Glycan-modified anti-CD4 antibodies for HIV prevention and therapy
09790276 · 2017-10-17
Assignee
Inventors
Cpc classification
C07K2317/41
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
International classification
Abstract
Disclosed herein are glycan-modified anti-CD4 monoclonal antibodies with N-linked glycans attached to the variable region. Expression vectors and cell lines useful for the production of such antibodies, and use of such antibodies for HIV prevention and therapy are also disclosed.
Claims
1. A glycan-modified antibody comprising N-linked glycans attached to a variable region of said antibody, wherein said antibody comprises a heavy chain comprising three CDRs contained in SEQ ID NO: 2 and a light chain comprising three CDRs contained in SEQ ID NO:3, and comprises an engineered N-linked glycosylation site at an amino acid position in the sequence of SEQ ID NO:3 selected from the group consisting of amino acid 54 of SEQ ID NO:3 (30EGln), amino acid 77 of SEQ ID NO:3 (52Ser), amino acid 78 of SEQ ID NO:3 (53Thr), amino acid 79 of SEQ ID NO:3 (54Arg), amino acid 85 of SEQ ID NO:3 (60Asp), amino acid 90 of SEQ ID NO:3 (65Ser), amino acid 92 of SEQ ID NO:3 (67Ser), and amino acid 101 of SEQ ID NO:3 (76Ser).
2. The antibody of claim 1, wherein the one or more N-linked glycans are attached to the variable region of the light chain of said antibody.
3. The antibody of claim 1, wherein the engineered N-linked glycosylation site is located at an amino acid position of the light chain selected from the group consisting of 30EGln, 52Ser, 53Thr, 54Arg, 65Ser, and 67Ser.
4. The antibody of claim 3, wherein the engineered N-linked glycosylation site is located at 52Ser.
5. The antibody of claim 4, wherein said light chain comprises an amino acid sequence of the light chain as set forth in SEQ ID NO: 4.
6. A glycan-modified antibody comprising N-linked glycans attached to a variable region of said antibody, wherein said antibody comprises a light chain and a heavy chain, wherein said light chain comprises an amino acid sequence of the light chain set forth in SEQ ID NO:4 and wherein said heavy chain comprises an amino acid sequence of the heavy chain as set forth in SEQ ID NO: 5.
7. The antibody of claim 1, wherein the N-linked glycans comprise at least 7 carbohydrate units.
8. The antibody of claim 7, wherein the N-linked glycans comprise 10-11 carbohydrate units.
9. A pharmaceutical composition comprising the antibody of claim 1 and at least one pharmaceutically acceptable carrier.
10. A pharmaceutical composition comprising the antibody of claim 6 and at least one pharmaceutically acceptable carrier.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The foregoing summary, as well as the following detailed description of the invention, will be better understood when read in conjunction with the appended drawings. For the purpose of illustrating the invention, there are shown in the drawings embodiments which are presently preferred. It should be understood, however, that the invention is not limited to the embodiments.
(2) In the drawings:
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
DETAILED DESCRIPTION OF THE INVENTION
(27) The present invention has demonstrated for the first time that the function of a monoclonal antibody can be improved through glycan modification in the variable region. In particular, it has been discovered in the present invention that grafting glycans onto the variable region of the light chain of an anti-CD4 monoclonal antibody can restore a glycan-mediated interaction between the antibody and HIV, such that the antibody with a glycan modification can potently inhibit infection of viral isolates that normally escape the activity of the parent antibody molecule (without the glycan modification).
(28) Accordingly, the present invention provides glycan-modified anti-CD4 monoclonal antibodies, components such as expression vectors and cell lines useful for the production of such antibodies, and use of such antibodies for HIV prevention and therapy.
(29) Definitions
(30) An “antigen” refers to a molecule which contains one or more epitopes and which is capable of eliciting an immunological response. “Antigenic molecules” are also used in a general sense to refer to molecules that are binding targets of the glycan modified proteins disclosed herein.
(31) An “epitope”, also known as antigenic determinant, is the portion of an antigenic molecule or molecules that is recognized by the immune system, i.e., B cells, T cells or antibodies. An epitope can be a conformational epitope or a linear epitope. A conformational epitope is formed by discontinuous sections of an antigenic molecule, or formed by multiple molecules. In the case where the antigen is a protein, a conformational epitope can be formed by discontinuous amino acid residues of the same protein molecule, or by amino acid residues on different molecules of the protein (e.g., a quaternary epitope formed by a multimer of the protein). A linear epitope is formed by continuous sections of an antigen, e.g., a continuous sequence of amino acids of a protein antigen.
(32) The term “antibody” is used herein broadly and encompasses intact antibody molecules, which include intact polyclonal, monoclonal, monospecific, polyspecific, chimeric, humanized, human, primatized, single-chain, single-domain, synthetic and recombinant antibodies, and antibody fragments that have a desired activity or function.
(33) The term “antibody fragments,” as used herein, includes particularly antigen-binding fragments of an intact antibody. Examples of antigen-binding fragments include, but are not limited to, Fab fragments (consisting of the VL, VH, CL and CH1 domains), Fab′ fragments (which differs from Fab fragments by having an additional few residues at the C-terminus of the CH1 domain including one or more cysteines from the antibody hinge region), (Fab′).sub.2 fragments (formed by two Fab′ fragments linked by a disulphide bridge at the hinge region), Fd fragments (consisting of the VH and CH1 domains), Fv fragments (referring to a dimer of one heavy and one light chain variable domain in tight, non-covalent association which contains a complete antigen recognition and binding site), dAb fragments (consisting of a VH domain), single domain fragments (VH domain, VL domain, VHH domain, or VNAR domain), isolated CDR regions, scFv (or “single chain Fv”, referring to a fusion of the VL and VH domains, linked together via a linker), and other antibody fragments that retain antigen-binding function.
(34) The term “variable region” refers to the antigen-binding region of an antibody, which varies greatly between different antibody molecules. The region of an antibody that does not vary the same way and generally engages effector functions of the immune system is called “constant region”. Approximately the first 110 amino acids of an immunoglobulin chain (mature form) constitute its variable domain. The two variable domains of the heavy chain (VH) and the two variable domains of the light chain (VL) make up the variable region of an antibody. The six constant domains of the heavy chain (CH.sub.1, CH.sub.2, and CH.sub.3) and the two constant domains of the light chain (CL) make up the constant region of an antibody.
(35) The term “CDR” or “complementarity determining region” refers to the hypervariable regions within the variable domain of an antibody. There are 3 CDRs in each of the heavy chain and light chain variable domains, and are composed of amino acid residues responsible for antigen-binding. The term “framework region” or “FR” refers to the more conserved portions of the variable domains and is composed of residues other than the hypervariable region residues.
(36) The term “antigen-binding site” of an antibody means a conformation and/or configuration formed by amino acids of the antibody to which an antigen binds. For example, the three CDRs of each of the VH and VL domains interact to define an antigen-binding site on the surface of the VH-VL dimer. Together, the six CDRs confer antigen-binding specificity to the antibody. It should be noted, however, a single variable domain (i.e., VH or VL) can also recognize and bind antigen, albeit often less effectively than the whole binding site with all six CDRs.
(37) The term “chimeric antibody” refers to antibodies containing polypeptides from different sources, e.g., different species or different antibody class or subclass. Examples of chimeric antibodies include an antigen-binding portion of a murine monoclonal antibody fused an Fc fragment of a human immunoglobulin. Methods for making chimeric antibodies are known in the art; for example, methods described in patents by U.S. Pat. No. 4,816,397 to Boss et al. and U.S. Pat. No. 4,816,567 to Cabilly et al.
(38) The term “humanized antibody” refers to antibodies that contain non-human sequence elements in a human immunoglobulin backbone or framework. Generally, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region (CDRs) of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, RAT, rabbit or nonhuman primate having a desired specificity, affinity and capacity. In some instances, framework region (FR) residues of the human immunoglobulin are also replaced by non-human residues. Humanized antibodies may also, in some instances, contain residues that are not found in either the recipient antibody or the donor antibody and introduced to further refine antibody performance. In general, a humanized antibody contains substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin sequence. A humanized antibody optionally also contains at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. Methods for making humanized antibodies are documented in the art; see, for example, by U.S. Pat. No. 5,225,539 to Winter and U.S. Pat. No. 4,816,397 to Boss et al.
(39) The term “non-human primatized antibody” refers to antibodies that contain human sequence elements or non-primate sequence elements in a non-human primate immunoglobulin backbone or framework. For example, non-human primatized antibodies can be made from a non-human primate immunoglobulin (recipient antibody) by replacing residues in a hypervariable region (CDRs) of the recipient antibody with residues from a hypervariable region of a donor antibody from a human or non-primate species such as mouse, RAT or rabbit having a desired specificity, affinity and capacity. Alternatively, non-human primatized antibodies can be made suitable for administration to a desirable primate species by using a recipient immunoglobulin having human or non-primate sequences or sequences from a different primate species and introducing the Fc fragment, and/or residues, including particularly framework region residues, from the desirable primate, into the recipient immunoglobulin. Examples of non-human primatized antibodies include “monkeynized” antibodies disclosed herein in the Examples section.
(40) The term “monospecific antibody” refers to antibodies that recognize and bind to one epitope.
(41) The term “polyspecific antibody” refers to antibodies formed from at least two separate antibodies and binding to multiple (i.e., two or more) separate epitopes.
(42) The term “neutralizing antibody” refers to an antibody that inhibits, reduces or completely prevents HIV-1 infection. Whether an antibody is a neutralizing antibody can be determined by in vitro assays described in the Examples section hereinbelow.
(43) The term “potent neutralizing antibody” refers to an antibody which, when used at a low concentration, reduces HIV-1 infection by at least 50%, 60%, 70%, 80%, 90%, 95%, 99% or greater. Concentrations below 50 μg/ml, between 1 and 50 μg/ml, or even below 1 μg/ml, are considered “low concentrations”. In some embodiments, low concentrations are concentrations in the picomolar range, such as 10-900 ng/ml, and include any concentration in that range, such as 800, 700, 600, 500, 400, 300, 200, 100, 75, 50, 25, 10 ng/ml, or even less than 10 ng/ml.
(44) The term “broad neutralizing antibody” refers to an antibody which inhibits HIV-1 infection, as defined by a 50% inhibition of infection in vitro, in more than 50%, 60%, 70%, 80%, 90%, 95%, 99% or greater, of a large panel of (greater than 100) HIV-1 envelope pseudotyped viruses and viral isolates; for example, a large panel of isolates representing envelope diversity by geography, clade, tropism, and stage of infection.
(45) The term “fragment” as used herein refers to a physically contiguous portion of the primary structure of a biomolecule. In the case of proteins, a fragment may be defined by a contiguous portion of the amino acid sequence of a protein and may be at least 3-5 amino acids, at least 6-10 amino acids, at least 11-15 amino acids, at least 16-24 amino acids, at least 25-30 amino acids, at least 30-45 amino acids and up to the full length of the protein minus a few amino acids. In the case of polynucleotides, a fragment is defined by a contiguous portion of the nucleic acid sequence of a polynucleotide and may be at least 9-15 nucleotides, at least 15-30 nucleotides, at least 31-45 nucleotides, at least 46-74 nucleotides, at least 75-90 nucleotides, and at least 90-130 nucleotides. In some embodiments, fragments of biomolecules are immunogenic fragments.
(46) A “fusion protein” refers to two or more peptides of different origins connected to each other via a linker or linkers. For example, a fusion protein can include a protein conjugated to an antibody. Other examples include, an antibody conjugated to a different antibody or an antibody conjugated to a Fab fragment. The Fab fragment can be conjugated to the N terminus or C terminus of the heavy or light chain of the antibody, or other regions within the antibody.
(47) A “peptide” is any compound formed by the linkage of two or more amino acids by amide (peptide) bonds, usually a polymer of alpha-amino acids in which the alpha-amino group of each amino acid residue (except the NH2 terminus) is linked to the alpha-carboxyl group of the next residue in a linear chain. The terms peptide, polypeptide and poly(amino acid) are used synonymously herein to refer to this class of compounds without restriction as to size, unless indicated to the contrary. Members of this class having a large size are also referred to as proteins and include antibodies.
(48) Glycan-Modified Anti-CD4 Monoclonal Antibodies
(49) This glycan modification approach disclosed herein is applicable to anti-CD4 monoclonal antibodies, which can be a monoclonal antibody that is a monospecific, polyspecific, chimeric, humanized, human, non-human primatized, single-chain, and/or single-domain antibody. The present approach is also applicable to fragments of anti-CD4 monoclonal antibodies, especially antigen-binding fragments of anti-CD4 monoclonal antibodies.
(50) Anti-CD4 antibodies have been described in the art and can also be readily generated as the protein sequence of the CD4 receptor is available to those skilled in the art. CD4 has four immunoglobulin domains (D1 to D4) that are located on the extracellular surface of the cell, and uses its D1 domain to interact with the β.sub.2-domain of MHC class II molecules. In some embodiments, the anti-CD4 antibody binds to one or more of D1, D1-D2 junction, D2, the BC or FG loop of D2, or any combination thereof. In specific embodiments, anti-CD4 antibodies used in this disclosure are directed principally to the second immunoglobulin-like domain (D2) (amino acid positions 98-180) of the CD4 receptor. Antibodies directed to the D2 domain of CD4 have the desirable property of blocking HIV infection without interfering with immune functions mediated by interaction of CD4 with the major histocompatibility complex (MHC) class II molecules. In other embodiments, the anti-CD4 antibody used in the present invention binds to an epitope located in the BC-loop of D2 near the D1-D2 junction of the CD4 receptor (amino acids 121-127). In still other embodiments, the anti-CD4 antibody binds to the FG-loop of D2 (amino acids 163-165) and part of D1 (amino acids 77-96). The amino acid numbering corresponds to positions of the mature form of the CD4 receptor, not including the signal peptide. The amino acid sequence of the human CD4 receptor is set forth in SEQ ID NO: 1, in which amino acids 1-25 represent a signal peptide, amino acids 26-122 constitute D1, and amino acids 123-205 constitute D2.
(51) In a specific embodiment, the anti-CD4 monoclonal antibody is the humanized antibody, ibalizumab or “iMab” (previously known as TNX-355, or hu5A8). Ibalizumab potently blocks infection by a broad spectrum of HIV-1 isolates and targets an epitope located in the BC-loop of D2 near the D1-D2 junction of the CD4 receptor, without interfering with immune functions mediated by interaction of CD4 with the major histocompatibility complex (MHC) class II molecules. One example of the anti-CD4 antibody is that provided in U.S. Pat. No. 5,871,732, which is entirely incorporated by reference herein.
(52) In another embodiment, the anti-CD4 antibody or fragment thereof is a mutant of ibalizumab with improved stability. One example is the anti-CD4 antibody having one or more substitutions in the hinge region that prevent intrachain disulfide bond formation resulting in antibody molecules with surprisingly improved bivalent stability, for instance, those provided in WO2008134046 (A1), published on Apr. 27, 2007, which is incorporated herein by reference.
(53) According to the embodiments of the invention, the anti-CD4 antibody may be generated by IgG 4 or IgG 1. In one example of the invention, an anti-CD4 IgG 1 antibody with binding affinity to CD4 was prepared, designated as MV1. The MV1 has a leucine to phenylalanine change at position 234, a leucine to glutamic acid change at position 235 and a proline to serine change at position 331 of the IgG 1 constant region. The MV1 has the amino acid sequences for the heavy chain and light chain as set forth in SEQ ID NOS: 2-3, respectively.
(54) In some examples of the invention, the anti-CD4 antibody may comprise one or more modifications in the Fc region or FcRn region of the heavy chain to improve recycling of the anti-CD4 antibody. One particular example is the anti-CD4 antibody comprises an amino acid sequence of heavy chain as set forth in SEQ ID NO: 5.
(55) Glycan modification disclosed herein involves adding glycans to an engineered N-linked glycosylation site within the variable region of an anti-CD4 antibody. In eukaryotic cells, glycans are attached to asparagine residues within the consensus sequence Asn-X-Ser/Thr of newly synthesized polypeptides as they emerge from the ribosome. This N-linked glycosylation process is an enzyme-directed process which occurs in the ER and the Golgi apparatus. For the purpose of the present invention, the Asn residue within a consensus sequence Asn-X-Ser/Thr is referred to as the “N-linked glycosylation site.” The skilled artisan can employ a variety of molecular cloning techniques to engineer an N-linked glycosylation site within the variable region of an anti-CD4 monoclonal antibody, which may include one or more insertions, deletions and/or substitutions of amino acids in order to obtain a consensus N-linked glycosylation sequence Asn-X-Ser/Thr.
(56) In some embodiments, an N-linked glycosylation site is engineered within the V-domain of the light chain (VL) of an anti-CD4 monoclonal antibody. One may consider conducting a 3-D modeling analysis of the relevant antibodies, the CD4 receptor and the HIV gp120 protein to facilitate a determination of a suitable or a more desirable location within the antibody for an N-linked glycosylation site. As illustrated, the present invention demonstrates that for ibalizumab or other anti-CD4 antibody, an N-linked glycosylation site can be introduced to a location that is close to the V5 loop of the HIV gp120 protein bound to CD4 Domain 1 in a 3-D modeling analysis.
(57) In some embodiments, an N-linked glycosylation site is engineered at an amino acid position of the light chain of ibalizumab or corresponding positions thereof, selected from residues 30E, 52, 53, 54, 60, 65 and 67 and 76, and a combination thereof. In particular, the amino acid position is selected from the group consisting of positions 30E Gln, 52Ser, 53Thr, 54Arg, 60Asp, 65Ser, 67Ser, and 76Ser. According to the invention, each of the amino acid changes made to the sequence represented by “30E Gln”, “52Ser”, “53Thr”, “54Arg”, “60Asp”, “65Ser”, “67Ser”, and “76Ser” to introduce a new N-linked glycosylation site at each of these positions is given below: 30E Gln: 30E Gln, 31Lys, 32Asn changed to 30E Asn, 31Ala, 32Thr 52Ser: 52Ser, 53Thr, 54Arg changed to 52Asn, 53Ser, 54Thr 53Thr: 53Thr, 54Arg, 55Glu changed to 53Asn, 54Ala, 55Thr 54Arg: 54Arg, 55Glu, 56Ser changed to 54Asn, 55Ala, 56Thr 60Asp: 60Asp, 61Arg, 62Phe changed to 60Asn, 61Ala, 62Thr 65Ser: 65Ser, 66Gly, 67Ser changed to 65Asn, 66Ala, 67Thr 67Ser: 67Ser, 68Gly, 69Thr changed to 67Asn, 68Ala, 69Thr 76Ser: 76Ser, 77Ser, 78Val changed to 76Asn, 77Ala, 78Thr.
(58) In the examples of the invention, a N-linked glycosylation N-linked glycosylation at either or combination of the positions 30EGln, 52Ser, 53Thr, 54Arg, 65Ser and 67Ser can provide an improved activity. In one specific example, the position is position 52Ser. The numbering of these positions is based on the mature form of the light chain (devoid of the first 16 amino acid signal sequence) of ibalizumab, or the corresponding positions thereof. In specific embodiments, the N-linked glycosylation site is engineered at one of 30E Gln, 52Ser, or 53Thr of the ibalizumab light chain. In a particular example, the N-linked glycosylation site is engineered at position 52Ser.
(59) In a particular example of the invention, a derivative IgG1 version of ibalizumab with modifications to improve the stability, called MV1, was used to generate the glycan-modified anti-CD4 antibody. The heavy chain and light chain of the MV1 have the amino acid sequences set forth in SEQ ID NOS: 2 and 3, respectively. The light chain has an engineered N-linked glycosylation site at position 52, which has the amino acid sequence set forth in SEQ ID NO: 4. The MV1 may have a further modification in the Fc region or FcRn region of the heavy chain to improve recycling of the antibody. A particular example of the present invention provides a glycan-modified anti-CD4 antibody with improved activity and stability comprising the amino acid sequence of light chain as set forth in SEQ ID NO: 4 and the amino acid sequence of heavy chain as set forth in SEQ ID NO: 5.
(60) Once an N-linked glycosylation site has been engineered within the variable region of an anti-CD4 monoclonal antibody, glycan-modified forms of such antibody can be readily produced using suitable recombinant expression systems. For example, a cell line suitable for recombinant expression of antibody molecules and capable of N-linked glycosylation can be transfected with expression vector(s) encoding the light chain of an anti-CD4 antibody, wherein at least a variable domain of the light chain has been engineered to include an N-linked glycosylation site. Antibody-containing culture supernatants can be collected and subjected to any appropriate chromatography to obtain a substantially purified antibody preparation.
(61) Cell lines suitable for recombinant expression of antibody molecules are readily available to those skilled in the art, and are generally capable of N-linked glycosylation. In eukaryotes, the N-linked glycosylation process occurs co-translationally and the initial step takes place at the luminal side of the ER membrane, involving the transfer of a Glc.sub.3Man.sub.9GlcNAc.sub.2 oligosaccharide to nascent polypeptide chains. This precursor structure is then further modified by a series of glycosidases and glycosyltransferases. Following the removal of the three glucose residues by glucosidase I and II, one specific terminal α-1,2-mannose is removed by mannosidase I. These reactions are well conserved between most lower and higher eukaryotes. At this point, correctly folded Man.sub.8GlcNAc.sub.2 N-linked glycosylated proteins may exit the glycosylation machinery; alternatively, they may continue and undergo further species- and cell type-specific processing, catalyzed by a series of enzymes, to produce hybrid and/or complex type glycans. See
(62) According to this invention, the N-linked glycans added to the variable region of an anti-CD4 antibody should include at least 7, 8, 9, 10, 11 or 12 carbohydrate units or “rings.” The term “carbohydrate units” refers to individual saccharide molecules that are linked to each other to make up the native N-glycans in eukaryotic cells; i.e., they include glucose, mannose, N-acetylglucosamine, galactose, and sialic acid. The precise structure (i.e., the compositions and serial linkage) of the N-glycans on an antibody may not be entirely critical as long as the N-glycans include at least 7 units. Examples of N-linked glycans include those typically seen in mammalian cells, e.g., Man.sub.8GlcNAc.sub.2 (the GlcNAc at the end being linked to Asn), Man.sub.5GlcNAc.sub.2, GlcNAcMan.sub.5GlcNAc.sub.2, GlcNAc.sub.2Man.sub.3GlcNAc.sub.2, Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2, (sialic acid).sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2, GalGlcNAcMan.sub.5GlcNAc.sub.2, as well as the bisected bi-antennary complex, the tri-antennary complex, tri′-antennary complex and tetra-antennary complex N-glycans described in U.S. Pat. No. 6,602,684 (e.g.,
(63) According to this invention, suitable cells lines for recombinant expression of glycan-modified antibodies are eukaryotic cells, including especially mammalian cell lines such as Chinese hamster ovary (CHO) cells, Baby Hamster Kidney (BHK) cells, (Murine myeloma) NSO cells, Murine myeloma SP2/0 cells, human embryonic kidney 293 (HEK293 or 293) cells, mouse embryonic fibroblast 3T3 cells, and cell lines derived therefrom as long as the derived cells can effectively express a recombinant antibody with N-linked glycosylation. Many of these cells are available through American Tissue Culture Collection (ATCC) or commercial sources. Genetically modified cells that produce glycoproteins having altered glycoforms, e.g., glycoproteins having a particular class of N-linked glycans (such as bi-antennary complex N-linked oligosaccharides) modified with bisecting N-acetylglucosamine (GlcNAc), as described in U.S. Pat. No. 6,602,684, incorporated herein by reference), can also be employed to produce the antibodies of this invention. Other eukaryotic cells which may be appropriate include insect cells and yeast cells, such as baker yeast S. cerevisiae and methylotrophic yeast such as Pichia pastoris, including particularly yeast strains genetically modified to produce proteins having human N-glycan forms. See, e.g., U.S. Pat. No. 7,029,872, and U.S. Pat. No. 7,449,308, both incorporated herein by reference.
(64) According to the examples of the invention, the N-linked glycans are attached to an antibody molecule produced from cells by treating the antibody molecule isolated from cell culture with enzymes (e.g., PNGase). A shift in the apparent molecular weight of the antibody (which can be detected in SDS-PAGE, Western blot, and the like) as a result of the treatment indicates that N-linked glycans are indeed attached to the antibody molecule. The size of the N-linked glycans can be estimated by comparing with N-linked glycans of known sizes. For a more detailed analysis, the N-linked glycans attached to the antibody can be analyzed by DNA sequencer assisted (DSA), fluorophore assisted carbohydrate electrophoresis (FACE), or MALDI-TOF MS, for example, all of which are techniques well documented in the art. For example, in a DSA-FACE analysis, N-linked glycans are released from a glycosylated antibody peptide: N-glycosidase F (PNGase F). The released N-linked glycans are then derivatized with the fluorophore 8-aminopyrene-1,3,6-trisulfonate (APTS) by reductive amination. After removal of excess APTS, the labeled N-linked glycans are analyzed with an ABI 3130 DNA sequencer. See, e.g., Laroy et al. (Nat Protoc. 1: 397-405 (2006)), U.S. Pat. No. 6,602,684 for MALDI-TOF MS analysis of N-linked glycans on recombinantly produced proteins, which are incorporated by reference herein.
(65) Glycan-modified antibodies can be evaluated in various functional assays to confirm their effectiveness in neutralizing HIV, including assays to determine the breadth and potency of the antibodies against large panels of viral isolates as described in the examples section.
(66) In the embodiments of the invention, it is confirmed that a glycan on the N-terminus of gp120 fills a vacant space between the L chain of ibalizumab and gp120 V5, and ibalizumab's effect on HIV-1 entry is sterically mediated by the mass effect of this glycan. In the tests of a panel of ibalizumab mutants with PNGS at various positions in the L chain on the ability to neutralize HIV-1 infectivity in vitro, it was found that ibalizumab mutants bearing a glycan located in close proximity to V5 in the ibalizumab-CD4-gp120 complex efficiently neutralized HIV-1. These ibalizumab mutants also neutralized HIV-1 strains that are resistant to wild-type ibalizumab. In one particular example of the invention, an ibalizumab mutant, LM52, neutralized 100% of the tested 118 HIV-1 isolates at a potency more than 10-fold higher than wild-type ibalizumab judging by the geometric mean IC.sub.80, the antibody concentration required to neutralize 80% of infection. It is indicated that ibalizumab blocks HIV-1 entry through a steric hindrance mechanism, and provide an example of how a strategic placement of an N-linked glycosylation site can be used to improve the activity of a monoclonal antibody.
(67) Based on the findings in the invention, it is indicated that the glycan-addition approach may be adapted to enhance their functional activity of monoclonal antibodies. Using the structural-activity relationship (SAR), it is conceivable that increasing the bulk at key positions on the antibody could lead to improved activity so as to generate a superior monoclonal antibody product.
(68) In some embodiments of this invention, it may be desirable to produce antibodies with substantially homogeneous N-linked glycans or one class of N-linked glycans. By “substantially homogeneous” it is meant that at least 50%, 60%, 75%, 80%, 85%, 90% or even 95% of the N-linked glycans on the antibody molecules in a preparation are of the same structure, same size (i.e., same molecular weight, or alternatively, same number of carbohydrate “rings”), or same range of size (e.g., 9-12 “rings”, or 10-11 “rings”), and/or type. This can be achieved by utilizing cell lines genetically engineered to express or overexpress a selected set of enzymes involved in N-glycosylation (see, e.g., U.S. Pat. No. 6,602,684 and U.S. Pat. No. 7,029,872, incorporated by reference herein), or to disrupt an enzyme at an intermediate stage in the N-glycosylation pathway (e.g., GnT1 knockout strains), or to utilize one or more inhibitors that target specific processing enzymes, or a combination thereof. Examples of inhibitors include Kifunensine, DMJ (for “deoxymannojirimycin”), and Swainsonine.
(69) Pharmaceutical Composition
(70) Pharmaceutical composition comprising a glycan-modified antibody disclosed herein can be prepared by mixing the antibody with one or more optional pharmaceutically acceptable carriers. Pharmaceutically acceptable carriers include solvents, dispersion media, isotonic agents and the like. The carrier can be liquid, semi-solid, e.g. pastes, or solid carriers. Examples of carriers include water, saline solutions or other buffers (such as phosphate, citrate buffers), oil, alcohol, proteins (such as serum albumin, gelatin), carbohydrates (such as monosaccharides, disaccharides, and other carbohydrates including glucose, sucrose, trehalose, mannose, mannitol, sorbitol or dextrins), gel, lipids, liposomes, resins, porous matrices, binders, fillers, coatings, stabilizers, preservatives, antioxidants including ascorbic acid and methionine, chelating agents such as EDTA; salt forming counter-ions such as sodium; non-ionic surfactants such as TWEEN™, PLURONICS™ or polyethylene glycol (PEG), or combinations thereof.
(71) The pharmaceutical composition can contain more than one active compound, e.g., one or more antibodies, in combination with one or more additional beneficial compound for inhibiting, preventing and treating HIV infections.
(72) The active ingredients can be combined with the carrier in any convenient and practical manner, e.g., by admixture, solution, suspension, emulsification, encapsulation, absorption and the like, and can be made in formulations such as tablets, capsules, powder (including lyophilized powder), syrup, suspensions that are suitable for injections, ingestions, infusion, or the like. Sustained-release preparations can also be prepared.
(73) Methods of Treatment and Prevention
(74) In a further aspect, the glycan modified antibodies disclosed herein, optionally provided in pharmaceutically acceptable carrier, are employed for the treatment and prevention of HIV infection in a subject, as well as prevention of HIV transmission.
(75) The term “treatment” of HIV infection refers to effective inhibition of the HIV infection so as to delay the onset, slow down the progression, reduce viral load, and/or ameliorate the symptoms caused by HIV infection.
(76) The term “prevention of HIV infection” means the onset of HIV infection is delayed, and/or the incidence or likelihood of HIV infection is reduced or eliminated.
(77) The term “prevention of HIV transmission” means the incidence or likelihood of HIV being transmitted from one individual to another (e.g., from an HIV-positive woman to the child during pregnancy, labor or delivery, or breastfeeding; or from an HIV-positive subject to an HIV-negative partner) is reduced or eliminated.
(78) The term “subject” refers to any primate subject, including human and non-human subjects (e.g., rhesus subjects).
(79) To inhibit, treat and/or prevent HIV infection, a therapeutically effective amount of a glycan-modified antibody disclosed herein is administered to a subject in need.
(80) The term “therapeutically effective amount” means the dose required to effect an inhibition of HIV infection so as to treat and/or prevent HIV infection. The dosage of an antibody depends on the disease state and other clinical factors, such as weight and condition of the subject, the subject's response to the therapy, the type of formulations and the route of administration. The precise dosage to be therapeutically effective and non-detrimental can be determined by those skilled in the art. As a general rule, a suitable dose of an antibody for the administration to adult humans parenterally is in the range of about 0.1 to 20 mg/kg of patient body weight per day, once a week, or even once a month, with the typical initial range used being in the range of about 2 to 10 mg/kg. Since the antibodies will eventually be cleared from the bloodstream, re-administration may be required. Alternatively, implantation or injection of antibodies provided in a controlled release matrix can be employed.
(81) The antibodies can be administered to the subject by standard routes, including the oral, transdermal or parenteral (e.g., intravenous, intraperitoneal, intradermal, subcutaneous or intramuscular). In addition, the antibodies can be introduced into the body, by injection or by surgical implantation or attachment such that a significant amount of a desirable antibody is able to enter blood stream in a controlled release fashion.
(82) Sequence Listing
(83) SEQ ID NO: 1: the amino acid sequence of the human CD4 receptor (amino acids 1-25 representing a signal peptide, amino acids 26-122 constituting D1, and amino acids 123-205 constituting D2):
(84) TABLE-US-00001 MNRGVPFRHLLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKS IQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIK NLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESP PGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEF KIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAER ASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAG SGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSL KLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWS TPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLS EKKTCQCPHRFQKTCSPI
(85) SEQ ID NO: 2: the amino acid sequence of the heavy chain of MV1 (471 amino acids, including the first 19 amino acid residues constituting a leader sequence):
(86) TABLE-US-00002 MEWSGVFMFLLSVTAGVHSQVQLQQSGPEVVKPGASVKMSCKASGYTFT SYVIHWVRQKPGQGLDWIGYINPYNDGTDYDEKFKGKATLTSDTSTSTA YMELSSLRSEDTAVYYCAREKDNYATGAWFAYWGQGTLVTVSSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD KTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPASIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
(87) SEQ ID NO: 3: the amino acid sequence of the light chain of MV1 (238 amino acids, including the first 19 amino acids which constitute a leader sequence):
(88) TABLE-US-00003 MEWSGVFIFL LSVTAGVHSD IVMTQSPDSL AVSLGERVTM NCKSSQSLLY STNQKNYLAW YQQKPGQSPK LLIYWASTRE SGVPDRFSGS GSGTDFTLTI SSVQAEDVAV YYCQQYYSYR TFGGGTKLEI KRTVAAPSVF IFPPSDEQLK SGTASVVCLL NNFYPREAKV QWKVDNALQS GNSQESVTEQ DSKDSTYSLS STLTLSKADY EKHKVYACEV THQGLSSPVT KSFNRGEC
(89) SEQ ID NO: 4: the amino acid sequence of the Light chain of LM52:
(90) TABLE-US-00004 DIVMTQSPDSLAVSLGERVTMNCKSSQSLLYSTNQKNYLAWYQQKPGQS PKLLIYWANSTESGVPDRFSGSGSGTDFTLTISSVQAEDVAVYYCQQYY SYRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPR EAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV YACEVTHQGLSSPVTKSFNRGEC
(91) SEQ ID NO: 5—the amino acid sequence of the heavy chain of a modified MV1 with improved recycling of the antibody (452 amino acids with two modifications):
(92) TABLE-US-00005 QVQLQQSGPEVVKPGASVKMSCKASGYTFTSYVIHWVRQKPGQGLDWIG YINPYNDGTDYDEKFKGKATLTSDTSTSTAYMELSSLRSEDTAVYYCAR EKDNYATGAWFAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEFEGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHSHY TQKSLSLSPGK*
(93) The description of some specific embodiments provides sufficient information that others can, by applying current knowledge, readily modify or adapt for various applications such specific embodiments without departing from the generic concept, and, therefore, such adaptations and modifications should and are intended to be comprehended within the meaning and range of equivalents of the disclosed embodiments. It is to be understood that the phraseology or terminology employed herein is for the purpose of description and not of limitation. In the drawings and the description, there have been disclosed exemplary embodiments and, although specific terms may have been employed, they are unless otherwise stated used in a generic and descriptive sense only and not for purposes of limitation, the scope of the claims therefore not being so limited. Moreover, one skilled in the art will appreciate that certain steps of the methods discussed herein may be sequenced in alternative order or steps may be combined. Therefore, it is intended that the appended claims not be limited to the particular embodiment disclosed herein.
EXAMPLES
(94) Materials and Methods
(95) 1. Cell Lines, Reagents, and Pseudotyped Viruses
(96) TZM-b1 cells (catalog no. 8129) were obtained through the AIDS Research and Reference Reagent Program (ARRRP), Division of AIDS, NIAID, NIH. This is a genetically engineered HeLa cell line that expresses CD4, CXCR4, and CCR5 and contains Tat-responsive reporter genes for luciferase and β-galactosidase under the control of an HIV-1 long terminal repeat. The Standard Reference Panels of Subtype B HIV-1 Env clones from acute and early infections and Env-deficient backbone plasmid (SG3ΔEnv) were also obtained through the NIH ARRRP. HIV-1 env pseudotyped viruses were prepared by co-transfection of 293A cells (Invitrogen) with an Env-expression plasmid and SG3ΔEnv. Recombinant sCD4 comprising the full-length extracellular domain of human CD4 was obtained from Progenics Pharmaceuticals, Inc. (Tarrytown, N.Y.). Ibalizumab protein was provided by TaiMed Biologics (Irvine, Calif.). Plasmids pMV1 and pLC, which encode for ibalizumab H chain and L chain, respectively, were amplified from cDNA and cloned into pCDNA3.1 (+) (Invitrogen). N-acetylglucosaminyltransferase I-negative GnT1(−) human embryonic kidney (HEK) 293S cells were obtained from ATCC (catalog no. CRL-3022).
(97) 2. Addition of N-Linked Glycosylation Sites to the Anti-CD4 Antibody L Chain
(98) The Asn-Ala-Thr (LM30E, LM53, LM54, LM60, LM65, LM67, and LM76) or Asn-Ser-Thr (LM52) sequences were introduced by mutagenesis to create mutants at the light (L) chain of the anti-CD4 antibody such as WT ibalizumab or MV1. Mutagenesis was carried out with QUICKCHANGE mutagenesis kit (Stratagene, Santa Clara, Va.). The L (light) chain mutants (LM) constructs were generated from anti-CD4 IgG1 antibodies (such as MV1), and then were sequenced and transiently transfected into HEK293A cells (1:1 ratio of heavy and L chain plasmids) with polyethylenimine (PEI)-DNA complex. Supernatants were harvested on day 5 post transfection and LM proteins were purified with a protein-A agarose (Thermo Scientific, Rockford, Ill.) column. WT ibalizumab and LM30E, LM52, and LM53 were treated with PNGase F (New England Biolabs, Ipswich, Mass.) under denaturing conditions, before analysis by SDS-PAGE.
(99) 3. Virus Neutralization Assay Using TZM-b1 Cells
(100) Neutralization assay was performed based on the method of Wei et al..sup.37 with modifications.sup.38. Briefly, 10,000 cells per well were seeded in a 96-well plate in 100 μL/well of DMEM supplemented with 10% fetal bovine serum (D10) and incubated overnight. The next day, serially diluted ibalizumab or LM proteins were added to the cells and incubated for 1 h. Then, 200×50%-tissue-culture-infective-doses (TCID.sub.50) of replication-competent or pseudotyped HIV-1 were prepared in D10 containing DEAE-Dextran (Sigma, St. Louis, Mo.) and added to the cells. The cells were incubated for 48 h and β-galactosidase activity was measured using the Galacto-Star System (Applied Biosystems, Cedarville, Ohio). The percentage of inhibition of viral infectivity was calculated as 1 minus the ratio of antibody-treated wells versus untreated-infected wells multiplied by 100. The IC.sub.50 and IC.sub.80 values (the antibody concentrations that confer 50% and 80% neutralization, respectively) were calculated by a non-linear regression analysis.
(101) 4. Surface Plasmon Resonance
(102) Binding affinity analyses were performed with a BIACORE T3000 optical biosensor (GE Healthcare, Piscataway, N.J.). Immobilization of ibalizumab and all the glycan variants were performed following the standard amine coupling procedure. Briefly, carboxyl groups on the sensor chip surface were activated by injection of 35 μL of a solution containing 0.2 M N-(3-dimethylaminopropyl)-N-ethylcarbodiimide and 0.05 M Nhydroxysuccinimide at a flow rate of 5 μL/minute. Next, ibalizumab or its mutant variant, at a concentration of 2 μg/mL in 10 mM sodium-acetate buffer, pH 4.5, was allowed to flow over the chip surface at a rate of 10 μL/minute until the desired level of response units of reacted protein (150-200 RU) was achieved. After unreacted protein was washed out, excess active ester groups on the sensor surface were capped by the injection of 35 μL of 1 M ethanolamine, pH 8.0, at a flow rate of 5 μL/minute. As background to correct instrument and buffer artifacts, a reference was generated under the same conditions with omission of the protein ligand. Binding experiments were performed at 25° C. in HBS-EP buffer (0.01 M HEPES, 0.15M NaCI, 3 mM EDTA, 0.005% vol/vol surfactant P20 (GE Healthcare). Binding kinetics were measured by passing various concentrations of analyte (human sCD4 protein) over the chip surface at a flow rate of 30μL/minute for 3 min. Dissociation of bound analytes was monitored while the surface was washed for 10 min. Remaining analytes were removed at a flow rate of 50 μL/minute with two 30-sec injections of 10 mM glycine-HCI, pH 2.0. For kinetics data analysis, the kinetic parameters were determined by collectively fitting the overlaid sensograms locally using the BlAevaluation 4.1 software to the 1:1 Langmuir binding model.
(103) 5. Identification of N-Linked Glycosylation on LM52
(104) Three micrograms of LM52 protein was dissolved in 50 mM ammonium bicarbonate (ABC)/50% tetrafluoroethylene and reduced by adding 40 mM dithiothreitol (DTT). After incubation at 65° C. for 1 h, the protein samples were processed for alkylation by adding 40 mM iodoacetamide and incubating at room temperature for 1 h in the dark. The reaction was quenched by adding 40 mM DTT followed with 1 h incubation. Then 25 mM ABC was added before trypsin digestion. Protein samples were then treated with 0.2 μg trypsin (Promega) for overnight. The digested protein samples were dried and re-dissolved with 20 μL of water before LC-MS/MS analysis. For the assignment for N-glycans on antibodies, the measured masses of trypsin-digested antibody were compared to a database that combined predicted tryptic peptides and N-linked glycans. The assigned glycopeptides were confirmed by the appearance of glycan fragments in MS/MS spectra. For PNGasc digestion, LM52 was treated with PNGase F (New England Biolabs) overnight.
(105) 6. Statistical Analyses
(106) Differences in antibody potencies shown in Figures S2 and S3 were assessed by parametric (Students paired t-test) analyses of 50% and 80% inhibitory concentrations, using GraphPad Prism v5.03 software. Statistical significance was achieved if P≦0.05.
(107) Results
Example 1
(108) Sequence analysis of a panel of 118 viral isolates suggests that ibalizumab resistance was associated with the number of potential N-linked glycosylation sites (PNGS) in the V5 loop of gp120 (Pace et al., J. Acquir. Immune Defic. Syndr. Epub ahead of print: Sep. 2012). As shown in
(109) One wild-type virus (AC10.0.29) in the panel has two N-linked glycosylation sites in V5 and is naturally sensitive to ibalizumab. The V5 N-linked glycosylation sites in this virus were systematically deleted using site-directed mutagenesis, and the resulting mutant viruses became resistant to ibalizumab (see
(110) Another wild-type virus (RHPA4259.7) in the panel has no N-linked glycosylation site in V5 and is naturally resistant to ibalizumab. This virus was modified to systematically add N-linked glycosylation sites in V5. As shown in
(111) Analysis of superimposed crystal structures of ibalizumab, CD4 and HIV gp120 revealed that the V5 loop of gp120 is adjacent to the interaction site between the light chain of ibalizumab and CD4. Additional modeling analysis suggested that ibalizumab may normally inhibit HIV through steric hindrance, and that loss of a glycan on gp120 V5 may allow a virus to bypass this steric hindrance and escape the anti-HIV activity of ibalizumab. It was hypothesized in the present invention that addition of N-linked glycan sites onto ibalizumab at a region that is close to the gp120 V5 (for example near the N-terminus of V5) may allow the modified ibalizumab to neutralize viruses that are normally resistant to ibalizumab. The following experiments were conducted to verify this hypothesis.
(112) Based on the crystal structure of the ibalizumab-CD4 complex, several sites in the light chain of ibalizumab were selected based on their putatively close distance to the V5 of gp120. These include amino acid positions 30E, 67, 65, 52, 53, 54, 60, and 76—the numbering is based on the mature version of the light chain absent the 19 amino acid signal sequence (i.e., a leader sequence) and following the Kabat and Chothia Numbering Scheme which accounts for amino acid residues not accounted for in the original numbering. For example, position “30E” refers to the 5.sup.th amino acid in a stretch of amino acids (30A, 30B, 30C, 30D, 30E, . . . ) between the positions originally numbered as 30 and 31. Potential N-linked glycosylation sites were introduced at each of these positions. The mutant light chains all had higher molecular weights than the wild type light chain, suggesting the presence of an added glycan in these mutants. When the mutant light chains were treated with the deglycosylation agent, PNGase F, their molecular weights dropped to that of a normal ibalizumab wild type light chain. These data confirmed that N-linked glycosylation sites were indeed added to the mutant light chains.
Example 2
Design of Ibalizumab Variants
(113) Studies of ibalizumab-resistant HIV-1 strains revealed that resistance is mainly conferred by the loss of glycan(s) from the V5 loop of HIV-1 Env gp120. To further explore the role of V5 glycosylation in ibalizumab susceptibility, we modeled the interactions between gp120, CD4 and ibalizumab using the structures reported to the Protein Data Bank (accession number 2NXY and 302D). The V5 N-terminal glycan is situated closest to the ibalizumab L chain (
(114) We therefore introduced PNGS into residues (30E, 52, 53, 54, 60, 65, 67, and 76) in the variable region of the ibalizumab L chain that are proximal to the V5 loop of gp120. These ibalizumab L chain mutants (LMs) were constructed, sequenced, and transfected into 293A cells to produce mutant proteins. We purified the variant mAbs by protein-A agarose chromatography, and analyzed them by SDS-PAGE (
Example 3
CD4 Binding and HIV-1 Neutralization by LMs
(115) We next evaluated the kinetics of binding of these ibalizumab LMs to human soluble CD4 (sCD4) by surface plasmon resonance. In a Biacore assay using sCD4 as the analyte, WT ibalizumab and LMs bound sCD4 with similar binding kinetics. The K.sub.D of six of these LMs bound to sCD4 was in the range of 0.19 nM to 0.8 nM (Table 1), and these numbers were within 2-fold of the K.sub.D of wild-type ibalizumab (0.43 nM). These data showed that the addition of an N-linked glycan at these select locations in the L chain of ibalizumab did not markedly affect its ability to bind CD4.
(116) TABLE-US-00006 TABLE 1 The binding kinetics of ibalizumab and its LMs to human CD4 Antibody K.sub.on (10.sup.5/Ms) K.sub.off (10.sup.−5/s) K.sub.D (0.1 nM) ibalizumab 2.8 12 4.3 LM30E 1.1 15 14 LM52 4.6 16 3.5 LM53 2.9 13 4.5 LM54 3.7 27 7.3 LM60 4.4 8.3 1.9 LM65 3.3 49 15 LM67 2.5 20 8 LM76 5.0 14 2.8
(117) We next explored the HIV-1 neutralizing capacity of the LMs compared to WT ibalizumab. To this end, we tested the LMs against a panel of HIV-1 viruses that are resistant or partially resistant to ibalizumab, including 3 replication-competent HIV-1 strains (
(118) TABLE-US-00007 TABLE 2 Comparison of ibalizumab and its light chain mutants WT LM30E LM52 LM53 LM54 LM65 LM67 LM60 LM76 Mean MPI 75 98 98 99 93 93 91 75 78 (%) Distance (Å) 11.1 19.8 19.8 23.3 21.3 18.9 27.6 31.2 to V5 IC.sub.80 (μg/mL) 0.87 0.14 0.05 0.09 0.28 0.20 0.05 1.5 0.75 Geometric mean
Example 4
Glycan Size Influences LM52 Activity
(119) Whether glycan size influences the improved HIV-1 neutralization activity of the LMs was studied. The study was focused on LM52 because of its superior HIV-1 neutralization profile (
Example 5
Neutralization Breadth and Potency of LM52
(120) We then tested the HIV-1 neutralization activity of LM52 against a panel of 118 diverse HIV-1 viral strains covering 11 clades. LM52 showed significantly improved neutralization breadth and potency compared to WT ibalizumab in this single-cycle TZM-b1 assay (
(121) TABLE-US-00008 TABLE 3 In vitro neutralization profiles of ibalizumab and LM52 as expressed by IC.sub.50 (μg/mL), IC.sub.80 (μg/mL) and MPI (%) Ibalizumab LM52 IC.sub.50 IC.sub.80 MPI IC.sub.50 IC.sub.80 MPI Virus Clade (μg/ml) (μg/ml) (%) (μg/ml) (μg/ml) (%) 6535.3 B 0.01 0.05 99 0.012 0.034 100 QH0692.42 B 0.03 0.14 85 0.023 0.051 100 SC422661.8 B 0.04 >10 77 0.019 0.037 100 PVO.4 B 0.02 0.09 89 0.019 0.036 100 TRO.11 B 0.01 0.05 91 0.015 0.035 100 AC10.0.29 B 0.02 0.04 98 0.013 0.029 100 RHPA4259.7 B >10 >10 42 0.027 0.076 91 THRO4156.18 B 0.06 >10 78 0.022 0.062 99 REJO4541.67 B 0.02 0.37 82 0.015 0.043 99 TRJO4551.58 B 2.05 >10 62 0.01 0.027 100 WITO4160.33 B 0.02 0.43 83 0.013 0.036 100 CAAN5342.A2 B 0.01 0.03 100 0.013 0.028 100 WEAU_d15_410_5017 B (T/F) 0.02 10.00 80 0.019 0.043 100 1006_11_C3_1601 B (T/F) >10 >10 46 0.019 0.053 98 1054_07_TC4_1499 B (T/F) 0.03 >10 79 0.018 0.041 100 1056_10_TA11_1826 B (T/F) 0.01 0.02 98 0.013 0.031 100 1012_11_TC21_3257 B (T/F) 0.03 0.09 92 0.009 0.027 100 6240_08_TA5_4622 B (T/F) 0.02 0.05 99 0.0011 0.03 100 6244_13_B5_4576 B (T/F) 0.01 0.03 98 0.009 0.026 100 62357_14_D3_4589 B (T/F) 0.03 0.03 80 0.013 0.046 100 SC05_8C11_2344 B (T/F) 0.01 9.49 97 0.009 0.032 100 Du156.12 C 0.01 0.03 100 0.005 0.012 100 Du172.17 C 0.01 0.04 88 0.011 0.026 100 Du422.1 C 0.03 0.07 98 0.013 0.035 100 ZM197M.PB7 C 0.01 0.02 99 0.012 0.034 100 ZM214M.PL15 C 0.01 0.04 94 0.005 0.024 100 ZM233M.PB6 C 0.03 1.84 81 0.015 0.043 100 ZM249M.PL1 C 0.03 0.12 91 0.011 0.038 100 ZM53M.PB12 C 0.10 >10 77 0.022 0.051 100 ZM109F.PB4 C 3.90 >10 24 0.028 0.064 99 ZM135M.P10a C 0.10 >10 66 0.012 0.035 100 CAP45.2.00.G3 C 0.03 0.09 93 0.009 0.029 100 CAP210.2.00.E8 C 0.05 0.12 99 0.021 0.046 100 HIV-001428-2.42 C >10 >10 36 0.036 0.077 99 HIV-0013095-2.11 C 0.29 >10 59 0.035 0.075 100 HIV-16055-2.3 C 0.11 >10 76 0.02 0.053 100 HIV-16845-2.22 C 0.06 0.29 86 0.017 0.049 100 Ce1086_B2 C (T/F) 0.04 0.09 97 0.009 0.031 100 Ce0393_C3 C (T/F) 0.02 0.03 99 0.005 0.014 100 Ce1176_A3 C (T/F) 0.04 0.11 94 0.011 0.025 100 Ce2010_F5 C (T/F) 0.05 0.24 87 0.011 0.029 100 Ce0682_E4 C (T/F) 0.05 0.52 82 0.005 0.017 100 Ce1172_H1 C (T/F) 0.03 0.07 93 0.008 0.027 100 Ce2060_G9 C (T/F) >10 >10 41 0.012 0.031 100 Ce703010054_2A2 C (T/F) 9.01 >10 51 0.062 0.255 88 BF1266.431a C (T/F) 0.02 0.05 99 0.009 0.024 100 246F C1G C (T/F) 0.34 >10 71 0.021 0.049 100 249M B10 C (T/F) 0.03 0.10 94 0.007 0.02 100 ZM247v1(Rev-) C (T/F) 0.09 >10 74 0.028 0.061 100 7030102001E5(Rev-) C (T/F) 0.02 0.02 97 0.015 0.034 100 1394C9G1(Rev-) C (T/F) 0.02 0.05 97 0.014 0.026 100 Ce704809221_1B3 C (T/F) 0.16 >10 70 0.02 0.048 99 CNE19 BC 0.06 >10 78 0.027 0.059 100 CNE20 BC 0.03 0.06 92 0.019 0.041 100 CNE21 BC 0.08 0.32 89 0.035 0.074 100 CNE17 BC 0.04 0.15 86 0.015 0.038 100 CNE30 BC 0.10 >10 73 0.033 0.071 99 CNE52 BC 0.12 >10 69 0.017 0.037 100 CNE53 BC 3.36 >10 57 0.018 0.04 100 CNE58 BC 0.03 0.07 93 0.017 0.035 100 MS208.A1 A 0.03 0.07 99 0.029 0.063 100 Q23.17 A 3.40 >10 50 0.017 0.037 100 Q461.e2 A 0.05 0.54 82 0.018 0.035 100 Q769.d22 A >10 >10 34 0.019 0.052 99 Q259.d2.17 A 0.04 0.19 87 0.019 0.043 99 Q842.d12 A 0.02 0.09 93 0.009 0.023 100 0330.v4.c3 A 0.25 >10 64 0.028 0.078 97 0260.v5.c36 A 0.04 0.12 93 0.013 0.035 100 191955_A11 A (T/F) 0.04 0.09 96 0.023 0.052 100 191084 B7-19 A (T/F) 0.04 0.10 91 0.009 0.024 100 9004SS_A3_4 A (T/F) 0.04 0.13 88 0.021 0.048 100 T257-31 CRF02_AG 0.02 0.05 99 0.012 0.032 100 928-28 CRF02_AG 0.05 0.12 92 0.028 0.063 100 263-8 CRF02_AG 0.02 0.07 92 0.016 0.035 100 T250-4 CRF02_AG 0.02 0.06 97 0.023 0.052 100 T251-18 CRF02_AG 0.03 0.07 97 0.023 0.052 100 T278-50 CRF02_AG >10 >10 48 0.016 0.045 98 T255-34 CRF02_AG 0.90 >10 61 0.017 0.052 100 211-9 CRF02_AG 0.03 0.07 96 0.015 0.043 100 235-47 CRF02_AG 0.02 0.04 97 0.009 0.026 100 620345.c01 CRF01_AE 0.03 0.22 83 0.004 0.015 100 703357.c02 CRF01_AE 0.02 0.05 100 0.009 0.024 100 C1080.c03 CRF01_AE 0.03 0.12 84 0.009 0.029 100 R2184.c04 CRF01_AE 0.03 0.06 96 0.007 0.024 100 R1166.c01 CRF01_AE 0.02 0.05 97 0.006 0.017 100 R3265.c06 CRF01_AE 0.02 0.67 82 0.004 0.02 100 C2101.c01 CRF01_AE 0.04 0.08 97 0.014 0.037 100 C3347.c11 CRF01_AE 0.01 0.04 98 0.004 0.011 100 C4118.c09 CRF01_AE 0.04 0.09 92 0.01 0.034 100 CNE5 CRF01_AE 0.04 0.08 98 0.017 0.045 100 BJOX009000.02.4 CRF01_AE 0.03 0.10 92 0.011 0.031 100 (T/F) BJOX015000.11.5 CRF01_AE 0.03 0.13 88 0.006 0.036 100 (T/F) BJOX00000.06.2 CRF01_AE 0.02 0.04 99 0.007 0.019 100 (T/F) BJOX025000.01.1 CRF01_AE 0.02 0.06 97 0.014 0.031 100 (T/F) BJOX028000.10.3 CRF01_AE 0.01 0.22 90 0.004 0.019 100 (T/F) X1193_c1 G 0.03 0.06 99 0.005 0.012 100 PO402_c2_11 G 0.04 0.09 99 0.007 0.018 100 X1254_c3 G 0.13 >10 75 0.019 0.044 100 X2088_c9 G 0.07 >10 79 0.016 0.036 100 X2131_C1_B5 G 0.20 >10 57 0.017 0.056 99 P91981_C5_3 G 0.12 >10 73 0.013 0.029 100 X1632_S2_B10 G >10 >10 15 0.03 0.143 83 3016.v5.c45 D 0.07 0.13 93 0.022 0.041 100 A07412M1.vrc12 D 1.76 >10 57 0.013 0.035 99 231965.c01 D 0.10 >10 69 0.022 0.066 100 231966.c02 D 0.03 0.08 96 0.005 0.018 100 191821_E6_1 D (T/F) 0.10 >10 75 0.022 0.06 99 3817.v2.c59 CD 0.04 0.07 98 0.005 0.012 100 6480.v4.c25 CD 0.03 0.10 93 0.011 0.04 100 6952.v1.c20 CD 0.07 >10 71 0.019 0.051 100 6811.v7.c18 CD 0.16 >10 72 0.021 0.058 100 89-F1_2_25 CD 0.16 6.54 81 0.053 0.195 97 3301.v1.c24 AC 0.55 >10 63 0.012 0.032 100 6041.v3.c23 AC >10 >10 46 0.019 0.051 98 6540.v4.c1 AC 0.06 >10 74 0.017 0.047 100 6545.v4.c1 AC 0.23 >10 71 0.025 0.069 99 0815.v3.c3 ACD >10 >10 44 0.019 0.053 99 13103.v3.c10 ACD 0.03 0.07 98 0.009 0.024 100 Murine leukemia virus Control ND ND ND >10 >10 3
(122) Overall, the geometric mean IC.sub.50 value for LM52 was 14 ng/mL, compared to 74 ng/mL for WT ibalizumab, and the geometric mean IC.sub.80 value for LM52 was 37 ng/mL, compared to 510 ng/mL for WT ibalizumab (
(123) The improved activity of LM52 was also evident in a plot comparing its HIV-1 strain coverage across increasing antibody concentrations (
Example 6
Effects of Multiple Glycans
(124) We next examined the effect of placing two or three glycans in the region of interest in the ibalizumab L chain. We produced LM30E-52, LM30E-53, and LM52-67 double mutants, as well as LM30E-52-67 and LM30E-53-67 triple mutants in 293A cells and then purified and analyzed the antibodies by SDS-PAGE (
(125) TABLE-US-00009 TABLE 4 Comparison of the IC.sub.80 (μg/mL) of ibalizumab and its single, double, and triple LMs Virus ibalizumab LM52 LM30E-53 LM30E-52 LM52-67 LM30E-53-67 LM30E-52-67 RHPA4259 >10 0.03 0.02 0.10 0.02 0.06 0.23 SHIVsf162P3 >10 0.37 0.32 0.61 0.37 0.68 0.89 SHIVsf162P3N >10 >10 0.93 4.40 0.98 4.40 2.50 9015-07 A1 0.24 0.04 0.04 0.06 0.04 0.08 0.13 1051-D927 TD12 >10 0.05 0.09 0.09 0.04 0.32 0.32 Q769.d22 >10 0.13 0.15 0.29 0.11 0.47 0.49 16055-2.3 >10 0.04 0.06 0.08 0.05 0.13 0.24 246F C1G C >10 0.07 0.10 0.22 0.02 0.30 0.49 QG393.60M >10 0.05 0.05 0.07 0.04 0.10 0.11 ZM249M.PL1 0.22 0.05 0.06 0.12 0.05 0.10 0.13 Q259.d2.17 0.37 0.09 0.10 0.15 0.07 0.13 0.26 Q461.e2 0.61 0.09 0.10 0.14 0.09 0.16 0.18 Geometric Mean 3.20 0.10 0.09 0.18 0.07 0.22 0.31
Example 7
Analysis of LM52 Polyreactivity
(126) A property common to some HIV-1-neutralizing mAbs is their cross-reactivity with self-antigens.sup.29, 30. Neither LM52 nor ibalizumab bound to HEp-2 epithelial cell extracts (
CONCLUSION
(127) In the present invention, a superior HIV-1 entry-blocking mAb product generated from the MV1, called as the variant LM52, is provided, which at relatively low concentrations could neutralize all tested HIV-1 strains tested. The virus-neutralizing properties of LM52 were evidently superior to those of the wild type of ibalizumab as well as of a number of the best anti-Env mAbs reported to date, for example VRC01, PG9, 10E8, and NIH45-46G54W. Together with the established safety record of the ibalizumab in humans, these observations suggest that LM52 should be a good candidate for clinical development for the treatment or prevention of HIV-1. This modified antibody may be particularly suitable as a long-acting PrEP agent given its expected (based on the known pharmacokinetic properties of the parental ibalizumab) schedule of monthly administration.
(128) These findings also provide insight into the mechanism of action of ibalizumab. That HIV-1 loses a glycan in the N-terminus of gp120 V5 to become resistant to ibalizumab. It is suggested that the ibalizumab mechanism of action is mediated by the glycan resulting in a steric clash between the antibody L chain and the viral envelope glycoprotein, thereby sterically disrupting a step in HIV-1 entry. It is indicated in this invention that a glycan on the L chain restores the antiviral activity of ibalizumab against ibalizumab-resistant strains, that positioning this glycan on key residues spatially closest to V5 resulted in greatest antiviral effect, and that larger glycans conferred larger effects on virus neutralization collectively support that ibalizumab blocks HIV-1 infection via a steric hindrance mechanism.
(129) All publications and patents, patent application publications, and patent applications cited herein are hereby incorporated by reference to the same extent as if they had each been individually incorporated by reference.