BIOMARKERS FOR USE IN INTEGRIN THERAPY APPLICATIONS

20220049301 · 2022-02-17

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to biomarkers for use in determining the sensitivity of patients to therapy with αvβ6 integrin inhibition or therapy with TGF-β pathway inhibitors. The biomarker profiles disclosed herein provide individualized gene and protein profiles which will aid in treating diseases and disorders which are amenable to treatment with therapies designed against αvβ6-integrin and/or TGF-β pathway inhibitors.

Claims

1. A method for predicting whether a human subject who has an αvβ6-mediated disorder will respond to treatment with an αvβ6-integrin inhibitor, the method comprising: a) providing a biological sample obtained from the human subject after administration of the αvβ6-integrin inhibitor; and b) measuring the expression level of a gene or protein from Table 1 or a gene or protein from Table 2 in the biological sample, wherein: (i) an increase in the expression level of the gene or protein from Table 1 relative to a control expression level; or ii) a decrease in the expression level of the gene or protein from Table 2 relative to a control expression level, predicts that the human subject will respond, or has an increased likelihood of responding, to treatment with the αvβ6-integrin inhibitor.

2. The method of claim 1, further comprising determining the phosphorylation status of SMAD2 protein in the biological sample, wherein a decrease in the phosphorylation status of SMAD2 protein after administration of the αvβ6 integrin inhibitor is a further predictor that the human subject will respond, or has an increased likelihood of responding, to treatment with the αvβ6-integrin inhibitor.

3. The method of claim 1, wherein the method comprises measuring any combination of at least 6 genes or proteins from Table 1, Table 2, or Tables 1 and 2.

4. The method of claim 1, wherein a decrease in the expression level of at least one of arachidonate 5-lipoxygenase 5 (ALOX5), fibronectin (FN1), oxidized low density lipoprotein receptor 1 (OLR1), plasminogen activator inhibitor-1 (PAI-1 or SERPINE1), transglutaminase 2 (TGM2), or triggering receptor expressed on myeloid cells 1 (TREM1) in the biological sample is measured and predicts that the human subject will respond, or has an increased likelihood of responding, to treatment with the αvβ6-integrin inhibitor.

5. (canceled)

6. A method of treating an αvβ6-mediated disorder in a human subject in need thereof, the method comprising administering to the human subject a therapeutically effective amount of an αvβ6 integrin inhibitor, wherein the human subject has been identified as having at least one of: (i) a decreased expression level of a gene or protein from Table 1 in a biological sample obtained from the human subject, compared to a control expression level; or (ii) an increased expression level of a gene or protein from Table 2 in a biological sample obtained from the human subject, compared to a control expression level.

7. (canceled)

8. A method of treating an αvβ6-mediated disorder in a human subject in need thereof, the method comprising administering to the human subject a therapeutically effective amount of an αvβ6 integrin inhibitor, wherein the human subject has previously been administered the αvβ6 integrin inhibitor and has been identified as having at least one of: (i) an increased expression level of a gene or protein from Table 1 in a biological sample obtained from the human subject after the previous administration of the αvβ6 integrin inhibitor, compared to a control expression level; or (ii) a decreased expression level of a gene or protein from Table 2 in a biological sample obtained from the human subject after the previous administration of the αvβ6 integrin inhibitor, compared to a control expression level.

9. The method of claim 1, wherein the biological sample is a bronchoalveolar lavage sample.

10. The method of claim 1, wherein the biological sample is a tissue sample.

11-12. (canceled)

13. The method of claim 1, wherein the αvβ6-mediated disorder is fibrosis, psoriasis, sclerosis, cancer, acute lung injury, acute kidney injury, liver injury, scleroderma, transplant, or Alports Syndrome.

14. The method of claim 1, wherein the αvβ6-mediated disorder is lung fibrosis or kidney fibrosis.

15. The method of claim 1, wherein the αvβ6-mediated disorder is idiopathic pulmonary fibrosis, radiation induced fibrosis, bleomycin induced fibrosis, or asbestos induced fibrosis.

16. The method of claim 1, wherein the αvβ6-mediated disorder is a cancer selected from the group consisting of a pancreatic cancer, a lung cancer, a breast cancer, a prostate cancer, a colorectal cancer, a head and neck cancer, an esophageal cancer, a skin cancer, and an endometrial cancer.

17. The method of claim 1, wherein the αvβ6-integrin inhibitor is an anti-αvβ6-integrin antibody.

18. The method of claim 17, wherein the anti-αvβ6-integrin antibody has the same CDRs as an antibody produced by a hybridoma selected from the group consisting of: 6.1A8 (ATCC accession number PTA-3647); hybridoma 6.3G9 (ATCC accession number PTA-3649); 6.8G6 (ATCC accession number PTA-3645); 6.2E5 (ATCC accession number PTA-3897); 6.2B1 (ATCC accession number PTA-3646); 7.1G10 (ATCC accession number PTA-3898); 7.7G5 (ATCC accession number PTA-3899); and 7.105 (ATCC accession number PTA-3900).

19. The method of claim 17, wherein the anti-αvβ6-integrin antibody has the same CDRs as the antibody produced by the hybridoma deposited as 6.3G9 (ATCC accession number PTA-3649), except that the light chain CDR 1 contains an asparagine to serine substitution such that the light chain CDR 1 sequence is the sequence of SASSSVSSSYLY (SEQ ID NO:1196).

20. The method of claim 17, wherein the anti-αvβ6-integrin antibody comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 1210.

21. The method of claim 20, wherein the anti-αvβ6-integrin antibody further comprises a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 1211.

22-23. (canceled)

24. A biomarker panel comprising a probe for each of ALOX5, FN1, OLR1, SERPINE1, TGM2, and TREM1 and no additional genes or proteins other than one or more of the genes or proteins listed in Table 1 and Table 2.

25-27. (canceled)

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0080] FIG. 1 is a graphical representation of the expression of the ratio of phosphorylated SMAD2 (pSMAD2) protein relative to total SMAD2 protein in BAL cells isolated from cynomolgus monkeys after 8-weekly doses of STX-100 treatment relative to circulating levels of STX-100 in serum after the last (8th) weekly dose of antibody (area under the curve (AUC) ug*hr/ml). Data are shown for individual animals in vehicle and 0.1, 0.3, 1.0, 3.0, and 10 mg/kg STX-100 treatment groups. pSMAD2 and total SMAD2 levels were determined by ELISA analysis.

[0081] FIG. 2A is a graphical representation of the expression of ALOX5 mRNA in BAL cells isolated from cynomolgus monkeys after 8-weekly doses of STX-100 treatment relative to circulating levels of STX-100 in serum after the last (8th) weekly dose of antibody (area under the curve (AUC) ug*hr/ml). Data are shown for individual animals in vehicle and 0.1, 0.3, 1.0, 3.0, and 10 mg/kg STX-100 treatment groups. Gene expression was determined by Taqman® gene expression analysis.

[0082] FIG. 2B is a graphical representation of the expression of OLR1 mRNA in BAL cells isolated from cynomolgus monkeys after 8-weekly doses of STX-100 treatment relative to circulating levels of STX-100 in serum after the last (8th) weekly dose of antibody (area under the curve (AUC) ug*hr/ml). Data are shown for individual animals in vehicle and 0.1, 0.3, 1.0, 3.0, and 10 mg/kg STX-100 treatment groups. Gene expression was determined by Taqman® gene expression analysis.

[0083] FIG. 2C is a graphical representation of the expression of Serpine1 mRNA in BAL cells isolated from cynomolgus monkeys after 8-weekly doses of STX-100 treatment relative to circulating levels of STX-100 in serum after the last (8th) weekly dose of antibody (area under the curve (AUC) ug*hr/ml). Data are shown for individual animals in vehicle and 0.1, 0.3, 1.0, 3.0, and 10 mg/kg STX-100 treatment groups. Gene expression was determined by Taqman® gene expression analysis.

[0084] FIG. 2D is a graphical representation of the expression of TGM2 mRNA in BAL cells isolated from cynomolgus monkeys after 8-weekly doses of STX-100 treatment relative to circulating levels of STX-100 in serum after the last (8th) weekly dose of antibody (area under the curve (AUC) ug*hr/ml). Data are shown for individual animals in vehicle and 0.1, 0.3, 1.0, 3.0, and 10 mg/kg STX-100 treatment groups. Gene expression was determined by Taqman® gene expression analysis.

[0085] FIG. 3 is a bar graph showing the expression level of Cathepsin L mRNA in mouse BAL macrophage cells following treatment with 3G9.

[0086] FIG. 4 is a bar graph showing the expression level of Legumain mRNA in mouse BAL macrophage cells following treatment with 3G9.

[0087] FIG. 5 is a bar graph showing the expression level of PAI-1 (also known as Serpine1) mRNA in mouse BAL macrophage cells following treatment with 3G9.

[0088] FIG. 6 is a bar graph showing the expression level of Osteopontin mRNA in mouse BAL macrophage cells following treatment with 3G9.

[0089] FIG. 7 is a bar graph showing the expression level of TREM-1 mRNA in mouse BAL macrophage cells following treatment with 3G9.

[0090] FIG. 8 is a bar graph showing the expression level of MMP-19 mRNA in mouse BAL macrophage cells following treatment with 3G9.

[0091] FIG. 9 is a bar graph showing the expression level of ALCAM mRNA in mouse BAL macrophage cells following treatment with 3G9.

DETAILED DESCRIPTION OF THE INVENTION

[0092] The identification of biomarkers that will provide rapid and accessible readouts of efficacy, drug exposure, or clinical response is increasingly important in the clinical development of drug candidates. In the present invention, the inventors have identified specific biomarkers that can be used to tailor therapy with an anti αvβ6-inhibitor such as an anti αvβ6-integrin antibody in the treatment of, for example lung injury. Embodiments of the invention include measuring changes in the expression levels of specific biomarkers that are responsive to treatment with an anti αvβ6-inhibitor such as an αvβ6-integrin antibody. In one aspect, bronchoalveolar lavage samples from subjects that are to be treated with the antibody are used for biomarker analysis.

[0093] This invention provides methods for predicting responsiveness to a αvβ6-integrin inhibitor in a subject suffering from a disorder, and methods for selecting a treatment regimen with an inhibitor of αvβ6-integrin, based on expression of particular biomarkers in the subject to be treated. The invention is based, at least in part, on the observation that altered expression of particular biomarkers in a subject suffering from lung fibrosis is associated with increased or decreased responsiveness to therapy with an anti-αvβ6-integrin antibody. Microarray analysis, and other nucleic acid analyses were used to examine normal subjects and subjects suffering from fibrosis, who were categorized as being responsive to treatment with an antibody (responders) or nonresponsive to treatment with an anti-αvβ6-integrin antibody (nonresponders). While the initial determination is made based on lung fibrosis models, it is contemplated that the markers may be useful in the treatment of other diseases, including but not limited to fibrosis, psoriasis, sclerosis, cancer, acute lung injury, renal injury, liver injury, scleroderma, transplant or Alports Syndrome, and the like. A list of additional diseases that may be treated include those listed in U.S. Pat. Nos. 7,465,449, 7,943,742, 8,153,126, and 7,927,590 each incorporated herein by reference in its entirety for the disclosure therein of disease states to be treated with αvβ6-integrin antibody related therapy.

[0094] A panel of genes were identified whose expression was altered (up-regulated (Table 1) or downregulated (Table 2)) in animals treated with the antibody, demonstrating the ability of these genes to act as biomarkers for predicting responsiveness to αvβ6-integrin inhibitor treatment. In particular, ALOX5, FN1, OLR1, SERPINE1, TGM2, TREM1, ENPP1, IGSF2, and GPR82 which are each down-regulated by administration of an anti-αvβ6 integrin specific antibody were identified as particularly useful in predicting the future response to αvβ6-integrin treatment. Accordingly, in specific embodiments, the expression pattern of one or more biomarkers which particularly include one or more, two, three, four, five, six, seven, eight, or nine of the above 9 genes (e.g., ALOX5, FN1, OLR1, SERPINE1, TGM2, and TREM1) can be assessed in subjects for which αvβ6-inhibitor therapy is being considered, or subjects suffering from other disorders amenable to modulation with αvβ6-integrin inhibition therapy, to thereby predict responsiveness of the subject to such therapy and/or to aid in the selection of an appropriate treatment regimen.

[0095] As used herein, the term “treatment regimen” is intended to refer to one or more parameters selected for the treatment of a subject, e.g., with a αvβ6 integrin inhibitor, which parameters can include, but are not necessarily limited to, the type of agent chosen for administration, the dosage, the formulation, the route of administration and the frequency of administration.

[0096] Using such tissue, cell, or fluid samples to assess gene expression before and after treatment with the anti-αvβ6-integrin antibody or small molecule inhibitor therapy, the inventors identified specific biomarkers that respond to anti-αvβ6-integrin therapy or small molecule inhibitor of −αvβ6-integrin activity. These biomarkers can be employed for predicting response to one or more αvβ6-integrin modulators and indeed for modulating the effects of modulators of the TGFβ signaling pathway. In one aspect, the biomarkers of the invention are those provided in Table 1 and Table 2 and the Sequence Listing, including both polynucleotide and polypeptide sequences. The invention also includes nucleotide sequences that hybridize to the polynucleotides provided in Table 1 and Table 2. The biomarkers in Table 1 are those that were found to be up-regulated, or increased in response to administration of an anti-αvβ6-integrin antibody, and the biomarkers shown in Table 2 are downregulated or decreased in response to administration of an αvβ6-antibody.

[0097] The biomarkers have expression levels in cells that are highly correlated with sensitivity to anti-αvβ6-antibody exhibited by the cells. Hence, these biomarkers serve as useful molecular tools for predicting the likelihood of a response to inhibition of αvβ6-integrin activity, preferably with anti-αvβ6-integrin antibodies but may also be predictive of efficacy of small molecule inhibitors of αvβ6-integrin activity. As αvβ6-integrin activity has been shown to influence TGFβ signaling pathway, the biomarkers identified herein also will be useful in predicting efficacy of modulators of the TGFβ signaling pathway.

[0098] Furthermore, the biomarker expression patterns described herein also can be used in monitoring a disorder in a subject, e.g., monitoring the responsiveness of the subject to a particular therapy or assisting in the diagnosis or prognosis of the disorder (e.g., fibrosis) in the subject.

[0099] The term “predicting responsiveness to a αvβ6 integrin inhibitor”, as used herein, is intended to refer to an ability to assess the likelihood that treatment of a subject with a αvβ6 integrin inhibitor will or will not be effective in (e.g., provide a measurable benefit to) the subject. In particular, such an ability to assess the likelihood that treatment will or will not be effective typically is exercised before treatment with the αvβ6 integrin inhibitor is begun in the subject. However, it is also possible that such an ability to assess the likelihood that treatment will or will not be effective can be exercised after treatment has begun but before an indicator of effectiveness (e.g., an indicator of measurable benefit) has been observed in the subject. Thus, genes identified herein in Table 1 and Table 2 and their alterations (i.e., up-regulation or down-regulation) in response to such therapy will be useful as surrogate biomarkers for clinical efficacy of such therapy.

[0100] The term “αvβ6 integrin inhibitor” as used herein is intended to encompass agents including proteins, antibodies, antibody fragments, fusion proteins (e.g., Ig fusion proteins or Fc fusion proteins), small molecule αvβ6 integrin antagonists and similar naturally- or nonnaturally-occurring molecules, and/or recombinant and/or engineered forms thereof, that, directly or indirectly, inhibit αvβ6 integrin activity, such as by inhibiting interaction of αvβ6 integrin with a cell surface receptor for αvβ6 integrin, inhibiting αvβ6 integrin protein production, inhibiting αvβ6 integrin gene expression, inhibiting αvβ6 integrin secretion from cells, inhibiting αvβ6 integrin receptor signaling or any other means resulting in decreased αvβ6 integrin activity in a subject. The term “αvβ6 integrin inhibitor” also includes agents which interfere with αvβ6 integrin activity or expression. For example, particular αvβ6 integrin inhibitors may include nucleic acid or chemical based inhibitors of expression, such as for example, RNAi molecules, siRNA molecules, micro-RNA molecules (e.g., inhibitors of RNAs and mimetics of microRNA), as well as longer antisense nucleic acid molecules. Examples of αvβ6 integrin inhibitors include the antibodies described and disclosed in e.g., U.S. Pat. Nos. 7,465,449, 7,943,742, 8,153,126, and 7,927,590 each incorporated herein by reference in its entirety for the disclosure therein of specific antibodies and variants thereof, modulators of αvβ6 integrin activity, and related methods of production.

[0101] The term “antibody” as referred to herein includes whole antibodies and any antigen binding fragment (i.e., “antigen-binding portion”) or single chains thereof. An “antibody” refers to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system. Preferred sequences for the CDRs of the antibodies for use in the present invention include those described in U.S. Pat. No. 7,465,449. For example, the CDR sequences are as follows:

TABLE-US-00001 TABLE A Antibody Amino Acid Sequence SEQ ID NO Heavy Chain CDR1 8G6 SYTFTDYAMH 1176 1A8 SYTFTDYTMH 1177 2BI GFTFSRYVMS 1178 3G9 GFTFSRYVMS 1178 2AI GYDFNNDLIE 1180 2G2 GYAFTNYLIE 1181 Heavy Chain CDR2 8G6 VISTYYGNTNYNQKFKG 1182 1A8 VIDTYYGKTNYNQKFEG 1183 2BI SISSG-GSTYYPDSVKG 1184 3G9 SISSG-GRMYYPDTVKG 1185 2AI VINPGSGRTNYNEKFKG 1186 2G2 VISPGSGHNYNEKFKG 1187 Heavy Chain CDR3 8G6 GGLRRGDRPSLRYAMDY 1188 1A8 GGFRRGDRPSLRYAMDS 1189 2BI GAIYDG-----YYVFAY 1190 3G9 GSIYDG-----YYVFPY 1191 2AI IYYGPH-----SYAMDY 1192 2G2 ID-YSG-----PYAVDD 1193 Light Chain CDR 1 8G6 RASQSVSTSS-YSYMY 1194 1A8 RASQSVSIST-YSYIH 1195 2BI SASSSVSSS-----YLY 1196 3G9 SANSSVSSS-----YLY 1197 2AI KASLDVRTAVA 1198 2G2 KASQAVNTAVA 1199 Light Chain CDR 2 8G6 YASNLES 1200 1A8 YASNLES 1200 2BI STSNLAS 1202 3G9 STSNLAS 1202 2AI SASYRYT 1179 2G2 SASYQYT 1201 Light Chain CDR 3 8G6 QHNWEIPFT 1203 1A8 QHSWEIPYT 1204 2BI HQWSSYPPT 1205 3G9 HQWSTYPPT 1206 2AI QQHYGIPWT 1207 2G2 QHHYGVPWT 1208

[0102] In the above sequences, for the 8G6 heavy chain CDR 3 sequence, the sequence also may be modified in that the “R” in position 12 can for example be Q, such that the sequence is: GGLRRGDRPSLQYAMDY (SEQ ID NO:1209). Further it may be desirable in certain embodiments that the light chain CDR 1 sequence of the 3G9 antibody be modified to SASSSVSSSYLY (SEQ ID NO:1196).

[0103] The term “antigen-binding portion” of an antibody (or simply “antibody portion”), as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term “antigen-binding portion” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment, which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR). Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv). Such single chain antibodies are also intended to be encompassed within the term “antigen-binding portion” of an antibody. Also encompassed within the term “antigen-binding portion” of an antibody are sc(Fv)2 and diabodies. These antibody fragments are obtained using conventional techniques known to those with skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.

[0104] The terms “monoclonal antibody” or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.

[0105] The terms “chimeric antibody” or “chimeric monoclonal antibody” are intended to refer to antibodies in which the variable region sequences are derived from one species and the constant region sequences are derived from another species, such as an antibody in which the variable region sequences are derived from a mouse antibody and the constant region sequences are derived from a human antibody. Such “chimeric antibodies” can be prepared by standard recombinant technology well established in the art. For example, a nucleic acid encoding a VH region from a mouse antibody can be operatively linked to a nucleic acid encoding the heavy chain constant regions from a human antibody and, likewise, a nucleic acid encoding a VL region from a mouse antibody can be operatively linked to a nucleic acid encoding the light chain constant region from a human antibody.

[0106] The terms “humanized antibody” or “humanized monoclonal antibody” are intended to refer to antibodies in which CDR sequences derived from the germline of a non-human mammalian species, such as a mouse, have been grafted onto human framework sequences. Additional framework region modifications may be made within the human framework sequences. Such “humanized antibodies” can be prepared by standard recombinant technology well established in the art. For example, nucleic acids encoding the CDR1, CD2 and CDR3 regions from a VH region of a mouse antibody can be operatively linked to nucleic acids encoding the FR1, FR2, FR3 and FR4 regions of a human VH region, and the entire “CDR-grafted” VH region can be operatively linked to nucleic acid encoding the heavy chain constant regions from a human antibody. Likewise, nucleic acids encoding the CDR1, CD2 and CDR3 regions from a VL region of a mouse antibody can be operatively linked to nucleic acids encoding the FR1, FR2, FR3 and FR4 regions of a human VL region, and the entire “CDR-grafted” VL region can be operatively linked to nucleic acid encoding the light chain constant region from a human antibody. Preferred humanized antibodies for use in the present invention are described in U.S. Pat. No. 7,943,742. Preferably, the humanized antibody used in the methods of the invention is one that comprises the heavy and light chain CDRs 1, 2, and 3 from murine antibody 3G9. More preferably, the light chain CDR1 of murine antibody 3G9 is employed in the humanized antibody, wherein the humanized 3G9 antibody contains a light chain variable domain wherein the CDR1 region contains an asparagine (N) to serine (S) substitution at residue 3 of CDR 1 of the light chain (SEQ ID NO:1197 showing wild-type sequence of light chain CDR 1, whereas the humanized sequence would be: SASSSVSSSYLY (SEQ ID NO:1196). An exemplary such humanized antibody (referred to herein as STX-100) for use in the present invention is an antibody that has a heavy chain sequence of:

TABLE-US-00002 (SEQ ID NO: 1210) EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYVVMSWVRQAPGK GLEWVASISSGGRMYYPDTVKGRFTISRDNAKNSLYLQMNSLRAED TAVYYCARGSIYDGYYVFPYWGQGTLVTVSS
and a light chain sequence of:

TABLE-US-00003 (SEQ ID NO: 1211) EIVLTQSPATLSLSPGERATLSCSASSSVSSSYLYWYQQKPGQAPRLLIY STSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQWSTYPPTFG GGTKVEIK

[0107] The biomarker profiles identified herein also may be used to identify mammals that will be responsive to small molecule inhibitors of αvβ6-integrin. It should be understood that small molecules can have any molecular weight. They are merely called small molecules because they typically have molecular weights less than 450 daltons. Small molecules include compounds that are found in nature as well as synthetic compounds. In one embodiment, the αvβ6-integrin-modulator or modulator of TGFβ signaling (see e.g., Akhurst, Curr. Opin. Investig. Drugs, 7(6):513-21 (2006); Hawinkels, Growth Factors, 29(4):140-52 (2011) is a small molecule that inhibits the growth of tumor cells that express αvβ6-integrin. In another embodiment, the small molecule is one that inhibits the growth of refractory tumor cells that express αvβ6-integrin.

[0108] As used herein, the term “biomarker” is intended to encompass a substance that is used as an indicator of a biologic state and includes genes (and nucleotide sequences of such genes), mRNAs (and nucleotide sequences of such mRNAs) and proteins (and amino acid sequences of such proteins) and post-translationally modified forms of proteins (i.e. phosphorylated and non-phosphorylated forms). A “biomarker expression pattern” is intended to refer to a quantitative or qualitative summary of the expression of one or more biomarkers in a subject, such as in comparison to a standard or a control.

[0109] The terms “increased” or “increased expression” and “decreased” or “decreased expression”, with respect to the expression pattern of a biomarker(s), are used herein as meaning that the level of expression is increased or decreased relative to a constant basal level of expression of a household, or housekeeping, gene, whose expression level does not significantly vary under different conditions. A non-limiting example of such a household, or housekeeping, gene is GAPDH. Other suitable household, or housekeeping, genes are well-established in the art.

[0110] The invention includes individual biomarkers and biomarker sets having both diagnostic and prognostic value in disease areas which are amenable to treatment with an agent that inhibits αvβ6-integrin activity, an anti-αvβ6-integrin antibody or a modulator of TGFβ signaling. The biomarker sets comprise a plurality of biomarkers such as, for example, a plurality of the biomarkers provided in Table 1 and Table 2 that are highly correlated with sensitivity or efficacy to one or more αvβ6-integrin modulators, such as αvβ6-integrin-specific antibodies.

[0111] The biomarkers and biomarker sets of the invention can be used to predict or provide a prognosis of the likely effect of one or more αvβ6-integrin modulators in different biological systems or for cellular responses. The biomarkers and biomarker sets can be used in in vitro assays of αvβ6 antibodies response by test cells to predict in vivo outcome. In accordance with the invention, the various biomarkers and biomarker sets described herein, or the combination of these biomarker sets with other biomarkers or markers, can be used, for example, to predict how patients with an αvβ6-integrin related disease might respond to therapeutic intervention with one or more αvβ6-integrin-specific antibodies.

[0112] A biomarker and biomarker set of cellular gene expression patterns correlating with sensitivity or resistance of cells following exposure of the cells to one or more αvβ6-specific antibodies provides a useful tool for screening one or more tissue or cell samples from a subject before treatment with the αvβ6-integrin specific antibodies. The screening allows a prediction of cells of a patient's sample exposed to one or more αvβ6-integrin-specific antibodies, based on the expression results of the biomarker and biomarker set, as to whether or not the biological sample, and hence a patient harboring a disease such as, e.g., fibrosis (e.g., IPF), psoriasis, sclerosis, cancer, acute lung injury, liver injury, scleroderma, transplant, or Alports Syndrome, will or will not respond to treatment with the αvβ6-integrin-specific antibodies.

[0113] The biomarker or biomarker set can also be used to monitor the progress of disease treatment or therapy in those patients undergoing treatment for a disease involving an αvβ6-integrin-specific antibody.

[0114] The biomarkers also serve as targets for the development of therapies for disease treatment. Such targets may be particularly applicable to treatment of lung fibrosis. Indeed, because these biomarkers are differentially expressed in samples that are sensitive and resistant to therapy, the expression patterns of these biomarkers are correlated with relative intrinsic sensitivity of cells to treatment with αvβ6-integrin-specific antibodies.

[0115] The level of biomarker protein and/or mRNA can be determined using methods well known to those skilled in the art. For example, quantification of protein can be carried out using methods such as ELISA, 2-dimensional SDS PAGE, Western blot, immunopreciptation, immunohistochemistry, fluorescence activated cell sorting (FACS), or flow cytometry. Quantification of mRNA can be carried out using methods such as PCR, array hybridization, sequencing, Northern blot, in-situ hybridization, dot-blot, Taqman, or RNAse protection assay.

[0116] Microarrays. The invention also includes specialized microarrays, e.g., oligonucleotide microarrays or cDNA microarrays, comprising one or more biomarkers of Table 1 and Table 2, showing expression profiles that correlate with increased or decreased expression in response to αvβ6-integrin-specific antibodies. Such microarrays can be employed in in vitro assays for assessing the expression level of the biomarkers in the test cells from patients before and after treatment, and determining whether the expression of the biomarkers has been changed as a result of the treatment such that where expression of the biomarkers in Table 1 is increased and/or where there is a decrease in the expression of the biomarkers of Table 2 there is an indication of therapeutic efficacy of the antibody in the subject from whom the sample is isolated.

[0117] For example, a specialized microarray can be prepared using all the biomarkers, or subsets thereof (e.g., ALOX5, FN1, OLR1, PAI-1, TGM2, TREM1), as described herein and shown in Table 1 and Table 2. Cells from a tissue or organ biopsy can be isolated and exposed to one or more of αvβ6-integrin-specific antibodies. In one aspect, following application of nucleic acids isolated from both untreated and treated cells to one or more of the specialized microarrays, the pattern of gene expression of the tested cells can be determined and compared with that of the biomarker pattern from the control panel of cells used to create the biomarker set on the microarray. Based upon the gene expression pattern results from the cells that underwent testing, it can be determined if the biological sample is taken from a subject that will be responsive to the therapy using that profile of gene expression. Whether or not the tested cells from a tissue or organ biopsy will respond to one or more of the αvβ6-integrin-specific antibodies and the course of treatment or therapy can then be determined or evaluated based on the information gleaned from the results of the specialized microarray analysis.

[0118] Antibodies. The invention also includes antibodies, including polyclonal or monoclonal, directed against one or more of the polypeptide biomarkers. Such antibodies can be used in a variety of ways, for example, to purify, detect, and target the biomarkers of the invention, including both in vitro and in vivo diagnostic, detection, screening, and/or therapeutic methods.

[0119] Kits. The invention also includes kits for determining or predicting whether a patient would be susceptible or resistant to a treatment that comprises one or more αvβ6-integrin-specific antibodies. The patient may have a disorder such as, for example, fibrosis, psoriasis, sclerosis, cancer, acute lung injury, renal injury, liver injury, scleroderma, transplant, or Alports Syndrome. Such kits would be useful in a clinical setting for use in testing a patient's biopsied samples, for example, to determine or predict if the patient will be resistant or sensitive to a given treatment or therapy with αvβ6-integrin-specific antibodies. The kit comprises a suitable container that comprises: one or more microarrays, e.g., oligonucleotide microarrays or cDNA microarrays, that comprise those biomarkers that correlate with increased or decreased expression in response to αvβ6-integrin-specific antibodies; one or more αvβ6-integrin-specific antibodies for use in testing cells from patient tissue specimens or patient samples; and instructions for use. In addition, kits contemplated by the invention can further include, for example, reagents or materials for monitoring the expression of biomarkers of the invention at the level of mRNA or protein, using other techniques and systems practiced in the art such as, for example, RT-PCR assays, which employ primers designed on the basis of one or more of the biomarkers described herein, immunoassays, such as enzyme linked immunosorbent assays (ELISAs), immunoblotting, e.g., Western blots, or in situ hybridization, mRNA sequencing, and the like.

[0120] Application of Biomarkers and Biomarker Sets. The biomarkers and biomarker sets may be used in different applications. A “biomarker set” can be built from any combination of biomarkers listed in Table 1 and/or Table 2 and used to make predictions about the effect of αvβ6-integrin-specific antibodies in different biological systems, for efficacy and responsiveness of lung injury to such antibodies. The various biomarkers and biomarkers sets described herein can be used, for example, as diagnostic or prognostic indicators in lung disease management, to predict how patients with such diseases might respond to therapeutic intervention with αvβ6-integrin-specific antibodies, and to predict how patients might respond to therapeutic intervention that modulates signaling through the entire TGFβ pathway.

[0121] The biomarkers have both diagnostic and prognostic value in diseases areas in which signaling through TGFβ is of importance.

[0122] In one aspect, the invention pertains to a method for predicting responsiveness to a αvβ6 integrin inhibitor in a subject having disease that would be amenable to treatment with the an anti-αvβ6 integrin antibody. Typically, the method comprises (i) assaying the subject for the expression of one or more biomarkers predictive of responsiveness to a αvβ6 integrin inhibitor in a disorder, and (ii) predicting responsiveness of the subject to the αvβ6 integrin inhibitor based on expression of the one or more biomarkers in the subject. As used herein, the term “one or more biomarkers” is intended to mean that at least one biomarker in a disclosed list of biomarkers is assayed and, in various embodiments, more than one biomarker set forth in the list may be assayed, such as two, three, four, five, ten, twenty, thirty, forty, fifty, more than fifty, or all the biomarkers in the list may be assayed. Further the diagnostic methods of the invention may be combined with assays that determine the phosphorylation status of SMAD2. Such assays would involve determination of SMAD2 phosphorylation status in response to administration of an αvβ6 integrin inhibitor wherein phosphorylation of SMAD2 is indicative of TGFβ activation and a decrease in that phosphorylation status in response to administration of an αvβ6 integrin inhibitor is indicative of inhibition of TGFβ activity. The methods described herein can further be combined with assays that determine the expression level (e.g., mRNA, protein) in peripheral blood or BAL of one or more (e.g., one, two, three, four, five, six, seven) serum biomarker such as, but not limited to, tissue remodeling markers (e.g., metalloproteinase 7 (MMP-7), osteopontin (OPN)); TGF-8 inducible proteins (e.g., tissue inhibitor of metalloproteinase 1 (TIMP-1), collagen type 1alpha1 (Col1A1)); and epithelial injury markers (e.g., surfactant A (SP-A), alpha defensins (DEFA1-3)). Blood samples for serum biomarkers can be collected prior to (baseline) and after administration (post-treatment) of the αvβ6 inhibitor (e.g., STX-100). In one embodiment, differential expression of the serum biomarkers can be measured as the difference from baseline to post-treatment value for serum biomarkers compared between αvβ6 inhibitor treated patients and placebo treated patients. A decrease in the expression of these biomarkers post-treatment is indicative that the subject will, or is highly likely to, respond to the αvβ6 inhibitor (e.g., STX-100) therapy or anti-TGFβ treatment.

[0123] In one aspect, cells or fluid from a patient, e.g., from bronchoalveolar lavage, or tissue or even a tissue biopsy, can be assayed to determine the expression pattern of one or more biomarkers prior to treatment with one or more αvβ6-integrin-specific antibodies, small molecule inhibitors of αvβ6-integrin activity, or indeed modulators of TGFβ signaling. In one aspect, the disease is for example, fibrosis (e.g., IPF), psoriasis, sclerosis, cancer (e.g., a pancreatic cancer, a lung cancer, a breast cancer, a colorectal cancer, a head and neck cancer, an esophageal cancer, a skin cancer, and an endometrial cancer), acute lung injury, renal injury, liver injury, scleroderma, transplant, or Alports Syndrome. Success or failure of a treatment can be determined based on the biomarker expression pattern of the sample from the test tissue (test cells or fluid), e.g., sample from a bronchoalveolar lavage, as being relatively similar or different from the expression pattern of a control set of the one or more biomarkers. Thus, if the test sample shows a biomarker expression profile which corresponds to that of the biomarkers in the control panel but which are increased or decreased as a result of the treatment with αvβ6-integrin specific antibody or small molecule inhibitor of αvβ6-integrin activity, it is highly likely or predicted that the individual's disease will respond favorably to treatment with the αvβ6-integrin-specific antibodies, thereby allowing the clinician to identify the subjects that are likely to be responders to the therapeutic regiment. By contrast, if the test cells show a biomarker expression pattern in which the biomarkers of Table 1 are not increased or the biomarkers or Table 2 are not decreased in response to the αvβ6-integrin antibody or small molecule inhibitor of αvβ6-integrin activity, it is highly likely or predicted that the individual will not respond to treatment with agents that are TGFβ modulators, anti-αvβ6-integrin antibodies, or small molecules that inhibit the activity of αvβ6-integrin.

[0124] The invention also provides a method of monitoring the treatment of a patient having a disease treatable by one or more αvβ6-integrin antibodies, a small molecule inhibitor of αvβ6-integrin activity or a TGFβ modulator. The isolated test cells from the patient's tissue sample, e.g., tissue or cell sample from any of the disease states mentioned herein and in specific embodiments, e.g., a BAL sample, can be assayed to determine the expression pattern of one or more biomarkers before and after exposure to the αvβ6-integrin inhibiting agent wherein, preferably, the agent is an anti-αvβ6-integrin antibody. The resulting biomarker expression profile of the test sample before and after treatment is compared with that of one or more biomarkers as described in Table 1 and whose expression is shown herein to be up-regulated in response to treatment with an anti-αvβ6-integrin antibody, and/or one or more biomarkers of Table 2 whose expression is shown to be down-regulated in response to treatment with an anti-αvβ6-integrin antibody. Thus, if a patient's response is sensitive to treatment by an anti-αvβ6-integrin antibody, based on correlation of the expression profile of the one or biomarkers up-regulated (i.e., biomarkers in Table 1) or down-regulated (i.e., biomarkers in Table 2), the patient's treatment prognosis can be qualified as favorable and treatment can continue. Also, if, after treatment with an anti-αvβ6-integrin antibody, the test sample fails to show a change in the biomarker expression profile as compared to the expression profile prior to treatment, it can serve as an indicator that the current treatment should be modified, changed, or even discontinued. This monitoring process can indicate success or failure of a patient's treatment with an anti-αvβ6-integrin antibody and such monitoring processes can be repeated as necessary or desired.

[0125] Additionally or alternatively, in certain situations it may be possible to assay for the expression of one or more biomarkers at the protein level or the post-translationally modified form of a protein (e.g. phosphorylation or non-phosphorylation), using a detection reagent that detects the protein product or phosphorylated form of a protein encoded by the mRNA of the biomarker(s). For example, if an antibody reagent is available that binds specifically to the biomarker protein product or a phosphorylated form of a protein product to be detected, and not to other proteins, then such an antibody reagent can be used to detect the expression of the biomarker of interest in a cellular, tissue, or fluid sample from the subject, or a preparation derived from the test sample, using standard antibody-based techniques known in the art, such as FACS analysis, ELISA, mass-spectrometry and the like.

[0126] As used herein, the term “subject” includes humans, and non-human animals amenable to αvβ6 integrin inhibitor therapy, e.g., preferably mammals, such as non-human primates, sheep, dogs, cats, horses and cows.

[0127] Given the observation that the expression pattern of particular biomarkers is associated with responsiveness of the subject to a αvβ6 integrin inhibitor, one can select an appropriate treatment regimen for the subject based on the expression of one or more biomarkers in the subject. Accordingly, in one embodiment, the above-described method for predicting the responsiveness to a αvβ6 integrin inhibitor in a subject further comprises selecting a treatment regimen with the αvβ6 integrin inhibitor based upon expression of the one or more biomarkers in the subject. In another aspect, the method still further comprises administering the αvβ6 integrin inhibitor to the subject according to the treatment regimen such that the disorder is inhibited in the subject.

[0128] In another embodiment, the invention provides a method for selecting a treatment regimen for therapy with a αvβ6 integrin inhibitor in a subject, the method comprising:

[0129] assaying the subject for expression of one or more biomarkers predictive of responsiveness to a αvβ6 integrin inhibitor for treatment of the disorder; and

[0130] selecting a treatment regimen with a αvβ6 integrin inhibitor based upon expression of the one or more biomarkers in the subject.

[0131] In yet another embodiment, the invention provides a method of treating a subject having a disorder with a αvβ6 integrin inhibitor (e.g., an αvβ6 antibody or a small molecule inhibitor), the method comprising:

[0132] assaying the subject for expression of one or more biomarkers predictive of responsiveness to a αvβ6 integrin inhibitor for treatment of the disorder;

[0133] selecting a treatment regimen with a αvβ6 integrin inhibitor based upon expression of the one or more biomarkers in the subject; and

[0134] administering the αvβ6 integrin inhibitor according to the treatment regimen such that the subject is treated for the disorder.

[0135] The treatment regimen that is selected typically includes at least one of the following parameters and more typically includes many or all of the following parameters: the type of agent chosen for administration, the dosage, the formulation, the route of administration and/or the frequency of administration.

[0136] In one embodiment, the αvβ6 integrin inhibitor is an anti-αvβ6 integrin antibody, or antigen-binding portion thereof. For example, the anti-αvβ6 integrin antibody, or antigen-binding portion thereof, can be a humanized antibody, a chimeric antibody or a multivalent antibody.

[0137] It is well known in the art that antibody heavy and light chain CDR3 domains play an important role in the binding specificity/affinity of an antibody for an antigen. Accordingly, in another aspect, the αvβ6 integrin inhibitor used in the treatment method of the invention is a human anti-αvβ6 integrin antibody that has slow dissociation kinetics for association with αvβ6 integrin and that has light and heavy chain CDR3 domains that structurally are identical to or related to those of STX-100 (humanized 3G9) whose sequences are shown herein.

[0138] The αvβ6 integrin antibody of the invention can be modified. In some embodiments, the αvβ6 integrin antibody or antigen binding fragments thereof, is chemically modified to provide a desired effect. For example, pegylation of antibodies and antibody fragments of the invention may be carried out by any of the pegylation reactions known in the art, as described, for example, in the following references: Focus on Growth Factors 3:4-10 (1992); EP 0 154 316; and EP 0 401 384 (each of which is incorporated by reference herein in its entirety). Preferably, the pegylation is carried out via an acylation reaction or an alkylation reaction with a reactive polyethylene glycol molecule (or an analogous reactive water-soluble polymer). A preferred water-soluble polymer for pegylation of the antibodies and antibody fragments of the invention is polyethylene glycol (PEG). As used herein, “polyethylene glycol” is meant to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol.

[0139] Methods for preparing pegylated antibodies and antibody fragments of the invention will generally comprise the steps of (a) reacting the antibody or antibody fragment with polyethylene glycol, such as a reactive ester or aldehyde derivative of PEG, under conditions whereby the antibody or antibody fragment becomes attached to one or more PEG groups, and (b) obtaining the reaction products. It will be apparent to one of ordinary skill in the art to select the optimal reaction conditions or the acylation reactions based on known parameters and the desired result.

[0140] In yet another embodiment of the invention, αvβ6 integrin antibodies or fragments thereof can be altered wherein the constant region of the antibody is modified to reduce at least one constant region-mediated biological effector function relative to an unmodified antibody. To modify an antibody of the invention such that it exhibits reduced binding to the Fc receptor, the immunoglobulin constant region segment of the antibody can be mutated at particular regions necessary for Fc receptor (FcR) interactions (see e.g., Canfield, S. M. and S. L. Morrison (1991) J. Exp. Med. 173:1483-1491; and Lund, J. et al. (1991) J. Immunol. 147:2657-2662). Reduction in FcR binding ability of the antibody may also reduce other effector functions which rely on FcR interactions, such as opsonization and phagocytosis and antigen-dependent cellular cytotoxicity.

[0141] The biomarkers of the invention will be particularly useful in predicting the responsiveness of diseases mediated by αvβ6. For example, these humanized antibodies can be used to treat fibrosis (e.g., lung fibrosis, acute lung injury, kidney fibrosis, liver fibrosis, Alport's Syndrome, transplant and scleroderma), and other diseases and disorders described elsewhere herein, by blocking the activation of TGF-β through blockade of binding to the latency associated peptide (LAP) portion of TGF-β or blocking the binding of αvβ6 to any other ligands, such as fibronectin, vitronectin, and tenascin. In particular, the humanized antibodies of this invention can be used to treat lung diseases associated with injury/fibrosis such as, but not limited to, idiopathic pulmonary fibrosis, radiation induced fibrosis, flu induced fibrosis, coagulation induced fibrosis, vascular injury induced fibrosis, chronic obstructive pulmonary disease (COPD), scleroderma, bleomycin induced fibrosis, chronic asthma, silicosis, asbestos induced fibrosis, acute lung injury, transplant, and acute respiratory distress, (including bacterial pneumonia induced, trauma induced, viral pneumonia induced, ventilator induced, non-pulmonary sepsis induced and aspiration induced). The biomarkers will also be useful in predicting treatment of chronic nephropathies associated with injury/fibrosis such as, but not limited to, lupus, diabetes, scleroderma, glomerular nephritis, focal segmental glomerular sclerosis, IgA nephropathy, hypertension, allograft, Alport's disease, and acute kidney injury. The humanized antibodies may also be useful to treat gut fibrosis, scleroderma, radiation-induced fibrosis. In addition, the biomarkers may be used for determining the responsiveness and predicting therapy for liver fibrosis such as, but not limited to, biliary duct injury induced fibrosis. Other indications include head and neck fibrosis, radiation induced fibrosis, corneal scarring, LASIX, corneal transplant, trabeculectomy, hypertrophic scarring, burn induced fibrosis, surgical fibrosis, sarcoidosis, psoriasis and spinal cord injury/fibrosis.

[0142] In addition to fibrotic diseases and conditions, the biomarkers may also be useful for predicting responsiveness of a subject with cancer or cancer metastasis (including tumor growth and invasion), particularly epithelial cancers, to therapy with an anti-αvβ6 or a small molecule inhibitor of αvβ6. A subset of epithelial cancers is squamous cell carcinoma, e.g., head and neck (including oral, laryngeal, pharyngeal, esophageal), breast, lung, prostate, cervical, colon, pancreatic, skin (basal cell carcinomas), prostate, and ovarian cancers. Studies have shown that αvβ6 is highly expressed in many epithelial cancers, especially on the leading edge of the tumors. The biomarkers of the invention can be used to assess whether such cancers are responsive to the αvβ6 therapies. The biomarkers also could be used for predicting responsiveness of a subject with psoriasis to therapy with an anti-αvβ6 or a small molecule inhibitor of αvβ6.

EXAMPLES

Example 1: Experimental Determination of Gene Expression Profiles and Phosphorylated SMAD2 Levels in BAL Cells from an 8 Week Study of Subcutaneous Injection of STX-100 (Humanized 3G9 Antibody) in Cynomolgus Monkeys

[0143] The TGF-β cytokine is central to the initiation and maintenance of fibrosis, a pathological process that is marked by the replacement of diseased tissue with excess extracellular matrix (ECM) and ultimately leads to organ scarring and failure. TGF-β promotes fibroblast proliferation and activation, leading to excess secretion of ECM and progression of the fibrotic process. TGF-β plays a well-regulated role in tissue remodeling events that take place during wound healing; however, in many diseases the process of tissue remodeling becomes aberrant and is characterized by prolonged upregulated TGF-β signaling, excess fibroblast accumulation, ECM deposition, and scarring. Elevated expression of TGF-β is a hallmark of fibrotic human tissues, and the functional importance of TGF-β in promoting tissue fibrosis has been documented in vitro and in vivo in animal disease models. Overexpression of TGF-β is sufficient to induce fibroblast activation and angiogenesis in vivo and to activate excessive production of ECM in organotypic and cell cultures. Conversely, genetic or pharmacological disruption of the TGF-β pathway protects from fibrosis in models of tissue fibrosis. Consequently, TGF-β has been identified as a therapeutic target for treatment of diseases associated with the pathology of fibrosis. This includes idiopathic pulmonary fibrosis (IPF), an interstitial lung disease characterized by chronic progressive fibrosis, where there is an increased TGF-β transcriptional signature in affected lung tissue and increased TGF-β protein levels in focal areas of fibrosis.

[0144] Monitoring TGF-β activity in bronchoalveolar lavage (BAL) cells is a means to monitor activation TGF-β activity in the lung since these cells can make intimate contact with the epithelium of the lung. BAL cells, which are largely composed of macrophages, show tonic activation of TGF-β activation as monitored by phosphorylated SMAD2 (pSMAD2) levels and the expression of TGF-β regulated genes. For instance, there is no meaningful difference in pSMAD2 levels in BAL cells isolated from wild type mice treated with TGF-β or from wild type mice versus bleomycin treated mice. Likewise, there is no meaningful difference in TGF-β regulated genes or pSMAD2 levels in BAL cells from healthy volunteers or IPF patients with or without TGF-β treatment.

[0145] Thus, evaluating changes in pSMAD2 levels and gene expression in anti-αvβ6 antibody-treated BAL cells from healthy primates provides a measure of monitoring inhibition of the TGF-β pathway. These experiments are described in greater detail below.

[0146] Cynomolgus monkeys (2 males/group and 3 females/group) received a bolus subcutaneous injection of 0 (0.9% Sodium Chloride for Injection, USP), 0.1, 0.3, 1, 3, or 10 mg/kg/dose STX-100 once weekly for 8 consecutive weeks. The dose volume was 1 mL/kg/dose for all dose groups. At the end of the treatment period, all animals were euthanized and tissues collected for possible analysis. Animals were bled prestudy and on Days 1, 7, 35, 42, 49, and on Day 50, blood samples were drawn at 12, 24, 36, 48, 72, 96, 120, 144 and 168 hours after the administration of the 8th (last) dose for pharmacokinetic analysis. Animals were also bled pretest and on Days 35, 53 and 57 for RNA isolation and gene expression analysis, and pretest and on Days 7, 35, 53 and 57 for possible serum biomarker and plasma biomarker analysis. Bronchoalveolar lavage was performed pretest and on Days 53 and 57 (termination) for RNA and gene expression analysis as well as total and differential cell counts. Parameters evaluated during the study included: viability, clinical observations and body weights.

[0147] All animals survived to termination of the study. Weekly dosing with STX-100 up to 10 mg/kg/week did not result in any effects on animal viability, clinical observations or body weight. There were noticeable variations in the trough concentrations in the 0.1 and 0.3 mg/kg dose groups. In the 0.1 mg/kg dose group, all animals had detectable concentrations of STX-100 on Day 7; however, trough concentrations following subsequent doses diminished to BQL in 3 out of 5 animals. For the 2 animals that had measurable STX-100 level in subsequent trough sampling time points, female Animal No. 8899 showed no serum exposure at trough following the 7th dose and no exposure at all was noted following the 8th dose, whereas, male animal 9281 showed serum exposure of STX-100 through the 8th dose.

[0148] Overall, serum exposures of STX-100 appeared to be higher in female than in male monkeys at 0.1, 0.3 and 1 mg/kg, but were similar at 3 and 10 mg/kg. Overall, the serum concentration profile of STX-100 in monkeys (males and females combined) increased with increasing dose.

[0149] BAL Collection: During the study, Bronchoalveolar lavage fluid (BALF) samples were harvested under anesthesia. Animals were sedated with ketamine (5 to 10 mg/kg IM) and anesthetized with Propofol (7 mg/kg IV). Additional Propofol was administered as needed. The entire procedure took less than 30 minutes per animal. At necropsy, the side of the lung that was last lavaged (right side) was separated and the apical lobe only was lavaged with two washes of 10 mL sterile saline.

[0150] The BAL procedure was performed by guiding a bronchoscope into the left or right main (1st and 2nd collection respectively) bronchus and advancing it into a terminal bronchus until it became ‘wedged’. Two washes of sterile phosphate buffered saline (PBS) (10 mL total) was instilled and aspirated for collection into a cryotube and placed immediately on wet ice. For the pre-test collection only, the bronchoscope was repositioned to the opposite side to the initial BALF collection and the procedure was repeated. Post-dose BAL was performed on one lung lobe only and the lavaged lung side was noted. The total harvested volume was estimated and recorded. All BALF cells were processed and frozen within two hours of BALF collection. Post collection, animals were placed in lateral recumbency on the side opposite to that lavaged. Animals lavaged on both sides were switched from side to side every 5 to 10 minutes to ensure adequate recovery and excess fluid absorption in both lung lobes.

[0151] Samples were spun at 500 g for 5 minutes at 2 to 8° C. The supernatant was divided into four equal aliquots and frozen at approximately −80° C. (±10° C.). The cell pellet were resuspended in 10.5 mL of ice cold 1×PBS and then aliquoted into samples for preparing cell lysates to analyze total SMAD2 and phosphorylated SMAD2 levels by ELISA and for preparing total RNA to monitor gene expression by affymetrix gene chip analysis (Affymetrix GeneChip® Human Gene 1.0 ST arrays) or Taqman® gene expression assays.

[0152] Table 1 shows the list of genes that showed a statistically significant increase in expression in BAL cells isolated from cynomolgus monkeys after 8-weekly doses of STX-100 treatment relative to vehicle treated control animals. Gene expression was determined by affymetrix gene chip analysis (Affymetrix GeneChip® Human Gene 1.0 ST arrays).

[0153] Table 2 shows the list of genes showing a statistically significant decrease in expression in BAL cells isolated from cynomolgus monkeys after 8-weekly doses of STX-100 treatment relative to vehicle treated control animals. Gene expression was determined by affymetrix gene chip analysis (Affymetrix GeneChip® Human Gene 1.0 ST arrays).

TABLE-US-00004 TABLE 1 Genes Up-requlated Upon STX-100 Administration Nucleic acid Protein gene_assignment Genbank No. Seqeunce Sequence RHOU // ras homolog NM_021205 SEQ ID NO: 1 SEQ ID NO: 2 gene family, member U ASTN2 // astrotactin 2 NM_198186 SEQ ID NO: 3 SEQ ID NO: 4 // ITM2C // integral NM_030926 SEQ ID NO: 5 SEQ ID NO: 6 membrane protein 2C // PCOLCE2 // NM_013363 SEQ ID NO: 7 SEQ ID NO: 8 procollagen C- endopeptidase enhancer 2 // SLC39A8 // solute NM_022154 SEQ ID NO: 9 SEQ ID NO: 10 carrier family 39 (zinc transporter), member 8 NM_015028 // TNIK // NM_015028 SEQ ID NO: 11 SEQ IDNO: 12 TRKF2 and NCK interacting kinase // FUCA1 // NM_000147 SEQ ID NO: 13 SEQ ID NO: 14 fucosidase, alpha-L-1, tissue NM_033104 // STON2 NM_033104 SEQ ID NO: 15 SEQ ID NO: 16 // stonin 2 // GATA3 // GATA NM_001002295 SEQ ID NO: 17 SEQ ID NO: 18 binding protein 3 // GRK5 // G protein- NM_005308 SEQ ID NO: 19 SEQ ID NO: 20 coupled receptor kinase 5 // PLA1A // NM_015900 SEQ ID NO: 21 SEQ ID NO: 22 phospholipase A1 member A // ATP2B4 // ATPase, NM_001001396 SEQ ID NO: 23 SEQ ID NO: 24 Ca++ transporting, plasma membrane 4 // TEC // tec protein NM_003215 SEQ ID NO: 25 SEQ ID NO: 26 tyrosine kinase // LAMC1 // laminin, NM_002293 SEQ ID NO: 27 SEQ ID NO: 28 gamma 1 (formerly LAMB2) // TAGAP // T-cell NM_054114 SEQ ID NO: 29 SEQ ID NO: 30 activation RhoGTPase activating protein // CD3E // CD3e NM_000733 SEQ ID NO: 31 SEQ ID NO: 32 molecule, epsilon (CD3-TCR complex) // BACE2 // beta-site NM_012105 SEQ ID NO: 33 SEQ ID NO: 34 APP-cleaving enzyme 2 // TRERF1 // NM_033502 SEQ ID NO: 35 SEQ ID NO: 36 transcriptional regulating factor 1 // CCL5 // chemokine NM_002985 SEQ ID NO: 37 SEQ ID NO: 38 (C-C motif) ligand 5 // PLA2G2D // NM_012400 SEQ ID NO: 39 SEQ ID NO: 40 phospholipase A2, group IID // S1PR1 // NM_001400 SEQ ID NO: 41 SEQ ID NO: 42 sphingosine-1- phosphate receptor 1 // PLXNA1 // plexin A1 NM_032242 SEQ ID NO: 43 SEQ ID NO: 44 // MTSS1 // metastasis NM_014751 SEQ ID NO: 45 SEQ ID NO: 46 suppressor 1 // SLAMF7 // SLAM NM_021181 SEQ ID NO: 47 SEQ ID NO: 48 family member 7 // C11 orf49 // NM_001003676 SEQ ID NO: 49 SEQ ID NO: 50 chromosome 11 open reading frame 49 // CCDC103 // coiled- NM_213607 SEQ ID NO: 51 SEQ ID NO: 52 coil domain containing 103 // PTPN22 // protein NM_015967 SEQ ID NO: 53 SEQ ID NO: 54 tyrosine phosphatase, non-receptor type 22 (lymphoid) // PIM2 // pim-2 NM_006875 SEQ ID NO: 55 SEQ ID NO: 56 oncogene // SLAMF8 // SLAM NM_020125 SEQ ID NO: 57 SEQ ID NO: 58 family member 8 // IQGAP2 // IQ motif NM_006633 SEQ ID NO: 59 SEQ ID NO: 60 containing GTPase activating protein 2 // CHST15 // NM_015892 SEQ ID NO: 61 SEQ ID NO :62 carbohydrate (N- acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15 // MAP2K6 // mitogen- NM_002758 SEQ ID NO: 63 SEQ ID NO: 64 activated protein kinase kinase 6 // ALOX15 // NM_001140 SEQ ID NO: 65 SEQ ID NO: 66 arachidonate 15- lipoxygenase NM_020859 // NM_020859 SEQ ID NO: 67 SEQ ID NO: 68 SHROOM3 // shroom family member 3 // DNM1 // dynamin 1 NM_004408 SEQ ID NO: 69 SEQ ID NO: 70 // NT5DC2 // 5′- NM_022908 SEQ ID NO: 71 SEQ ID NO: 72 nucleotidase domain containing 2 // IFITM1 // interferon NM_003641 SEQ ID NO: 73 SEQ ID NO: 74 induced transmembrane protein 1 (9-27) // E2F5 // E2F NM_001951 SEQ ID NO: 75 SEQ ID NO: 76 transcription factor 5, p130-binding // AES // amino- NM_198969 SEQ ID NO: 77 SEQ ID NO: 78 terminal enhancer of split // USP2 // ubiquitin NM_004205 SEQ ID NO: 79 SEQ ID NO: 80 specific peptidase 2 // CD8A // CD8a NR_027353 SEQ ID NO: 81 N/A molecule // MYO1E // myosin IE NM_004998 SEQ ID NO: 82 SEQ ID NO: 83 // KREMEN1 // kringle NM_001039570 SEQ ID NO: 84 SEQ ID NO: 85 containing transmembrane protein 1 // VLDLR // very low NM_003383 SEQ ID NO: 86 SEQ ID NO: 87 density lipoprotein receptor // TIAM1 // T-cell NM_003253 SEQ ID NO: 88 SEQ ID NO: 89 lymphoma invasion and metastasis 1 // ABLIM1 //actin NM_002313 SEQ ID NO: 90 SEQ ID NO: 91 binding LIM protein 1 // TSPAN4 // NM_001025237 SEQ ID NO: 92 SEQ ID NO: 93 tetraspanin 4 // PLTP // phospholipid NM_006227 SEQ ID NO: 94 SEQ ID NO: 95 transfer protein // PSCA // prostate NM_005672 SEQ ID NO: 96 SEQ ID NO: 97 stem cell antigen // GRAP2 // GRB2- NM_004810 SEQ ID NO: 98 SEQ ID NO: 99 related adaptor protein 2 // P2RY10 // purinergic NM_014499 SEQ ID NO: 100 SEQ ID NO: 101 receptor P2Y, G- protein coupled, 10 // MAP1A // NM_002373 SEQ ID NO: 102 SEQ ID NO: 103 microtubule- associated protein 1A // THEMIS // NM_001010923 SEQ ID NO: 104 SEQ ID NO: 105 thymocyte selection associated // IL18RAP // NM_003853 SEQ ID NO: 106 SEQ ID NO: 107 interleukin 18 receptor accessory protein // CHN2 // chimerin NM_004067 SEQ ID NO: 108 SEQ ID NO: 109 (chimaerin) 2 // PPM1E // protein NM_014906 SEQ ID NO: 110 SEQ ID NO: 111 phosphatase 1E (PP2C domain containing) // TMEM154 // NM_152680 SEQ ID NO: 112 SEQ ID NO: 113 transmembrane protein 154 // PLBD1 // NM_024829 SEQ ID NO: 114 SEQ ID NO: 115 phospholipase B domain containing 1 // SCN1B // sodium NM_001037 SEQ ID NO: 116 SEQ ID NO: 117 channel, voltage- gated, type I, beta // UST // uronyl-2- NM_005715 SEQ ID NO: 118 SEQ ID NO :119 sulfotransferase // IL23R // interleukin NM_144701 SEQ ID NO: 120 SEQ ID NO: 121 23 receptor // KLRK1 // killer cell NM_007360 SEQ ID NO: 122 SEQ ID NO: 123 lectin-like receptor subfamily K, member 1 // NFATC2 // nuclear NM_012340 SEQ ID NO: 124 SEQ ID NO: 125 factor of activated T- cells, cytoplasmic, calcineurin-dependent 2 // FYB // FYN binding NM_001465 SEQ ID NO: 126 SEQ ID NO: 127 protein (FYB-120/130) // KMO // kynurenine NM_003679 SEQ ID NO: 128 SEQ ID NO: 129 3-monooxygenase (kynurenine 3- hydroxylase) // MCOLN2 // NM_153259 SEQ ID NO: 130 SEQ ID NO: 131 mucolipin 2 // TMEM37 // NM_183240 SEQ ID NO: 132 SEQ ID NO: 133 transmembrane protein 37 // STARD13 // StAR- NM_178006 SEQ ID NO: 134 SEQ ID NO: 135 related lipid transfer (START) domain containing 13 // CD80 // CD80 NM_005191 SEQ ID NO: 136 SEQ ID NO: 137 molecule // LOC100289528 // ENST00000438157 SEQ ID NO: 998 SEQ ID NO: 138 hypothetical protein LOC100289528 // ARID5B // AT rich NM_032199 SEQ ID NO: 139 SEQ ID NO: 140 interactive domain 5B (MRF1-like) // ADD3 // adducin 3 NM_016824 SEQ ID NO: 141 SEQ ID NO: 142 (gamma) // PLCG1 // NM_002660 SEQ ID NO :143 SEQ ID NO: 144 phospholipase C, gamma 1 // SNORD115-31 // NR_003346 SEQ ID NO: 145 N/A small nucleolar RNA, C/D box 115-31 // PYROXD2 // NM_032709 SEQ ID NO: 146 SEQ ID NO: 147 pyridine nucleotide- disulphide oxidoreductase domain 2 // AMICA1 //adhesion NM_001098526 SEQ ID NO: 148 SEQ ID NO: 149 molecule, interacts with CXADR antigen 1 // TGFBI // NM_000358 SEQ ID NO: 150 SEQ ID NO: 151 transforming growth factor, beta-induced, 68 kDa // ABI2 // abl-interactor 2 NM_005759 SEQ ID NO: 152 SEQ ID NO: 153 // SLC16A7 // solute NM_004731 SEQ ID NO: 154 SEQ ID NO: 155 carrier family 16, member 7 (monocarboxylic acid transporter 2) // CD3D // CD3d NM_000732 SEQ ID NO: 156 SEQ ID NO: 157 molecule, delta (CD3- TCR complex) // OSBPL3 // oxysterol NM_015550 SEQ ID NO: 158 SEQ ID NO: 159 binding protein-like 3 // TPCN1 // two pore NM_001143819 SEQ ID NO: 160 SEQ ID NO: 161 segment channel 1 // ECE1 // endothelin NM_001397 SEQ ID NO: 162 SEQ ID NO: 163 converting enzyme 1 // TGFA // NM_003236 SEQ ID NO: 164 SEQ ID NO: 165 transforming growth factor, alpha // ZEB1 // zinc finger NR_024285 SEQ ID NO: 166 N/A E-box binding homeobox 1 — // CTDSPL // CTD NM_001008392 SEQ ID NO: 167 SEQ ID NO: 168 (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like // PPFIBP2 // PTPRF NM_003621 SEQ ID NO: 169 SEQ ID NO: 170 interacting protein, binding protein 2 (liprin beta 2) // KLRD1 // killer cell NM_002262 SEQ ID NO :171 SEQ ID NO :172 lectin-like receptor subfamily D, member 1 // GM2A // GM2 NM_000405 SEQ ID NO: 173 SEQ ID NO: 174 ganglioside activator // EIF4G3 // eukaryotic NM_003760 SEQ ID NO: 175 SEQ ID NO: 176 translation initiation factor 4 gamma, 3 // PADI2 // peptidyl NM_007365 SEQ ID NO: 177 SEQ ID NO: 178 arginine deiminase, type II // TSPAN33 // NM_178562 SEQ ID NO: 179 SEQ ID NO: 180 tetraspanin 33 // SDC3 // syndecan 3 NM_014654 SEQ ID NO: 181 SEQ ID NO: 182 // ZFP36L1 // zinc NM_004926 SEQ ID NO: 183 SEQ ID NO: 184 finger protein 36, C3H type-like 1 // CPM // NM_001874 SEQ ID NO: 185 SEQ ID NO: 186 carboxypeptidase M // SPP1 //secreted NM_001040058 SEQ ID NO: 187 SEQ ID NO: 188 phosphoprotein 1 // CYFIP2 // NM_001037332 SEQ ID NO: 189 SEQ ID NO: 190 cytoplasmic FMR1 interacting protein 2 // FLNB // filamin B, NM_001457 SEQ ID NO: 191 SEQ ID NO: 192 beta // C6orf192 // NM_052831 SEQ ID NO: 193 SEQ ID NO: 194 chromosome 6 open reading frame 192 // CD226 // CD226 NM_006566 SEQ ID NO: 195 SEQ ID NO: 196 molecule // RASA3 // RAS p21 NM_007368 SEQ ID NO: 197 SEQ ID NO: 198 protein activator 3 // CD274 // CD274 NM_014143 SEQ ID NO: 199 SEQ ID NO: 200 molecule // CD28 // CD28 NM_006139 SEQ ID NO: 201 SEQ ID NO: 202 molecule // KCNMA1 // NM_001014797 SEQ ID NO: 203 SEQ ID NO: 204 potassium large conductance calcium- activated channel, subfamily M, alpha member 1 NM_001259 // CDK6 // NM_001259 SEQ ID NO: 205 SEQ ID NO: 206 cycn-dependent kinase 6 // ADAM19 // ADAM NM_033274 SEQ ID NO: 207 SEQ ID NO: 208 metallopeptidase domain 19 (meltrin beta) // CD3G // CD3g NM_000073 SEQ ID NO: 209 SEQ ID NO: 210 molecule, gamma (CD3-TCR complex) // ADORA3 // NM_020683 SEQ ID NO: 211 SEQ ID NO :212 adenosine A3 receptor // STAT4 // signal NM_003151 SEQ ID NO: 213 SEQ ID NO: 214 transducer and activator of transcription 4 // CD86 // CD86 NM_175862 SEQ ID NO: 215 SEQ ID NO: 216 molecule // TM7SF4 // NM_030788 SEQ ID NO: 217 SEQ ID NO: 218 transmembrane 7 superfamily member 4 // CCL3L1 // NM_021006 SEQ ID NO: 219 SEQ ID NO: 220 chemokine (C-C motif) ligand 3-like 1 // CCL3L1 // NM_021006 SEQ ID NO: 221 SEQ ID NO :222 chemokine (C-C motif) ligand 3-like 1 // CCL3L1 // NM_021006 SEQ ID NO: 223 SEQ ID NO: 224 chemokine (C-C motif) ligand 3-like 1 // TOX // thymocyte NM_014729 SEQ ID NO: 225 SEQ ID NO: 226 selection-associated high mobility group box // ITK // IL2-inducible NM_005546 SEQ ID NO: 227 SEQ ID NO: 228 T-cell kinase // SORBS2 // sorbin NM_021069 SEQ ID NO: 229 SEQ ID NO: 230 and SH3 domain containing 2 // PLEKHA5 // NM_019012 SEQ ID NO: 231 SEQ ID NO: 232 pleckstrin homology domain containing, family A member 5 // FAT1 // FAT tumor NM_005245 SEQ ID NO: 233 SEQ ID NO: 234 suppressor homolog 1 (Drosophila) // TGFBR3 // NM_003243 SEQ ID NO: 235 SEQ ID NO: 236 transforming growth factor, beta receptor III // SMAD3 // SMAD NM_005902 SEQ ID NO: 237 SEQ ID NO: 238 family member 3 // TUBA4A // tubulin, NM_006000 SEQ ID NO: 230 SEQ ID NO: 240 alpha 4a // SLC40A1 // solute NM_014585 SEQ ID NO: 241 SEQ ID NO: 242 carrier family 40 (iron- regulated transporter), member 1 // LEF1 // lymphoid NM_016269 SEQ ID NO: 243 SEQ ID NO: 244 enhancer-binding factor 1 // CCL8 // chemokine NM_005623 SEQ ID NO: 245 SEQ ID NO: 246 (C-C motif) ligand 8 // CCR4 // chemokine NM_005508 SEQ ID NO: 247 SEQ ID NO: 248 (C-C motif) receptor 4 // CDC14A // CDC14 NM_003672 SEQ ID NO: 240 SEQ ID NO: 250 cell division cycle 14 homolog A (S. cerevisiae) // PRKCQ // protein NM_006257 SEQ ID NO: 251 SEQ ID NO: 252 kinase C, theta // STK39 // serine NM_013233 SEQ ID NO: 253 SEQ ID NO: 254 threonine kinase 39 (STE20/SPS1 homolog, yeast) // TSPAN3 // NM_005724 SEQ ID NO: 255 SEQ ID NO: 256 tetraspanin 3 // CCDC88C // coiled- NM_001080414 SEQ ID NO: 257 SEQ ID NO: 258 coil domain containing 88C // PDE4D // NM_001104631 SEQ ID NO: 259 SEQ ID NO: 260 phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila) // DFNA5 // deafness, NM_004403 SEQ ID NO: 261 SEQ ID NO: 262 autosomal dominant 5 // MMP2 // matrix NM_004530 SEQ ID NO: 263 SEQ ID NO: 264 metallopeptidase 2 (gelatinase A, 7 2kDa gelatinase, 72 kDa type IV collagenase) // GNG2 // guanine NM_053064 SEQ ID NO: 265 SEQ ID NO: 266 nucleotide binding protein (G protein), gamma 2 // ETS1 // v-ets NM_001143820 SEQ ID NO: 267 SEQ ID NO: 268 erythroblastosis virus E26 oncogene homolog 1 (avian) // P2RY12 // purinergic NM_022788 SEQ ID NO :269 SEQ ID NO: 270 receptor P2Y, G- protein coupled, 12 // SLC9A9 // solute NM_173653 SEQ ID NO: 271 SEQ ID NO: 272 carrier family 9 (sodium/hydrogen exchanger), member 9 // CD180 // CD180 NM_005582 SEQ ID NO: 273 SEQ ID NO: 274 molecule // TRERF1 // NM_033502 SEQ ID NO: 275 SEQ ID NO: 276 transcriptional regulating factor 1 // CD1C // CD1c NM_001765 SEQ ID NO: 277 SEQ ID NO: 278 molecule // INPP4B // inositol NM_003866 SEQ ID NO: 279 SEQ ID NO: 280 polyphosphate-4- phosphatase, type II, 105 kDa // DKFZP564O0823 // NM_015393 SEQ ID NO: 281 SEQ ID NO: 282 prostatic androgen- repressed message-1 // STAMBPL1 // STAM NM_020799 SEQ ID NO: 283 SEQ ID NO: 284 binding protein-like 1 // ADAM23 // ADAM NM_003812 SEQ ID NO: 285 SEQ ID NO: 286 metallopeptidase domain 23 // SRGAP1 // SLIT- NM_020762 SEQ ID NO: 287 SEQ ID NO: 288 ROBO Rho GTPase activating protein 1 // TUBB2C // tubulin, NM_006088 SEQ ID NO: 289 SEQ ID NO :290 beta 2C // CES1 // NM_001025195 SEQ ID NO: 291 SEQ ID NO: 292 carboxylesterase 1 (monocyte/macrophage serine esterase 1) // DPP4 // dipeptidyl- NM_001935 SEQ ID NO: 293 SEQ ID NO: 294 peptidase 4 // SKAP1 // src kinase NM_003726 SEQ ID NO: 295 SEQ ID NO: 296 associated phosphoprotein 1 // SEPP1 // NM_005410 SEQ ID NO: 297 SEQ ID NO: 298 selenoprotein P, plasma, 1 // KIAA0746 // NM_015187 SEQ ID NO: 299 SEQ ID NO: 300 KIAA0746 protein // CD200R1 // CD200 NM_138806 SEQ ID NO: 301 SEQ ID NO: 302 receptor 1 // ANGPTL2 // NM_012098 SEQ ID NO: 303 SEQ ID NO: 304 angiopoietin-like 2 // GZMK // granzyme K NM_002104 SEQ ID NO: 305 SEQ ID NO: 306 (granzyme 3; tryptase II) // SLC16A10 // solute NM_018593 SEQ ID NO: 307 SEQ ID NO: 308 carrier family 16, member 10 (aromatic amino acid transporter) // MARCKS // NM_002356 SEQ ID NO: 309 SEQ ID NO: 310 myristoylated alanine- rich protein kinase C substrate // C6orf105 // NM_001143948 SEQ ID NO: 311 SEQ ID NO: 312 chromosome 6 open reading frame 105 // CCND2 // cyclin D2 NM_001759 SEQ ID NO: 313 SEQ ID NO: 314 // GDPD1 // NM_182569 SEQ ID NO: 315 SEQ ID NO: 316 glycerophosphodiester phosphodiesterase domain containing 1 // CD38 // CD38 NM_001775 SEQ ID NO: 317 SEQ ID NO: 318 molecule // TGFB2 // NM_001135599 SEQ ID NO: 319 SEQ ID NO: 320 transforming growth factor, beta 2 // ARRDC4 // arrestin NM_183376 SEQ ID NO: 321 SEQ ID NO: 322 domain containing 4 // ITM2A // integral NM_004867 SEQ ID NO: 323 SEQ ID NO: 324 membrane protein 2A // SLC44A3 // solute NM_001114106 SEQ ID NO: 325 SEQ ID NO: 326 carrier family 44, member 3 // FGD6 // FYVE, NM_018351 SEQ ID NO: 327 SEQ ID NO: 328 RhoGEF and PH domain containing 6 // BIRC3 // baculoviral NM_001165 SEQ ID NO: 329 SEQ ID NO: 330 IAP repeat-containing 3 // GUCY1A3 // NM_000856 SEQ ID NO: 331 SEQ ID NO: 332 guanylate cyclase 1, soluble, alpha 3 // PAPSS2 // 3′- NM_004670 SEQ ID NO: 333 SEQ ID NO: 334 phosphoadenosine 5′- phosphosulfate synthase 2 // RAB6B // RAB6B, NM_016577 SEQ ID NO: 335 SEQ ID NO: 336 member RAS oncogene family // SLC38A1 // solute NM_030674 SEQ ID NO: 337 SEQ ID NO: 338 carrier family 38, member 1 // 5T85IA4 // 5T8 NM_005668 SEQ ID NO: 339 SEQ ID NO: 340 alpha-N-acetyl- neuraminide alpha- 2,8-sialyltransferase 4 // WDR17 // WD NM_170710 SEQ ID NO: 341 SEQ ID NO: 342 repeat domain 17 // C4orf18 // NM_001128424 SEQ ID NO: 343 SEQ ID NO: 344 chromosome 4 open reading frame 18 // KLRG1 // killer cell NM_005810 SEQ ID NO: 345 SEQ ID NO: 346 lectin-like receptor subfamily G, member 1 // TES // testis derived NM_015641 SEQ ID NO: 347 SEQ ID NO: 348 transcript (3 LIM domains) // ABCA6 // ATP- NM_080284 SEQ ID NO: 349 SEQ ID NO: 350 binding cassette, sub- family A (ABC1), member 6 // CD96 // CD96 NM_198196 SEQ ID NO: 351 SEQ ID NO: 352 molecule // C5orf13 // NM_004772 SEQ ID NO: 353 SEQ ID NO: 354 chromosome 5 open reading frame 13 // ITGB3 // integrin, NM_000212 SEQ ID NO: 355 SEQ ID NO: 356 beta 3 (platelet glycoprotein IIIa, antigen CD61) // PLXNC1 // plexin C1 NM_005761 SEQ ID NO: 357 SEQ ID NO: 358 // NEDD4L // neural NM_001144967 SEQ ID NO: 359 SEQ ID NO: 360 precursor cell expressed, developmentally down-regulated 4-like // LGMN // legumain NM_005606 SEQ ID NO: 361 SEQ ID NO: 362 // SCIN // scinderin NM_001112706 SEQ ID NO: 363 SEQ ID NO: 364 // TRAT1 // T cell NM_016388 SEQ ID NO: 365 SEQ ID NO: 366 receptor associated transmembrane adaptor 1 // ANTXR2 // anthrax NM_058172 SEQ ID NO: 367 SEQ ID NO: 368 toxin receptor 2 // CCL4L1 // NM_001001435 SEQ ID NO: 369 SEQ ID NO: 370 chemokine (C-C motif) ligand 4-like 1 // KIAA0040 // NM_014656 SEQ ID NO: 371 SEQ ID NO: 372 KIAA0040 // MYO1D // myosin ID NM_015194 SEQ ID NO: 373 SEQ ID NO: 374 — // RARRES1 // retinoic NM_206963 SEQ ID NO: 375 SEQ ID NO: 376 acid receptor responder (tazarotene induced) 1 // LYVE1 // lymphatic NM_006691 SEQ ID NO: 377 SEQ ID NO: 378 vessel endothelial hyaluronan receptor 1 // GPR174 // G NM_032553 SEQ ID NO: 379 SEQ ID NO: 380 protein-coupled receptor 174 // GABRG3 // gamma- NM_033223 SEQ ID NO: 381 SEQ ID NO: 382 aminobutyric acid (GABA) A receptor, gamma 3 // FOLR2 // folate NM_000803 SEQ ID NO: 383 SEQ ID NO: 384 receptor 2 (fetal) — — // GPR171 // G NM_013308 SEQ ID NO: 385 SEQ ID NO: 386 protein-coupled receptor 171 // PMP22 // peripheral NM_000304 SEQ ID NO: 387 SEQ ID NO: 388 myelin protein 22 // PLD3 // NM_012268 SEQ ID NO: 389 SEQ ID NO: 390 phospholipase D family, member 3 // VSIG4 // V-set and NM_007268 SEQ ID NO: 391 SEQ ID NO: 392 immunoglobulin domain containing 4 // PTPRB // protein NM_001109754 SEQ ID NO: 393 SEQ ID NO: 394 tyrosine phosphatase, receptor type, B // RNF125 // ring finger NM_017831 SEQ ID NO: 395 SEQ ID NO: 396 protein 125 // TCN2 // NM_000355 SEQ ID NO: 397 SEQ ID NO: 398 transcobalamin II; macrocytic anemia // EPS8 // epidermal NM_004447 SEQ ID NO: 399 SEQ ID NO: 400 growth factor receptor pathway substrate 8 // CD84 // CD84 NM_003874 SEQ ID NO: 401 SEQ ID NO: 402 molecule // F13A1 // coagulation NM_000129 SEQ ID NO: 403 SEQ ID NO: 404 factor XIII, A1 polypeptide // IKZF3 // IKAROS NM_012481 SEQ ID NO: 405 SEQ ID NO: 406 family zinc finger 3 (Aiolos) // SLFN5 // schlafen NM_144975 SEQ ID NO: 407 SEQ ID NO: 408 family member 5 // CAMK4 // NM_001744 SEQ ID NO: 409 SEQ ID NO: 410 calcium/calmodulin- dependent protein kinase IV // PLA2G7 // NM_005084 SEQ ID NO: 411 SEQ ID NO: 412 phospholipase A2, group VII (platelet- activating factor acetylhydrolase, plasma) // TNS1 // tensin 1 NM_022648 SEQ ID NO: 413 SEQ ID NO: 414 // HBD // hemoglobin, NM_000519 SEQ ID NO: 415 SEQ ID NO: 416 delta // CTSL1 // cathepsin NM_001912 SEQ ID NO: 417 SEQ ID NO: 418 L1 // SELL // selectin L NM_000655 SEQ ID NO: 419 SEQ ID NO: 420 // TNFSF10 // tumor NM_003810 SEQ ID NO: 421 SEQ ID NO: 422 necrosis factor (ligand) superfamily, member 10 // CLIC2 // chloride NM_001289 SEQ ID NO: 423 SEQ ID NO: 424 intracellular channel 2 // RGL1 // ral guanine NM_015149 SEQ ID NO: 425 SEQ ID NO: 426 nucleotide dissociation stimulator-like 1 // TM4SF19 // NM_138461 SEQ ID NO: 427 SEQ ID NO: 428 transmembrane 4 L six family member 19 // TFCP2L1 // NM_014553 SEQ ID NO: 429 SEQ ID NO: 430 transcription factor CP2-like 1 // STEAP4 // STEAP NM_024636 SEQ ID NO: 431 SEQ ID NO: 432 family member 4 // GPR15 // G protein- NM_005290 SEQ ID NO: 433 SEQ ID NO: 434 coupled receptor 15 // CYBRD1 // NM_024843 SEQ ID NO: 435 SEQ ID NO: 436 cytochrome b reductase 1 // SFRP4 // secreted NM_003014 SEQ ID NO: 437 SEQ ID NO: 438 frizzled-related protein 4 // CMKLR1 // NM_001142343 SEQ ID NO: 439 SEQ ID NO: 440 chemokine-like receptor 1 // HGF // hepatocyte NM_000601 SEQ ID NO: 441 SEQ ID NO: 442 growth factor (hepapoietin A; scatter factor) // CCL2 // chemokine NM_002982 SEQ ID NO: 443 SEQ ID NO: 444 (C-C motif) ligand 2 // THSD7A // NM_015204 SEQ ID NO: 445 SEQ ID NO: 446 thrombospondin, type I, domain containing 7A // SULT1C2 // NM_001056 SEQ ID NO: 447 SEQ ID NO: 448 sulfotransferase family, cytosolic, 1C, member 2 // MMP9 // matrix NM_004994 SEQ ID NO: 449 SEQ ID NO: 450 metallopeptidase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase) // LRRC39 // leucine NM_144620 SEQ ID NO: 451 SEQ ID NO: 452 rich repeat containing 39 // HBB // hemoglobin, NM_000518 SEQ ID NO: 453 SEQ ID NO: 454 beta // CTSK // cathepsin K NM_000396 SEQ ID NO: 455 SEQ ID NO: 456 // FABP3 // fatty acid NM_004102 SEQ ID NO: 457 SEQ ID NO: 458 binding protein 3, muscle and heart (mammary-derived growth inhibitor) // ENPP2 // NM_006209 SEQ ID NO: 459 SEQ ID NO: 460 ectonucleotide pyrophosphatase/phos phodiesterase 2 // MLANA // melan-A NM_005511 SEQ ID NO: 461 SEQ ID NO: 462 ABCD2// ATP-binding NM_005164 SEQ ID NO: 999 SEQ ID NO: 1000 cassette, sub-family D (ALD), member 2 NM_018169 SEQ ID NO: 1001 SEQ ID NO: 1002 C12orf35//chromosome 12 open reading frame 35 CD207//CD207 NM_015717 SEQ ID NO: 1003 SEQ ID NO: 1004 molecule, langerin CD247//CD247 NM_198053 SEQ ID NO: 1005 SEQ ID NO: 1006 molecule CD27//CD27 NM_001242 SEQ ID NO: 1007 SEQ ID NO: 1008 molecule CD5L//CD5 NM_005894 SEQ ID NO: 1009 SEQ ID NO: 1010 molecule-like CHIT1//chitinase 1 NM_003465 SEQ ID NO: 1011 SEQ ID NO: 1012 (chitotriosidase) CLEC2D//C-type NM_001004419 SEQ ID NO: 1013 SEQ ID NO: 1014 lectin domain family 2, member D CST7//cystatin F NM_003650 SEQ ID NO: 1015 SEQ ID NO: 1016 (leukocystatin) DTNA//dystrobrevin, NM_001390 SEQ ID NO: 1017 SEQ ID NO: 1018 alpha ENTPD1//ectonucleoside NM_001776 SEQ ID NO: 1019 SEQ ID NO: 1020 triphosphate diphosphohydrolase 1 EPHB1//EPH NM_004441 SEQ ID NO: 1021 SEQ ID NO: 1022 receptor B1 ESPNP//espin NR_026567 SEQ ID NO: 1023 N/A pseudogene FAM40B//family with NM_020704 SEQ ID NO: 1024 SEQ ID NO: 1025 sequence similarity 40, member B FAM87A//family with BC037297 SEQ ID NO: 1026 N/A sequence similarity 87, member A FBXO40//F-box NM_016298 SEQ ID NO: 1027 SEQ ID NO: 1028 protein 40 FCGR2A//Fc NM_001136219 SEQ ID NO: 1029 SEQ ID NO: 1030 fragment of IgG, low affinity IIa, receptor (CD32) FCGR2B//Fc NM_004001 SEQ ID NO: 1031 SEQ ID NO: 1032 fragment of IgG, low affinity IIb, receptor (CD32) FCGR2C//Fc NM_201563 SEQ ID NO: 1033 SEQ ID NO: 1034 fragment of IgG, low affinity IIc, receptor for (CD32) FMN1//formin 1 ENST00000414268 SEQ ID NO: 1035 SEQ ID NO: 1036 FMO1//flavin NM_002021 SEQ ID NO: 1037 SEQ ID NO: 1038 containing monooxygenase 1 FOLH1//folate NM_153696 SEQ ID NO: 1039 SEQ ID NO: 1040 hydrolase (prostate- specific membrane antigen) 1 FOLH1B//folate NM_153696 SEQ ID NO: 1041 SEQ ID NO: 1042 hydrolase 1B FYN//FYN oncogene NM_002037 SEQ ID NO: 1043 SEQ ID NO: 1044 related to SRC, FGR, YES GAST //gastrin NM_000805 SEQ ID NO: 1045 SEQ ID NO: 1046 GIMAP1//GTPase, NM_130759 SEQ ID NO: 1047 SEQ ID NO: 1048 IMAP family member 1 GIMAP5//GTPase, NM_018384 SEQ ID NO: 1049 SEQ ID NO: 1050 IMAP family member 5 GIMAP8//GTPase, NM_175571 SEQ ID NO: 1051 SEQ ID NO: 1052 IMAP family member 8 GPX3//glutathione NM_002084 SEQ ID NO: 1053 SEQ ID NO: 1054 peroxidase 3 (plasma) GUSBL1//glucuronidase, NR_003504 SEQ ID NO: 1055 N/A beta-like 1 HAVCR2//hepatitis A NM_032782 SEQ ID NO: 1056 SEQ ID NO: 1057 virus cellular receptor 2 IGJ//immunoglobulin NM_144646 SEQ ID NO: 1058 SEQ ID NO: 1059 J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides IGKV3D-11 // ENST00000390250 SEQ ID NO: 1060 SEQ ID NO: 1061 immunoglobulin kappa variable 3D-11 IL1R2//interleukin 1 NM_004633 SEQ ID NO: 1062 SEQ ID NO: 1063 receptor, type II JAKMIP2//janus NM_014790 SEQ ID NO: 1064 SEQ ID NO: 1065 kinase and microtubule interacting protein 2 KLHL38//kelch-like 38 NM_001081675 SEQ ID NO: 1066 SEQ ID NO: 1067 (Drosophila) LAT2//linker for NM_032464 SEQ ID NO: 1068 SEQ ID NO: 1069 activation of T cells family, member 2 LIPA//lipase A, NM_001127605 SEQ ID NO: 1070 SEQ ID NO: 1071 lysosomal acid, cholesterol esterase LOC100128751//INM04 AY194294 SEQ ID NO: 1072 SEQ ID NO: 1073 LOC91316//glucuronidase, NR_024448 SEQ ID NO: 1074 N/A beta LPL//lipoprotein NM_000237 SEQ ID NO: 1075 SEQ ID NO: 1076 lipase LY9//lymphocyte NM_002348 SEQ ID NO: 1077 SEQ ID NO: 1078 antigen 9 MAF//v-maf NM_001031804 SEQ ID NO: 1079 SEQ ID NO: 1080 musculoaponeurotic fibrosarcoma oncogene homolog (avian) MATK//megakaryocyte- NM_139355 SEQ ID NO: 1081 SEQ ID NO: 1082 associated tyrosine kinase MS4A4A//membrane- NM_024021 SEQ ID NO: 1083 SEQ ID NO: 1084 spanning 4-domains, subfamily A, member 4 MX2//myxovirus NM_002463 SEQ ID NO: 1085 SEQ ID NO: 1086 (influenza virus) resistance 2 (mouse) NCALD//neurocalcin NM_001040624 SEQ ID NO: 1087 SEQ ID NO: 1088 delta OBFC2A// NM_001031716 SEQ ID NO: 1089 SEQ ID NO: 1090 oligonucleotide OR14C36//olfactory NM_001001918 SEQ ID NO: 1091 SEQ ID NO: 1092 receptor, family 14, subfamily C, member 36 OR5L1//olfactory NM_001004738 SEQ ID NO: 1093 SEQ ID NO: 1094 receptor, family 5, subfamily L, member 1 PDZRN3//PDZ NM_015009 SEQ ID NO: 1095 SEQ ID NO: 1096 domain containing ring finger 3 PLXDC1//plexin NM_020405 SEQ ID NO: 1097 SEQ ID NO: 1098 domain containing 1 PP13004//hypothetical ENST00000381493 SEQ ID NO: 1099 SEQ ID NO: 1100 LOC402481 PSAT1// NM_058179 SEQ ID NO: 1101 SEQ ID NO: 1102 phosphoserine aminotransferase 1 PTPRE//protein NM_006504 SEQ ID NO: 1103 SEQ ID NO: 1104 tyrosine phosphatase, receptor type, E RASSF2//Ras NM_014737 SEQ ID NO: 1105 SEQ ID NO: 1106 association (RaIGDS RCAN3//RCAN family NM_013441 SEQ ID NO: 1107 SEQ ID NO: 1108 member 3 RCSD//RCSD NM_052862 SEQ ID NO: 1109 SEQ ID NO: 1110 domain containing 1 RGS10//regulator of NM_001005339 SEQ ID NO: 1111 SEQ ID NO: 1112 G-protein signaling 10 RGS9//regulator of G- NM_003835 SEQ ID NO: 1113 SEQ ID NO: 1114 protein signaling 9 RHOBTB1//Rho- NM_001242359, SEQ ID NO: 1115 SEQ ID NO: 1116 related BT domain containing 1 RNASE3// NM_002935 SEQ ID NO: 1117 SEQ ID NO: 1118 ribonuclease, RNase A family, 3 (eosinophilcationic protein) RTKN2//rhotekin 2 NM_145307 SEQ ID NO: 1119 SEQ ID NO: 1120 RUNX2//runt-related NM_001024630 SEQ ID NO: 1121 SEQ ID NO: 1122 transcription factor 2 SCML4//sex comb on NM_198081 SEQ ID NO: 1123 SEQ ID NO: 1124 midleg-like 4 (Drosophila) SEPT3//septin 3 NM_019106 SEQ ID NO: 1125 SEQ ID NO: 1126 SH2D1A//SH2 NM_002351 SEQ ID NO: 1127 SEQ ID NO: 1128 domain protein 1A SLC16A9//solute NM_194298 SEQ ID NO: 1129 SEQ ID NO: 1130 carrier family 16, member 9 (monocarboxylic acid transporter 9) SLCO4A1//solute NM_016354 SEQ ID NO: 1131 SEQ ID NO: 1132 carrier organic anion transporter family, member 4A1 SMAS// AK289851 SEQ ID NO: 1133 SEQ ID NO: 1134 glucuronidase, beta pseudogene ST3GAL5//ST3 beta- NM_003896 SEQ ID NO: 1135 SEQ ID NO: 1136 galactoside alpha-2,3- sialyltransferase 5 SULF2 //sulfatase 2 NM_018837 SEQ ID NO: 1137 SEQ ID NO: 1138 TCF7//transcription NM_201634 SEQ ID NO: 1139 SEQ ID NO: 1140 factor 7 (T-cell specific, HMG-box) TMEM176A// NM_018487 SEQ ID NO: 1141 SEQ ID NO: 1142 transmembrane protein 176A TMEM45A// NM_018004 SEQ ID NO: 1143 SEQ ID NO: 1144 transmembrane protein 45A TRAF3IP3//TRAF3 NM_025228 SEQ ID NO: 1145 SEQ ID NO: 1146 interacting protein 3 TREM2//triggering NM_018965 SEQ ID NO: 1147 SEQ ID NO: 1148 receptor expressed on myeloid cells 2 TYR//tyrosinase NM_000372 SEQ ID NO: 1149 SEQ ID NO: 1150 (oculocutaneous albinism IA) UBASH3A//ubiquitin NM_018961 SEQ ID NO: 1151 SEQ ID NO: 1152 associated and SH3 domain containing, A

TABLE-US-00005 TABLE 2 Genes Down-requlated Upon STX-100 Administration Nucleotide Protein gene_assignment Genbank No. Sequence Sequence // GPR82 // G protein- NM_080817 SEQ ID NO: 463 SEQ ID NO: 464 coupled receptor 82 // ENPP1 // NM_006208 SEQ ID NO: 465 SEQ ID NO: 466 ectonucleotide pyrophosphatase/phos phodiesterase 1 // THBS1 // NM_003246 SEQ ID NO: 467 SEQ ID NO: 468 thrombospondin 1 // SYDE2 // synapse NM_032184 SEQ ID NO: 469 SEQ ID NO: 470 defective 1, Rho GTPase, homolog 2 (C. elegans) // IGSF2 // NM_004258 SEQ ID NO: 471 SEQ ID NO: 472 immunoglobulin superfamily, member 2 // RETN // resistin NM_020415 SEQ ID NO: 473 SEQ ID NO: 474 // GPR116 // G protein- NM_015234 SEQ ID NO: 475 SEQ ID NO: 476 coupled receptor 116 // TRHDE // NM_013381 SEQ ID NO: 477 SEQ ID NO: 478 thyrotropin-releasing hormone degrading enzyme // CACNB4 // calcium NM_000726 SEQ ID NO: 479 SEQ ID NO: 480 channel, voltage- dependent, beta 4 subunit // PLXDC2 // plexin NM_032812 SEQ ID NO: 481 SEQ ID NO: 482 domain containing 2 // SMC6 // structural NM_001142286 SEQ ID NO: 483 SEQ ID NO: 484 maintenance of chromosomes 6 // OLR1 // oxidized low NM_002543 SEQ ID NO: 485 SEQ ID NO: 486 density lipoprotein (lectin-like) receptor 1 // SERPINE1 // serpin NM_000602 SEQ ID NO: 487 SEQ ID NO: 488 peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 // MEST // mesoderm NM_002402 SEQ ID NO: 489 SEQ ID NO: 490 specific transcript homolog (mouse) // LY75 // lymphocyte NM_002349 SEQ ID NO: 491 SEQ ID NO: 492 antigen 75 // PRKAR2B // protein NM_002736 SEQ ID NO: 493 SEQ ID NO: 494 kinase, cAMP- dependent, regulatory, type II, beta // TCF7L2 // NM_001146274 SEQ ID NO: 495 SEQ ID NO: 496 transcription factor 7- like 2 (T-cell specific, HMG-box) // CLEC5A // C-type NM_013252 SEQ ID NO: 497 SEQ ID NO: 498 lectin domain family 5, member A // AWAT2 // acyl-CoA NM_001002254 SEQ ID NO: 499 SEQ ID NO: 500 wax alcohol acyltransferase 2 // B3GNT5 // UDP- NM_032047 SEQ ID NO: 501 SEQ ID NO: 502 GlcNAc:betaGal beta- 1,3-N- acetylglucosaminyltransferase 5 // MICAL3 // NM_015241 SEQ ID NO: 503 SEQ ID NO: 504 microtubule associated monoxygenase, calponin and LIM domain containing 3 // PLAC8 // placenta- NM_016619 SEQ ID NO: 505 SEQ ID NO: 506 specific 8 // SLC11A1 // solute NM_000578 SEQ ID NO: 507 SEQ ID NO: 508 carrier family 11 (proton-coupled divalent metal ion transporters), member 1 // HSF5 // heat shock NM_001080439 SEQ ID NO: 509 SEQ ID NO: 510 transcription factor family member 5// 17q22 // 124535 /// ENST00000323777 // HSF5 // heat shock transcription factor family member 5 // EDIL3 // EGF-like NM_005711 SEQ ID NO: 511 SEQ ID NO: 512 repeats and discoidin I-like domains 3 // GLRB // glycine NM_000824 SEQ ID NO: 513 SEQ ID NO: 514 receptor, beta // GPR120 // G protein- NM_181745 SEQ ID NO: 515 SEQ ID NO: 516 coupled receptor 120 // EMR1 // egf-like NM_001974 SEQ ID NO: 517 SEQ ID NO: 518 module containing, mucin-like, hormone receptor-like 1 // CHI3L1 // chitinase NM_001276 SEQ ID NO: 519 SEQ ID NO: 520 3-like 1 (cartilage glycoprotein-39) // RTN1 // reticulon 1 NM_021136 SEQ ID NO: 521 SEQ ID NO: 522 // GCA // grancalcin, NM_012198 SEQ ID NO: 523 SEQ ID NO: 524 EF-hand calcium binding protein // CLIP4 // CAP-GLY NM_024692 SEQ ID NO: 525 SEQ ID NO: 526 domain containing linker protein family, member 4 // SGMS1 // NM_147156 SEQ ID NO: 527 SEQ ID NO 528: sphingomyelin synthase 1 // FN1 // fibronectin 1 NM_212482 SEQ ID NO: 529 SEQ ID NO: 530 // FAM9C // family with NM_174901 SEQ ID NO: 531 SEQ ID NO: 532 sequence similarity 9, member C // FER1L6 // fer-1-like NM_001039112 SEQ ID NO: 533 SEQ ID NO: 534 6 (C. elegans) // PGM5P2 // NR_002836 SEQ ID NO: 535 N/A phosphoglucomutase 5 pseudogene 2 // MMD // monocyte to NM_012329 SEQ ID NO: 536 SEQ ID NO: 537 macrophage differentiation- associated // SEMA3D // sema NM_152754 SEQ ID NO: 538 SEQ ID NO: 539 domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D // GEN1 // Gen NM_182625 SEQ ID NO: 540 SEQ ID NO: 541 homolog 1, endonuclease (Drosophila) // PGM5P2 // NR_002836 SEQ ID NO: 542 N/A phosphoglucomutase 5 pseudogene 2 // ALOX5 // NM_000698 SEQ ID NO: 543 SEQ ID NO: 544 arachidonate 5- lipoxygenase // CARD17 // caspase NM_001007232 SEQ ID NO: 545 SEQ ID NO: 546 recruitment domain family, member 17 // ITGA6 // integrin, NM_000210 SEQ ID NO: 547 SEQ ID NO: 548 alpha 6 // CAMP // cathelicidin NM_004345 SEQ ID NO: 549 SEQ ID NO: 550 antimicrobial peptide // MTHFD1L // NM_015440 SEQ ID NO: 551 SEQ ID NO: 552 methylenetetrahydrofol ate dehydrogenase (NADP+ dependent) 1-like // MINK1 // misshapen- NM_153827 SEQ ID NO: 553 SEQ ID NO: 554 like kinase 1 (zebrafish) // FHL1 // four and a NM_001159702 SEQ ID NO: 555 SEQ ID NO: 556 half LIM domains 1 — // GPAM // glycerol-3- NM_020918 SEQ ID NO: 557 SEQ ID NO: 558 phosphate acyltransferase, mitochondrial // AMIGO2 // adhesion NM_001143668 SEQ ID NO: 559 SEQ ID NO: 560 molecule with Ig-like domain 2 // TREM1 // triggering NM_018643 SEQ ID NO: 561 SEQ ID NO: 562 receptor expressed on myeloid cells 1 // STAP1 // signal NM_012108 SEQ ID NO: 563 SEQ ID NO: 564 transducing adaptor family member 1 // ABCG1 //ATP- NM_207627 SEQ ID NO: 565 SEQ ID NO: 566 binding cassette, sub- family G (WHITE), member 1 // PRSS12 // protease, NM_003619 SEQ ID NO: 567 SEQ ID NO: 568 serine, 12 (neurotrypsin, motopsin) // NIACR2 // niacin NM_006018 SEQ ID NO: 569 SEQ ID NO: 570 receptor 2 // PPARG // NM_138712 SEQ ID NO: 571 SEQ ID NO: 572 peroxisome proliferator-activated receptor gamma // ENO3 // enolase 3 NM_001976 SEQ ID NO: 573 SEQ ID NO: 574 (beta, muscle) // DLEU2L // deleted in NR_002771 SEQ ID NO: 575 N/A lymphocytic leukemia 2-like // NOSTRIN // nitric NM_001039724 SEQ ID NO: 576 SEQ ID NO: 577 oxide synthase trafficker // KCNA3 // potassium NM_002232 SEQ ID NO: 578 SEQ ID NO: 579 voltage-gated channel, shaker-related subfamily, member 3 // CGNL1 // cingulin- NM_032866 SEQ ID NO: 580 SEQ ID NO: 581 like 1 // MATN2 // matrilin 2 NM_002380 SEQ ID NO: 582 SEQ ID NO: 583 // CLEC4D // C-type NM_080387 SEQ ID NO: 584 SEQ ID NO: 585 lectin domain family 4, member D // CENPV // NM_181716 SEQ ID NO: 586 SEQ ID NO: 587 centromere protein V // RAB13 // RAB13, NM_002870 SEQ ID NO: 588 SEQ ID NO: 589 member RAS oncogene family // OLFML3 // NM_020190 SEQ ID NO: 590 SEQ ID NO: 591 olfactomedin-like 3 // KCNMB1 // NM_004137 SEQ ID NO: 592 SEQ ID NO: 593 potassium large conductance calcium- activated channel, subfamily M, beta member 1 // FPR1 // formyl NM_002029 SEQ ID NO: 594 SEQ ID NO: 595 peptide receptor 1 // DST // dystonin NM_001144769 SEQ ID NO: 596 SEQ ID NO: 597 — // CD1D // CD1d NM_001766 SEQ ID NO: 598 SEQ ID NO: 599 molecule // PECAM1 // NM_000442 SEQ ID NO: 600 SEQ ID NO: 601 platelet/endothelial cell adhesion molecule // DDHD1 // DDHD NM_001160148 SEQ ID NO: 602 SEQ ID NO: 603 domain containing 1 // KLHDC8B // kelch NM_173546 SEQ ID NO: 604 SEQ ID NO: 605 domain containing 8B // ATP8B4 // ATPase, NM_024837 SEQ ID NO: 606 SEQ ID NO: 607 class I, type 8B, member 4 // GPD1 // glycerol-3- NM_005276 SEQ ID NO: 608 SEQ ID NO: 609 phosphate dehydrogenase 1 (soluble) // MCF2L2 // MCF.2 NM_015078 SEQ ID NO: 610 SEQ ID NO: 611 cell line derived transforming sequence-like 2 // SVIL // supervillin NM_021738 SEQ ID NO: 612 SEQ ID NO: 613 // ICAM3 // intercellular NM_002162 SEQ ID NO: 614 SEQ ID NO: 615 adhesion molecule 3 // NLRC4 // NLR NM_021209 SEQ ID NO: 616 SEQ ID NO: 617 family, CARD domain containing 4 // SLC25A16 // solute NM_152707 SEQ ID NO: 618 SEQ ID NO: 619 carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 //CD163 //CD163 NM_004244 SEQ ID NO: 620 SEQ ID NO: 621 molecule // GPR162 // G protein- NM_019858 SEQ ID NO: 622 SEQ ID NO: 623 coupled receptor 162 // RAB30 // RAB30, NM_014488 SEQ ID NO: 624 SEQ ID NO: 625 member RAS oncogene family // SMAD7 // SMAD NM_005904 SEQ ID NO: 626 SEQ ID NO: 627 family member 7 // HBEGF // heparin- NM_001945 SEQ ID NO: 628 SEQ ID NO: 629 binding EGF-like growth factor // RHBDD2 // rhomboid NM_001040457 SEQ ID NO: 630 SEQ ID NO: 631 domain containing 2 // GPR116 // G protein- NM_015234 SEQ ID NO: 632 SEQ ID NO: 633 coupled receptor 116 // ITPR1 // inositol NM_001099952 SEQ ID NO: 634 SEQ ID NO: 635 1,4,5-triphosphate receptor, type 1 // PIWIL1 // piwi-like 1 NM_004764 SEQ ID NO: 636 SEQ ID NO: 637 (Drosophila) // TANC2 // NM_025185 SEQ ID NO: 638 SEQ ID NO: 639 tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 2 // PHGDH // NM_006623 SEQ ID NO: 640 SEQ ID NO: 641 phosphoglycerate dehydrogenase // MTHFS // 5,10- NM_006441 SEQ ID NO: 642 SEQ ID NO: 643 methenyltetrahydrofolate synthetase (5- formyltetrahydrofolatecyclo- ligase) // PGM5 // NM_021965 SEQ ID NO: 644 SEQ ID NO: 645 phosphoglucomutase 5 — // CHI3L2 // chitinase NM_001025199 SEQ ID NO: 646 SEQ ID NO: 647 3-like 2 // C19orf59 // NM_174918 SEQ ID NO: 648 SEQ ID NO: 649 chromosome 19 open reading frame 59 // CDH1 // cadherin 1, NM_004360 SEQ ID NO: 650 SEQ ID NO: 651 type 1, E-cadherin (epithelial) — // LDLRAP1 // low NM_015627 SEQ ID NO: 652 SEQ ID NO: 653 density lipoprotein receptor adaptor protein 1 // PANX1 // pannexin 1 NM_015368 SEQ ID NO: 654 SEQ ID NO: 655 // DGAT2 // NM_032564 SEQ ID NO: 656 SEQ ID NO: 657 diacylglycerol O- acyltransferase homolog 2 (mouse) // ABHD5 // NM_016006 SEQ ID NO: 658 SEQ ID NO: 659 abhydrolase domain containing 5 // STX6 // syntaxin 6 NM_005819 SEQ ID NO: 660 SEQ ID NO: 661 // MCTP1 // multiple NM_024717 SEQ ID NO: 662 SEQ ID NO: 663 C2 domains, transmembrane 1 // CCRL1 // chemokine NM_178445 SEQ ID NO: 664 SEQ ID NO: 665 (C-C motif) receptor- like 1 // FRMD4A // FERM NM_018027 SEQ ID NO: 666 SEQ ID NO: 667 domain containing 4A // CD300LD // CD300 NM_001115152 SEQ ID NO: 668 SEQ ID NO: 669 molecule-like family member d // SIRPB2 // signal- NM_001122962 SEQ ID NO: 670 SEQ ID NO: 671 regulatory protein beta 2 // C9orf150 // NM_203403 SEQ ID NO: 672 SEQ ID NO: 673 chromosome 9 open reading frame 150 // TMEM65 // NM_194291 SEQ ID NO: 674 SEQ ID NO: 675 transmembrane protein 65 // CDC42EP3 // NM_006449 SEQ ID NO: 676 SEQ ID NO: 677 CDC42 effector protein (Rho GTPase binding) 3 // UBASH3B // NM_032873 SEQ ID NO: 678 SEQ ID NO: 679 ubiquitin associated and SH3 domain containing, B // TTC39B // NM_152574 SEQ ID NO: 680 SEQ ID NO: 681 tetratricopeptide repeat domain 39B // TGM2 // NM_004613 SEQ ID NO: 682 SEQ ID NO: 683 transglutaminase 2 (C polypeptide, protein- glutamine-gamma- glutamyltransferase) // KIAA1598 // NM_001127211 SEQ ID NO: 684 SEQ ID NO: 685 KIAA1598 // FCGR1B // Fc NM_001017986 SEQ ID NO: 686 SEQ ID NO: 687 fragment of IgG, high affinity Ib, receptor (CD64) // ALDH2 // aldehyde NM_000690 SEQ ID NO: 688 SEQ ID NO: 689 dehydrogenase 2 family (mitochondrial) // TECR // trans-2,3- NM_138501 SEQ ID NO: 690 SEQ ID NO: 691 enoyl-CoA reductase // LAPTM4B // NM_018407 SEQ ID NO: 692 SEQ ID NO: 693 lysosomal protein transmembrane 4 beta // DEPDC6 // DEP NM_022783 SEQ ID NO: 694 SEQ ID NO: 695 domain containing 6 // FCGR1A // Fc NM_000566 SEQ ID NO: 696 SEQ ID NO: 697 fragment of IgG, high affinity Ia, receptor (CD64) // CRYBG3 // beta- NM_153605 SEQ ID NO: 698 SEQ ID NO: 699 gamma crystallin domain containing 3 // LILRA5 // leukocyte NM_021250 SEQ ID NO: 700 SEQ ID NO: 701 immunoglobulin-like receptor, subfamily A (with TM domain), member 5 // FCGR1A // Fc NM_000566 SEQ ID NO: 702 SEQ ID NO: 703 fragment of IgG, high affinity Ia, receptor (CD64) // PDCL // phosducin-like NM_005388 SEQ ID NO: 704 SEQ ID NO: 705 // DGKH // NM_178009 SEQ ID NO: 706 SEQ ID NO: 707 diacylglycerol kinase, eta // FRK // fyn-related kinase NM_002031 SEQ ID NO: 708 SEQ ID NO: 709 ENST00000367321 // ENST00000367321 SEQ ID NO: 710 SEQ ID NO: 711 MTHFD1L // methylenetetrahydrofol ate dehydrogenase (NADP+ dependent) 1- like // POPDC3 // popeye NM_022361 SEQ ID NO: 712 SEQ ID NO: 713 domain containing 3 // AIM2 // absent in NM_004833 SEQ ID NO: 714 SEQ ID NO: 715 melanoma 2 // CYSLTR2 // cysteinyl NM_020377 SEQ ID NO: 716 SEQ ID NO: 717 leukotriene receptor 2 // RP5-1022P6.2 // NM_019593 SEQ ID NO: 718 SEQ ID NO: 719 hypothetical protein KIAA1434 // GPR124 // G protein- NM_032777 SEQ ID NO: 720 SEQ ID NO: 721 coupled receptor 124 // SVIP // small NM_148893 SEQ ID NO: 722 SEQ ID NO: 723 VCP/p97-interacting protein // GPHN // gephyrin NM_020806 SEQ ID NO: 724 SEQ ID NO: 725 // HK3 // hexokinase 3 NM_002115 SEQ ID NO: 726 SEQ ID NO: 727 (white cell) // ALOX5AP // NM_001629 SEQ ID NO: 728 SEQ ID NO: 729 arachidonate 5- lipoxygenase- activating protein // NCF1 // neutrophil NM_000265 SEQ ID NO: 730 SEQ ID NO: 731 cytosolic factor 1 // NGFRAP1 //nerve NM_206917 SEQ ID NO: 732 SEQ ID NO: 733 growth factor receptor (TNFRSF16) associated protein 1 // LGR4 // leucine-rich NM_018490 SEQ ID NO: 734 SEQ ID NO: 735 repeat-containing G protein-coupled receptor 4 // CABLES1 // Cdk5 NM_138375 SEQ ID NO: 736 SEQ ID NO: 737 and Abl enzyme substrate 1 // NCF1 // neutrophil NM_000265 SEQ ID NO: 738 SEQ ID NO: 739 cytosolic factor 1 // FLOT2 // flotillin 2 NM_004475 SEQ ID NO: 740 SEQ ID NO: 741 // CDC42BPB // NM_006035 SEQ ID NO: 742 SEQ ID NO: 743 CDC42 binding protein kinase beta (DMPK- like) // LRP1 // low density NM_002332 SEQ ID NO: 744 SEQ ID NO: 745 lipoprotein-related protein 1 (alpha-2- macroglobulin receptor) // C17orf76 // NM_001113567 SEQ ID NO: 746 SEQ ID NO: 747 chromosome 17 open reading frame 76 // TMEM150B // NM_001085488 SEQ ID NO: 748 SEQ ID NO: 749 transmembrane protein 150B // ENTPD3 // NM_001248 SEQ ID NO: 750 SEQ ID NO: 751 ectonucleoside triphosphate diphosphohydrolase 3 // HLCS // NM_000411 SEQ ID NO: 752 SEQ ID NO: 753 holocarboxylase synthetase (biotin- (proprionyl-Coenzyme A-carboxylase (ATP- hydrolysing)) ligase) // DENND1B // NM_001142795 SEQ ID NO: 754 SEQ ID NO: 755 DENN/MADD domain containing 1B // MYO6 // myosin VI NM_004999 SEQ ID NO: 756 SEQ ID NO: 757 // TXNDC16 // NM_020784 SEQ ID NO: 758 SEQ ID NO: 759 thioredoxin domain containing 16 // FLVCR2 // feline NM_017791 SEQ ID NO: 760 SEQ ID NO: 761 leukemia virus subgroup C cellular receptor family, member 2 // ABCC4 // ATP- NM_005845 SEQ ID NO: 762 SEQ ID NO: 763 binding cassette, sub- family C (CFTR/MRP), member 4 // PFKFB3 // 6- NM_004566 SEQ ID NO: 764 SEQ ID NO: 765 phosphofructo-2- kinase/fructose-2,6- biphosphatase 3 // SLC36A4 // solute NM_152313 SEQ ID NO: 766 SEQ ID NO: 767 carrier family 36 (proton/amino acid symporter), member 4 // CLEC4E // C-type NM_014358 SEQ ID NO: 768 SEQ ID NO: 769 lectin domain family 4, member E // CD302 // CD302 NM_014880 SEQ ID NO: 770 SEQ ID NO: 771 molecule // SFRP2 // secreted NM_003013 SEQ ID NO: 772 SEQ ID NO: 773 frizzled-related protein 2 // NCF1 // neutrophil NM_000265 SEQ ID NO: 774 SEQ ID NO: 775 cytosolic factor 1 // MC3R // NM_019888 SEQ ID NO: 776 SEQ ID NO: 777 melanocortin 3 receptor // NP // nucleoside NM_000270 SEQ ID NO: 778 SEQ ID NO: 779 phosphorylase // SLC9A7 // solute NM_032591 SEQ ID NO: 780 SEQ ID NO: 781 carrier family 9 (sodium/hydrogen exchanger), member 7 // NID1 // nidogen 1 NM_002508 SEQ ID NO: 782 SEQ ID NO: 783 // GPRIN3 // GPRIN NM_198281 SEQ ID NO: 784 SEQ ID NO: 785 family member 3 // GLIPR2 // GLI NM_022343 SEQ ID NO: 786 SEQ ID NO: 787 pathogenesis-related 2 // PLEKHH2 // NM_172069 SEQ ID NO: 788 SEQ ID NO: 789 pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 // MERTK // c-mer NM_006343 SEQ ID NO: 790 SEQ ID NO: 791 proto-oncogene tyrosine kinase ENST00000367321 // ENST00000367321 SEQ ID NO: 792 SEQ ID NO: 793 MTHFD1L // methylenetetrahydrofol ate dehydrogenase (NADP+ dependent) 1- like // AK3L1 // adenylate NM_001005353 SEQ ID NO: 794 SEQ ID NO: 795 kinase 3-like 1 // RASA1 // RAS p21 NM_002890 SEQ ID NO: 796 SEQ ID NO: 797 protein activator (GTPase activating protein) 1 — // CXCL16 // NM_022059 SEQ ID NO: 798 SEQ ID NO: 799 chemokine (C-X-C motif) ligand 16 // AXL // AXL receptor NM_021913 SEQ ID NO: 800 SEQ ID NO: 801 tyrosine kinase // PDE3B // NM_000922 SEQ ID NO: 802 SEQ ID NO: 803 phosphodiesterase 3B, cGMP-inhibited ENST00000367321 // ENST00000367321 SEQ ID NO: 792 SEQ ID NO: 793 MTHFD1L // methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1- like // LONRF3 // LON NM_001031855 SEQ ID NO: 804 SEQ ID NO: 805 peptidase N-terminal domain and ring finger 3 // PION // pigeon NM_017439 SEQ ID NO: 806 SEQ ID NO: 807 homolog (Drosophila) // BHLHE41 // basic NM_030762 SEQ ID NO: 808 SEQ ID NO: 809 helix-loop-helix family, member e41 // TLN2 // talin 2 NM_015059 SEQ ID NO: 810 SEQ ID NO: 811 // SPNS1 // spinster NM_032038 SEQ ID NO: 812 SEQ ID NO: 813 homolog 1 (Drosophila) // MEFV // NM_000243 SEQ ID NO: 814 SEQ ID NO: 815 Mediterranean fever // FAM69A //family NM_001006605 SEQ ID NO: 816 SEQ ID NO: 817 with sequence similarity 69, member A // LRRFIP1 // leucine NM_001137550 SEQ ID NO: 818 SEQ ID NO: 819 rich repeat (in FLII) interacting protein 1 // ATP10A // ATPase, NM_024490 SEQ ID NO: 820 SEQ ID NO: 821 class V, type 10A — // EGLN3 // egl nine NM_022073 SEQ ID NO: 822 SEQ ID NO: 823 homolog 3 (C. elegans) // FGD2 // FYVE, NM_173558 SEQ ID NO: 824 SEQ ID NO: 825 RhoGEF and PH domain containing 2 // LSM6 // LSM6 NM_007080 SEQ ID NO: 826 SEQ ID NO: 827 homolog, U6 small nuclear RNA associated (S. cerevisiae) // MANBA // NM_005908 SEQ ID NO: 828 SEQ ID NO: 829 mannosidase, beta A, lysosomal // CD300LF // CD300 NM_139018 SEQ ID NO: 830 SEQ ID NO: 831 molecule-like family member f // C1orf38 // NM_001105556 SEQ ID NO: 832 SEQ ID NO: 833 chromosome 1 open reading frame 38 // IR52 // insulin NM_003749 SEQ ID NO: 834 SEQ ID NO: 835 receptor substrate 2 // CEBPB // NM_005194 SEQ ID NO: 836 SEQ ID NO: 837 CCAAT/enhancer binding protein (C/EBP), beta // RGL3 // ral guanine NM_001161616 SEQ ID NO: 838 SEQ ID NO: 839 nucleotide dissociation stimulator-like 3 // HIPK2 // NM_022740 SEQ ID NO: 840 SEQ ID NO: 841 homeodomain interacting protein kinase 2 // SLC25A37 // solute NM_016612 SEQ ID NO: 842 SEQ ID NO: 843 carrier family 25, member 37 // NRIP1 // nuclear NM_003489 SEQ ID NO: 844 SEQ ID NO: 845 receptor interacting protein 1 // PION // pigeon NM_017439 SEQ ID NO: 846 SEQ ID NO: 847 homolog (Drosophila) // TGFBR2 // NM_001024847 SEQ ID NO: 848 SEQ ID NO: 849 transforming growth factor, beta receptor II (70/80 kDa) // UBE2CBP // NM_198920 SEQ ID NO: 850 SEQ ID NO: 851 ubiquitin-conjugating enzyme E2C binding protein // PCCA // propionyl NM_000282 SEQ ID NO: 852 SEQ ID NO: 853 Coenzyme A carboxylase, alpha polypeptide // TIMD4 // T-cell NM_138379 SEQ ID NO: 854 SEQ ID NO: 855 immunoglobulin and mucin domain containing 4 // NIACR1 // niacin NM_177551 SEQ ID NO: 856 SEQ ID NO: 857 receptor 1 — // IL28RA // interleukin NM_170743 SEQ ID NO: 858 SEQ ID NO: 859 28 receptor, alpha (interferon, lambda receptor) // RARA // retinoic acid NM_000964 SEQ ID NO: 860 SEQ ID NO: 861 receptor, alpha // ACSL4 // acyl-CoA NM_022977 SEQ ID NO: 862 SEQ ID NO: 863 synthetase long-chain family member 4 // SGMS2 // NM_001136258 SEQ ID NO: 864 SEQ ID NO: 865 sphingomyelin synthase 2 // GMPR // guanosine NM_006877 SEQ ID NO: 866 SEQ ID NO: 867 monophosphate reductase // SKIL // SKI-like NM_005414 SEQ ID NO: 868 SEQ ID NO: 869 oncogene // HIP1 // huntingtin NM_005338 SEQ ID NO: 870 SEQ ID NO: 871 interacting protein 1 // EXOC5 // exocyst NM_006544 SEQ ID NO: 872 SEQ ID NO: 873 complex component 5 // ZC3H13 // zinc finger NM_015070 SEQ ID NO: 874 SEQ ID NO: 875 CCCH-type containing 13 // IMPAD1 // inositol NM_017813 SEQ ID NO: 876 SEQ ID NO: 877 monophosphatase domain containing 1 // SEPT4 // septin 4 NM_080415 SEQ ID NO: 879 SEQ ID NO: 880 // SLC1A5 // solute NM_005628 SEQ ID NO: 881 SEQ ID NO: 882 carrier family 1 (neutral amino acid transporter), member 5 // EML4 // echinoderm NM_019063 SEQ ID NO: 883 SEQ ID NO: 884 microtubule associated protein like 4 // ANPEP // alanyl NM_001150 SEQ ID NO: 885 SEQ ID NO: 886 (membrane) aminopeptidase //XG // Xg blood group NM_001141919 SEQ ID NO: 887 SEQ ID NO: 888 // PPP1R13B // protein NM_015316 SEQ ID NO: 889 SEQ ID NO: 890 phosphatase 1, regulatory (inhibitor) subunit 13B // IL1RAP // interleukin NM_002182 SEQ ID NO: 891 SEQ ID NO: 892 1 receptor accessory protein // AR // androgen NM_000044 SEQ ID NO: 893 SEQ ID NO: 894 receptor // SLC25A33 // solute NM_032315 SEQ ID NO: 895 SEQ ID NO: 896 carrier family 25, member 33 // C11orf59 // BC001706 SEQ ID NO: 897 SEQ ID NO: 898 chromosome 11 open reading frame 59 // ABHD2 // NM_007011 SEQ ID NO: 899 SEQ ID NO: 900 abhydrolase domain containing 2 // DENND5A // NM_015213 SEQ ID NO: 901 SEQ ID NO: 902 DENN/MADD domain containing 5A // KCNJ15 // potassium NM_002243 SEQ ID NO: 903 SEQ ID NO: 904 inwardly-rectifying channel, subfamily J, member 15 // CHRNA5 // NM_000745 SEQ ID NO: 905 SEQ ID NO: 906 cholinergic receptor, nicotinic, alpha 5 // IRAK3 // interleukin-1 NM_007199 SEQ ID NO: 907 SEQ ID NO: 908 receptor-associated kinase 3 // SYTL4 // NM_080737 SEQ ID NO: 909 SEQ ID NO: 910 synaptotagmin-like 4 // SNORD38B // small NR_001457 SEQ ID NO: 911 N/A nucleolar RNA, C/D box 38B // LRRFIP1 // leucine NM_001137550 SEQ ID NO: 912 SEQ ID NO: 913 rich repeat (in FLII) interacting protein 1 // ZNF124 // zinc finger NM_003431 SEQ ID NO: 914 SEQ ID NO: 915 protein 124 // CLEC12A // C-type NM_138337 SEQ ID NO: 916 SEQ ID NO: 917 lectin domain family 12, member A // CBL // Cas-Br-M NM_005188 SEQ ID NO: 918 SEQ ID NO: 919 (murine) ecotropic retroviral transforming sequence // MMP14 // matrix NM_004995 SEQ ID NO: 920 SEQ ID NO: 921 metallopeptidase 14 (membrane-inserted) // CCDC23 // coiled- NM_199342 SEQ ID NO: 922 SEQ ID NO: 923 coil domain containing 23 // TBC1D2B // TBC1 NM_144572 SEQ ID NO: 924 SEQ ID NO: 925 domain family, member 2B // PAK1 //p21 protein NM_001128620 SEQ ID NO: 926 SEQ ID NO: 927 (Cdc42/Rac)-activated kinase 1 // PAQR5 // progestin NM_001104554 SEQ ID NO: 928 SEQ ID NO: 929 and adipoQ receptor family member V // BNC2 // basonuclin 2 NM_017637 SEQ ID NO: 930 SEQ ID NO: 931 // DENND1B // NM_144977 SEQ ID NO: 932 SEQ ID NO: 933 DENN/MADD domain containing 1B // PPP2R3A // protein NM_002718 SEQ ID NO: 934 SEQ ID NO: 935 phosphatase 2 (formerly 2A), regulatory subunit B″, alpha // ALDOC // aldolase NM_005165 SEQ ID NO: 936 SEQ ID NO: 937 C, fructose- bisphosphate // KCTD10 // NM_031954 SEQ ID NO: 938 SEQ ID NO: 939 potassium channel tetramerisation domain containing 10 // BIN2 // bridging NM_016293 SEQ ID NO: 940 SEQ ID NO: 941 integrator 2 // FAM82A2 //family NM_018145 SEQ ID NO: 942 SEQ ID NO: 943 with sequence similarity 82, member A2 // TNIP3 // TNFAIP3 NM_024873 SEQ ID NO: 944 SEQ ID NO: 945 interacting protein 3 // FGD4 // FYVE, NM_139241 SEQ ID NO: 946 SEQ ID NO: 947 RhoGEF and PH domain containing 4 // FAM89A //family NM_198552 SEQ ID NO: 948 SEQ ID NO: 949 with sequence similarity 89, member A // SNX10 // sorting NM_013322 SEQ ID NO: 950 SEQ ID NO: 951 nexin 10 // FBXO9 // F-box AK095307 SEQ ID NO: 952 N/A protein 9 // PLCB2 // NM_004573 SEQ ID NO: 953 SEQ ID NO: 954 phospholipase C, beta 2 // HACL1 // 2- NM_012260 SEQ ID NO: 955 SEQ ID NO: 956 hydroxyacyl-CoA lyase 1 // KIAA0564 // NM_015058 SEQ ID NO: 957 SEQ ID NO: 958 KIAA0564 // MNDA // myeloid cell NM_002432 SEQ ID NO: 959 SEQ ID NO: 960 nuclear differentiation antigen // ACOT11 // acyl-CoA NM_147161 SEQ ID NO: 961 SEQ ID NO: 962 thioesterase 11 // MAP3K8 // mitogen- NM_005204 SEQ ID NO: 963 SEQ ID NO: 964 activated protein kinase kinase kinase 8 // C5orf27 // NR_026936 SEQ ID NO: 965 N/A chromosome 5 open reading frame 27 // CD14 // CD14 NM_ 000591 SEQ ID NO: 966 SEQ ID NO: 967 molecule // FMNL2 // form in-like 2 NM_052905 SEQ ID NO: 968 SEQ ID NO: 969 // FMNL3 // formin-like 3 NM_175736 SEQ ID NO: 970 SEQ ID NO: 971 // PLEK // pleckstrin NM_002664 SEQ ID NO: 972 SEQ ID NO: 973 // CXCR7 // chemokine NM_020311 SEQ ID NO: 974 SEQ ID NO: 975 (C-X-C motif) receptor 7 // PLAUR // NM_002659 SEQ ID NO: 976 SEQ ID NO: 977 plasminogen activator, urokinase receptor // BTK // Bruton NM_000061 SEQ ID NO: 978 SEQ ID NO: 979 agammaglobulinemia tyrosine kinase //VAMP4 // vesicle- NM_003762 SEQ ID NO: 980 SEQ ID NO: 981 associated membrane protein 4 // CCIN // calicin NM_005893 SEQ ID NO: 982 SEQ ID NO: 983 // ACTN1 // actinin ,alpha 1 NM_001130004 SEQ ID NO: 984 SEQ ID NO: 985 — // DHCR7 // 7- NM_001360 SEQ ID NO: 986 SEQ ID NO: 987 dehydrocholesterol reductase // SYT17 // NM_016524 SEQ ID NO: 988 SEQ ID NO: 989 synaptotagmin XVII // TECR // trans-2,3- NM_138501 SEQ ID NO: 990 SEQ ID NO: 991 enoyl-CoA reductase // SLC7A7 // solute NM_003982 SEQ ID NO: 992 SEQ ID NO: 993 carrier family 7 (cationic amino acid transporter, y+ system), member 7 // APOC1 // NM_001645 SEQ ID NO: 994 SEQ ID NO: 995 apolipoprotein C-I // ECHDC1 // enoyl NM_001002030 SEQ ID NO: 996 SEQ ID NO: 997 Coenzyme A hydratase domain containing 1 ACVRL1//activin A NM_000020 SEQ ID NO: 1153 SEQ ID NO: 1154 receptor type II-like 1 CASP9//caspase 9, NM_001229 SEQ ID NO: 1155 SEQ ID NO: 1156 apoptosis-related cysteine peptidase EGR2//early growth NM_000399 SEQ ID NO: 1157 SEQ ID NO: 1158 response 2 FBN1//fibrillin 1 NM_000138 SEQ ID NO: 1159 SEQ ID NO: 1160 FFAR2//free fatty acid NM_005306 SEQ ID NO: 1161 SEQ ID NO: 1162 receptor 2 GPR82//G protein- NM_080817 SEQ ID NO: 1163 SEQ ID NO: 1164 coupled receptor 82 HCK//hemopoietic NM_002110 SEQ ID NO: 1165 SEQ ID NO: 1166 cell kinase SCARNA7//small NR_003001 SEQ ID NO: 1167 N/A Cajal body-specific RNA 7 SNORD34//small NR_000019 SEQ ID NO: 1168 N/A nucleolar RNA, C SPN //sialophorin NM_001030288 SEQ ID NO: 1169 SEQ ID NO: 1170 TMEM163// NM_030923 SEQ ID NO: 1171 SEQ ID NO: 1172 transmembrane protein 163 TSPAN7//tetraspanin 7 NM_004615 SEQ ID NO: 1173 SEQ ID NO: 1174 ZMYND17//zinc NM_001024593 SEQ ID NO: 1175 SEQ ID NO: 878 finger, MYND-type containing 17

[0154] In FIG. 1, the data show expression of the ratio of phosphorylated SMAD2 (pSMAD2) protein relative to total SMAD2 protein in BAL cells isolated from cynomolgus monkeys after 8-weekly doses of STX-100 treatment relative to circulating levels of STX-100 in serum after the last (8th) weekly dose of antibody (area under the curve (AUC) ug*hr/ml). Data are shown for individual animals in vehicle and 0.1, 0.3, 1.0, 3.0, and 10 mg/kg STX-100 treatment groups. pSMAD2 and total SMAD2 levels were determined by ELISA analysis.

[0155] In FIG. 2, the data show expression of example genes a) ALOX5, b) OLR1, c) Serpine1, and d) TGM2 in BAL cells isolated from cynomolgus monkeys after 8-weekly doses of STX-100 treatment relative to circulating levels of STX-100 in serum after the last (8th) weekly dose of antibody (area under the curve (AUC) ug*hr/ml). Data are shown for individual animals in vehicle and 0.1, 0.3, 1.0, 3.0, and 10 mg/kg STX-100 treatment groups. Gene expression was determined by Taqman® gene expression analysis.

Example 2: Quantitative Polymerase Chain Reaction Studies on Gene Expression Levels in BAL Macrophage Cells Following Injection of 3G9 Antibody in Mice

[0156] Wild type mice were either treated with 2 doses of 3G9 antibody at three different concentrations (i.e., 0.3 mg/kg, 1 mg/kg, or 3 mg/kg) 7 days apart or not treated (control). BAL macrophages were isolated from the mice 24 hours after the second dose and quantitative polymerase chain reaction was used to determine the expression level of Cathepsin L, Legumain, PAI-1 (also known as Serpine1), Osteopontin, TREM-1, MMP-19, and ALCAM.

[0157] 3G9 treatment did not significantly affect the expression of Cathepsin L or Legumain (FIGS. 3 and 4). However, 3G9 treatment increased the expression of MMP19 and ALCAM, and reduced the expression of osteopontin, TREM-1 and PAI-1 (FIGS. 5-9).