 −76.025 18.019 1 51.89 B C ATOM 2182 CB LYS B 305 23.752 −77.427 17.865 1 62.33 B C ATOM 2183 CG LYS B 305 24.75 −77.556 16.739 1 69.39 B C ATOM 2184 CD LYS B 305 24.608 −78.857 16 1 80.74 B C ATOM 2185 CE LYS B 305 25.712 −78.975 14.963 1 91.04 B C ATOM 2186 NZ LYS B 305 25.248 −79.724 13.763 1 97.43 B N ATOM 2187 C LYS B 305 22.398 −75.994 19.332 1 55.17 B C ATOM 2188 O LYS B 305 21.237 −76.438 19.415 1 52.21 B O ATOM 2189 N ILE B 306 23.062 −75.514 20.381 1 53.43 B N ATOM 2190 CA ILE B 306 22.405 −75.461 21.674 1 52.66 B C ATOM 2191 CB ILE B 306 23.429 −75.31 22.823 1 55.19 B C ATOM 2192 CG1 ILE B 306 24.067 −76.68 23.082 1 57.15 B C ATOM 2193 CD1 ILE B 306 25.407 −76.628 23.78 1 58.54 B C ATOM 2194 CG2 ILE B 306 22.767 −74.788 24.1 1 58.3 B C ATOM 2195 C ILE B 306 21.353 −74.368 21.657 1 45.36 B C ATOM 2196 O ILE B 306 20.221 −74.593 22.086 1 44.63 B O ATOM 2197 N PHE B 307 21.735 −73.179 21.197 1 45.64 B N ATOM 2198 CA PHE B 307 20.761 −72.127 20.987 1 48.61 B C ATOM 2199 CB PHE B 307 21.416 −70.861 20.456 1 48.72 B C ATOM 2200 CG PHE B 307 22.184 −70.078 21.499 1 55.29 B C ATOM 2201 CD1 PHE B 307 21.676 −69.882 22.783 1 55.79 B C ATOM 2202 CE1 PHE B 307 22.39 −69.169 23.718 1 59 B C ATOM 2203 CZ PHE B 307 23.617 −68.62 23.395 1 56.7 B C ATOM 2204 CE2 PHE B 307 24.129 −68.793 22.122 1 57.01 B C ATOM 2205 CD2 PHE B 307 23.413 −69.515 21.186 1 56.62 B C ATOM 2206 C PHE B 307 19.628 −72.555 20.038 1 52.58 B C ATOM 2207 O PHE B 307 18.45 −72.32 20.332 1 54.04 B O ATOM 2208 N GLN B 308 19.975 −73.185 18.923 1 50.59 B N ATOM 2209 CA GLN B 308 18.951 −73.687 17.998 1 54.01 B C ATOM 2210 CB GLN B 308 19.588 −74.434 16.827 1 52.68 B C ATOM 2211 CG GLN B 308 18.66 −74.684 15.654 1 53.08 B C ATOM 2212 CD GLN B 308 19.378 −75.36 14.499 1 52.94 B C ATOM 2213 OE1 GLN B 308 19.394 −74.863 13.364 1 56.88 B O ATOM 2214 NE2 GLN B 308 19.985 −76.495 14.786 1 52.02 B N ATOM 2215 C GLN B 308 17.946 −74.602 18.705 1 48.27 B C ATOM 2216 O GLN B 308 16.74 −74.51 18.486 1 51.19 B O ATOM 2217 N HIS B 309 18.447 −75.474 19.563 1 49.44 B N ATOM 2218 CA HIS B 309 17.601 −76.426 20.286 1 49.58 B C ATOM 2219 CB HIS B 309 18.477 −77.442 21.035 1 54.27 B C ATOM 2220 CG HIS B 309 17.705 −78.433 21.85 1 58.26 B C ATOM 2221 ND1 HIS B 309 17.225 −79.614 21.326 1 62.63 B N ATOM 2222 CE1 HIS B 309 16.604 −80.292 22.273 1 62.63 B C ATOM 2223 NE2 HIS B 309 16.666 −79.593 23.393 1 63.56 B N ATOM 2224 CD2 HIS B 309 17.338 −78.42 23.153 1 55.98 B C ATOM 2225 C HIS B 309 16.692 −75.694 21.25 1 49.81 B C ATOM 2226 O HIS B 309 15.528 −76.04 21.373 1 54.66 B O ATOM 2227 N MET B 310 17.222 −74.662 21.907 1 51.13 B N ATOM 2228 CA MET B 310 16.459 −73.91 22.908 1 52.94 B C ATOM 2229 CB MET B 310 17.411 −73.054 23.735 1 60.02 B C ATOM 2230 CG MET B 310 18.335 −73.876 24.66 1 65.7 B C ATOM 2231 SD MET B 310 19.03 −72.877 25.999 1 60.12 B S ATOM 2232 CE MET B 310 19.918 −71.637 25.081 1 62.38 B C ATOM 2233 C MET B 310 15.358 −73.028 22.317 1 58.43 B C ATOM 2234 O MET B 310 14.299 −72.828 22.931 1 49.43 B O ATOM 2235 N LEU B 311 15.626 −72.495 21.124 1 55.3 B N ATOM 2236 CA LEU B 311 14.663 −71.701 20.379 1 54.76 B C ATOM 2237 CB LEU B 311 15.425 −70.837 19.365 1 52.9 B C ATOM 2238 CG LEU B 311 16.244 −69.77 20.085 1 51.8 B C ATOM 2239 CD1 LEU B 311 17.048 −68.986 19.068 1 46.27 B C ATOM 2240 CD2 LEU B 311 15.346 −68.873 20.96 1 48.62 B C ATOM 2241 C LEU B 311 13.538 −72.515 19.702 1 53.84 B C ATOM 2242 O LEU B 311 12.5 −71.952 19.309 1 51.52 B O ATOM 2243 N HIS B 312 13.713 −73.828 19.61 1 56.51 B N ATOM 2244 CA HIS B 312 12.74 −74.667 18.924 1 62.13 B C ATOM 2245 CB HIS B 312 13.404 −75.873 18.282 1 62.52 B C ATOM 2246 CG HIS B 312 12.669 −76.337 17.079 1 75.27 B C ATOM 2247 ND1 HIS B 312 11.639 −77.245 17.156 1 81.3 B N ATOM 2248 CE1 HIS B 312 11.13 −77.436 15.956 1 72.39 B C ATOM 2249 NE2 HIS B 312 11.77 −76.652 15.108 1 81.34 B N ATOM 2250 CD2 HIS B 312 12.724 −75.936 15.789 1 75.21 B C ATOM 2251 C HIS B 312 11.576 −75.096 19.82 1 65.6 B C ATOM 2252 O HIS B 312 11.793 −75.572 20.947 1 66.91 B O ATOM 2253 N ARG B 313 10.343 −74.916 19.319 1 64.63 B N ATOM 2254 CA ARG B 313 9.137 −75.116 20.137 1 68.65 B C ATOM 2255 CB ARG B 313 7.884 −74.453 19.52 1 71.7 B C ATOM 2256 CG ARG B 313 7.382 −75.039 18.208 1 70.13 B C ATOM 2257 CD ARG B 313 5.972 −74.574 17.816 1 74.5 B C ATOM 2258 NE ARG B 313 5.468 −75.415 16.713 1 75.53 B N ATOM 2259 CZ ARG B 313 4.196 −75.538 16.31 1 76.08 B C ATOM 2260 NH1 ARG B 313 3.925 −76.373 15.308 1 78.33 B N ATOM 2261 NH2 ARG B 313 3.19 −74.852 16.878 1 74.93 B N ATOM 2262 C ARG B 313 8.869 −76.584 20.44 1 70.81 B C ATOM 2263 O ARG B 313 8.305 −76.893 21.486 1 70.23 B O ATOM 2264 N LYS B 314 9.22 −77.465 19.498 1 76.73 B N ATOM 2265 CA LYS B 314 9.17 −78.935 19.703 1 86.87 B C ATOM 2266 CB LYS B 314 9.552 −79.717 18.416 1 95.74 B C ATOM 2267 CG LYS B 314 10.965 −80.337 18.358 1 103.07 B C ATOM 2268 CD LYS B 314 11.272 −80.941 16.982 1 110.25 B C ATOM 2269 CE LYS B 314 12.645 −80.559 16.438 1 113.63 B C ATOM 2270 NZ LYS B 314 12.678 −80.71 14.952 1 117.87 B N ATOM 2271 C LYS B 314 10.023 −79.415 20.889 1 82.22 B C ATOM 2272 O LYS B 314 9.645 −80.367 21.575 1 83.12 B O ATOM 2273 N SER B 315 11.167 −78.76 21.105 1 71.79 B N ATOM 2274 CA SER B 315 12.013 −79.017 22.273 1 69.76 B C ATOM 2275 CB SER B 315 13.304 −78.194 22.192 1 64.2 B C ATOM 2276 OG SER B 315 13.918 −78.345 20.929 1 66.4 B O ATOM 2277 C SER B 315 11.336 −78.765 23.636 1 68.25 B C ATOM 2278 O SER B 315 11.833 −79.263 24.656 1 74.38 B O ATOM 2279 N CYS B 316 10.261 −77.966 23.67 1 62.65 B N ATOM 2280 CA CYS B 316 9.476 −77.748 24.902 1 68.81 B C ATOM 2281 CB CYS B 316 9.439 −76.256 25.246 1 68.41 B C ATOM 2282 SG CYS B 316 11.011 −75.579 25.848 1 73.83 B S ATOM 2283 C CYS B 316 8.037 −78.32 24.885 1 72.28 B C ATOM 2284 O CYS B 316 7.46 −78.528 25.955 1 70.57 B O ATOM 2285 N PHE B 317 7.477 −78.591 23.698 1 77.56 B N ATOM 2286 CA PHE B 317 6.055 −78.931 23.552 1 78.82 B C ATOM 2287 CB PHE B 317 5.239 −77.647 23.356 1 79.14 B C ATOM 2288 CG PHE B 317 5.56 −76.562 24.345 1 83.93 B C ATOM 2289 CD1 PHE B 317 5.092 −76.635 25.654 1 88.9 B C ATOM 2290 CE1 PHE B 317 5.394 −75.632 26.574 1 88.22 B C ATOM 2291 CZ PHE B 317 6.164 −74.536 26.192 1 82.39 B C ATOM 2292 CE2 PHE B 317 6.644 −74.45 24.893 1 86.67 B C ATOM 2293 CD2 PHE B 317 6.345 −75.465 23.975 1 90 B C ATOM 2294 C PHE B 317 5.768 −79.865 22.381 1 79.06 B C ATOM 2295 O PHE B 317 5.958 −79.477 21.233 1 78.14 B O ATOM 2296 N ASN B 318 5.335 −81.092 22.675 1 86.74 B N ATOM 2297 CA ASN B 318 4.603 −81.937 21.69 1 97.22 B C ATOM 2298 CB ASN B 318 5.472 −82.382 20.488 1 96.55 B C ATOM 2299 CG ASN B 318 6.789 −82.994 20.914 1 102.52 B C ATOM 2300 OD1 ASN B 318 6.81 −83.983 21.644 1 108.78 B O ATOM 2301 ND2 ASN B 318 7.895 −82.416 20.461 1 101.47 B N ATOM 2302 C ASN B 318 3.928 −83.147 22.336 1 90.47 B C ATOM 2303 O ASN B 318 2.727 −83.35 22.159 1 87.94 B O Column 1- record name; Column 2 - atom serial number; Column 3 - atom name; Column 4 - amino acid residue name; Column 5 - chain identifier; Column 6 - amino acid residue sequence number; Column 7 - orthoganal coordinates for X in Angstromes; Column 8 - orthoganal coordinates for Y in Angstromes; Column 9 - orthoganal coordinates for Z in Angstromes; Column 10 - occupancy; Column 11 - temperature factor; Column 12 - Segment identifier; Column 13 - element symbol.

    [0356] While the present invention has been described with reference to the specific embodiments thereof, it should be understood by those skilled in the art that various changes may be made and equivalents may be substituted without departing from the true spirit and scope of the invention. In addition, many modifications may be made to adapt a particular situation, material, composition of matter, process, process step or steps, to the objective, spirit and scope of the present invention. All such modifications are intended to be within the scope of the claims appended hereto.