ANTIBODY CAPABLE OF BINDING TO INFLUENZA VIRUS
20170283485 · 2017-10-05
Inventors
Cpc classification
C07K2317/569
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains:
N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus.
Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.
Claims
1. An antibody that consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains:
N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C wherein FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus.
2. The antibody according to claim 1, wherein the FR1 consists of an amino acid sequence represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04); the FR2 consists of an amino acid sequence represented by WVRQAPGKGLEWVS (SEQ ID NO: 05); and the FR3 consists of an amino acid sequence represented by RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06); and the FR4 consists of an amino acid sequence represented by WGQGTQVTVSP (SEQ ID NO: 07).
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
DETAILED DESCRIPTION OF THE EMBODIMENT
[0023] The antibody according to the present invention is capable of binding to an influenza virus H12N1. As disclosed in Patent Literature 1, an antibody capable of binding to an influenza virus H12N1 consists of an amino acid sequence consisting of, in an N- to C-direction, the following structural domains.
N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C [0024] wherein [0025] FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence.
[0026] In the present invention, the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01).
[0027] In the present invention, the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02).
[0028] In the present invention, the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03).
[0029] Desirably, the CDR1, the CDR2, and the CDR3 are represented by SEQ ID NO: 01, SEQ ID NO: 02, and SEQ ID NO: 03, respectively. In this case, more desirably, the FR1 , the FR2, the FR3, and the FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively. In other words, it is desirable that the antibody according to the present invention consists of the following amino acid sequence.
TABLE-US-00001 (SEQ ID NO: 08) EVQLVESGGGLVQPGGSLRVSCAASGFTFSSYYMSWVRQAPGKGLEW VSTINTGGGSTYYADSVKGRFTISRDNAKNTLYLQMDSLKSEDTAVY YCAKDGPYGGYDYWGQGTQVTVSP
[0030] The antibody consisting of the amino acid sequence represented by SEQ ID NO: 08 does not exhibit antigenic cross reactivity with regard to hemagglutinins other than influenza Hemagglutinin H12N1.
EXAMPLES
Inventive Example 1
[0031] VHH antibodies capable of binding to a hemagglutinin (hereinafter, referred to as “HA”) included in an influenza virus type A H12N1 were prepared in accordance with the following procedures. In the present specification, VHH (or VHH antibody) means a variable domain of a heavy chain of a heavy chain antibody.
Immunization of Alpaca and Acquirement of Mononuclear
[0032] In order to form a VHH antibody gene library, an alpaca was immunized using recombinant HA proteins (H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15, and H16: available from Sino Biological, catalog number: 11055-V08H) derived from an influenza virus type A H12N5 (A/green-winged teal/ALB/199/1991) as an antigen.
[0033] Specifically, the recombinant HA protein having a concentration of 100 micrograms/milliliter was administered to the alpaca. After one week, the recombinant HA protein having the same concentration was administered to the alpaca, again. In this way, the alpaca was immunized with the recombinant HA protein five times over five weeks. After another week, blood of the alpaca was extracted. Then, mononuclear cells were acquired from the blood as below.
[0034] A blood cell separation solution (available from COSMO BIO Co., Ltd., trade name: Lymphoprep) was added to a lymphocyte separation tube (available from Greiner Bio-One Co., Ltd., trade name: Leucosep). Then, the solution was subjected to centrifugation at 1,000×g under a temperature of 20 degrees Celsius for one minute.
[0035] The blood extracted from the alpaca was treated with heparin. Then, an equivalent amount of phosphate buffered saline (hereinafter, referred to as “PBS”) was added to the thus-treated blood to obtain a sample solution. Then, the sample solution was added to the lymphocyte separation tube containing the blood cell separation solution.
[0036] The lymphocyte separation tube was subjected to centrifugation at 800×g under a temperature of 20 degrees Celsius for thirty minutes.
[0037] A fraction containing mononuclear cells was collected. Three times its volume of PBS was added. The fraction was subjected to centrifugation at 300×g under a temperature of 20 degrees Celsius for five minutes. The precipitate was suspended with PBS gently. After the suspending, 10 microliters of the suspension was separated in order for the count of the number of cells. The remaining suspension was subjected to centrifugation at 300×g under a temperature of 20 degrees Celsius for five minutes.
[0038] An RNA storage solution (trade name: RNAlater) having a volume of 2 milliliters was added to the precipitate. Then, the solution was suspended gently. The suspension was injected into two tubes each having a volume of 1.5 milliliters. Each tube contained 1 milliliter of the suspension. The tube was stored under a temperature of −20 degrees Celsius. The suspension (5 microliters) separated for the count of the number of cells was mixed with a Türk's solution (15 microliters), and the number of the mononuclear cells was counted with a counting chamber.
Formation of cDNA Gene Library of VHH Antibody
[0039] Then, a total RNA was extracted from the mononuclear cells, and a cDNA gene library of a VHH antibody was formed in accordance with the following procedure. In the following procedure, RNase-free-grade reagents and instruments were used.
[0040] A total RNA isolation reagent (trade name: TRIzol Regent, 1 milliliter) was added to the mononuclear cell fraction. The reagent was mixed gently with the fraction, and left at rest at room temperature for five minutes. Chloroform (200 microliters) was added to the reagent, and the reagent was shaken strongly for fifteen seconds. The reagent was left at room temperature for two-three minutes. The reagent was subjected to centrifugation at 12,000×g or less under a temperature of 4 degrees Celsius for 15 minutes.
[0041] The supernatant was moved to a new tube. RNase-free water and chloroform (200 microliters, each) were added to the tube. In addition, 500 milliliters of isopropanol was added to the tube. The liquid contained in the tube was stirred with a vortex mixer. The liquid was left at rest at room temperature for ten minutes. Then, the liquid was subjected to centrifugation at 12,000×g or less under a temperature of 4 degrees Celsius for fifteen minutes. The supernatant was removed, and the precipitate was rinsed with one milliliter of 75% ethanol. This solution was subjected to centrifugation at 7,500×g or less under a temperature of four degrees Celsius for five minutes. The solution was dried to obtain total RNA. The obtained total RNA was dissolved in RNase-free water.
[0042] In order to obtain cDNA from the total RNA, a kit including a reverse transcriptase was employed. The kit was available from Takara Bio Inc., as a trade name of PrimeScript II 1.sup.st strand cDNA Synthesis Kit. The Random 6 mer and Oligo dT primer included in the kit were used as primers. The cDNA was obtained in accordance with the standard protocol attached to the kit.
[0043] The gene of the VHH antibody included in the alpaca was obtained from the cDNA by a PCR method. An enzyme for PCR was available from Takara Bio Inc., as a trade name of Ex-taq.
[0044] The following reagents were mixed to obtain a mixture solution.
[0045] 10× buffer 5 microliters
[0046] dNTPs 4 microliters
[0047] Primer F 2 microliters
[0048] Primer R 2 microliters
[0049] cDNA template 1 microliter
[0050] Ex-taq 0.25 microliters
[0051] The mixture solution was subjected to the following PCR method.
[0052] First, the mixture solution was heated at a temperature of 95 degrees Celsius for two minutes.
[0053] Then, the temperature of the mixture solution was varied in accordance with the following cycle.
[0054] Ninety six degrees Celsius for thirty seconds,
[0055] Fifty two degrees Celsius for thirty seconds, and
[0056] Sixty eight degrees Celsius for forty seconds
[0057] This cycle was repeated thirty times.
[0058] Finally, the mixture solution was heated at a temperature of sixty eight degrees Celsius for four minutes and stored at a temperature of four degrees Celsius.
[0059] The following primers were used in the present PCR method.
TABLE-US-00002 Primer 1: (SEQ ID NO: 09) 5′-GGTGGTCCTGGCTGC-3′ Primer 2: (SEQ ID NO: 10) 5′-ctgctcctcgcGGCCCAGCCGGCCatggcTSAGKTGCAGCTCGT GGAGTC-3′ Primer 3: (SEQ ID NO: 11) 5′-TGGGGTCTTCGCTGTGGTGCG-3′ Primer 4: (SEQ ID NO: 12) 5′-TTGTGGTTTTGGTGTCTTGGG-3′ Primer 5: (SEQ ID NO: 13) 5′-tttgCtctGCGGCCGCagaGGCCgTGGGGTCTTCGCTGTGGTGC G-3′ Primer 6: (SEQ ID NO: 14) 5′-tttgCtctGCGGCCGCagaGGCCgaTTGTGGTTTTGGTGTCTTG GG-3′
[0060] (Reference literature: Biomed Environ Sci., 2012; 27(2):118-121)
[0061] Three PCR assays were conducted.
[0062] In the first PCR assay, a primer set A composed of the cDNA, Primer 1 and Primer 3 and a primer set B composed of the cDNA, Primer 1 and Primer 4 were used.
[0063] In the second PCR assay, a primer set C composed of the gene amplified with the primer set A, Primer 2, and Primer 3, and a primer set D composed of the gene amplified with the primer set B, Primer 2, and Primer 4 were used.
[0064] In the third PCR assay, a primer set E composed of the gene amplified with the primer set C, Primer 2, and Primer 5, and a primer set F composed of the gene amplified with the primer set D, Primer 2, and Primer 6 were used.
[0065] In this way, the gene library of the VHH antibody was formed. In other words, the gene library of the VHH antibody included the genes amplified with the primer sets E and F.
Formation of Phage Library
[0066] Next, a phage library was formed from the gene library of the VHH antibody in accordance of the following procedures.
[0067] A plasmid Vector 1 (4057 bp, see
[0068] The plasmid Vector 1 consists of the following gene sequence.
TABLE-US-00003 (SEQ ID NO: 17) gacgaaagggcctcgtgatacgcctatttttataggttaatgtcatg ataataatggtttcttagacgtcaggtggcacttttcggggaaatgt gcgcggaacccctatttgtttatttttctaaatacattcaaatatgt atccgctcatgagacaataaccctgataaatgcttcaataatattga aaaaggaagagtatgagtattcaacatttccgtgtcgcccttattcc cttttttgcggcattttgccttcctgtttttgctcacccagaaacgc tggtgaaagtaaaagatgctgaagatcagttgggtgcacgagtgggt tacatcgaactggatctcaacagcggtaagatccttgagagttttcg ccccgaagaacgttttccaatgatgagcacttttaaagttctgctat gtggcgcggtattatcccgtattgacgccgggcaagagcaactcggt cgccgcatacactattctcagaatgacttggttgagtactcaccagt cacagaaaagcatcttacggatggcatgacagtaagagaattatgca gtgctgccataaccatgagtgataacactgcggccaacttacttctg acaacgatcggaggaccgaaggagctaaccgcttttttgcacaacat gggggatcatgtaactcgccttgatcgttgggaaccggagctgaatg aagccataccaaacgacgagcgtgacaccacgatgcctgtagcaatg gcaacaacgttgcgcaaactattaactggcgaactacttactctagc ttcccggcaacaattaatagactggatggaggcggataaagttgcag gaccacttctgcgctcggcccttccggctggctggtttattgctgat aaatctggagccggtgagcgtgggtctcgcggtatcattgcagcact ggggccagatggtaagccctcccgtatcgtagttatctacacgacgg ggagtcaggcaactatggatgaacgaaatagacagatcgctgagata ggtgcctcactgattaagcattggtaactgtcagaccaagtttactc atatatactttagattgatttaaaacttcatttttaatttaaaagga tctaggtgaagatcctttttgataatctcatgaccaaaatcccttaa cgtgagttttcgttccactgagcgtcagaccccgtagaaaagatcaa aggatcttcttgagatcctttttttctgcgcgtaatctgctgcttgc aaacaaaaaaaccaccgctaccagcggtggtttgtttgccggatcaa gagctaccaactctttttccgaaggtaactggcttcagcagagcgca gataccaaatactgtccttctagtgtagccgtagttaggccaccact tcaagaactctgtagcaccgcctacatacctcgctctgctaatcctg ttaccagtggctgctgccagtggcgataagtcgtgtcttaccgggtt ggactcaagacgatagttaccggataaggcgcagcggtcgggctgaa cggggggttcgtgcacacagcccagcttggagcgaacgacctacacc gaactgagatacctacagcgtgagctatgagaaagcgccacgcttcc cgaagggagaaaggcggacaggtatccggtaagcggcagggtcggaa caggagagcgcacgagggagcttccagggggaaacgcctggtatctt tatagtcctgtcgggtttcgccacctctgacttgagcgtcgattttt gtgatgctcgtcaggggggcggagcctatggaaaaacgccagcaacg cggcctttttacggttcctggccttttgctggccttttgctcacatg ttctttcctgcgttatcccctgattctgtggataaccgtattaccgc ctttgagtgagctgataccgctcgccgcagccgaacgaccgagcgca gcgagtcagtgagcgaggaagcggaagagcgcccaatacgcaaaccg cctctccccgcgcgttggccgattcattaatgcagctggcacgacag gtttcccgactggaaagcgggcagtgagcgcaacgcaattaatgtga gttagctcactcattaggcaccccaggctttacactttatgcttccg gctcgtatgttgtgtggaattgtgagcggataacaatttcacacagg aaacagctatgaccatgattacgccAAGCTTCGAAGGAGACAGTCAT Aatgaaatacctgctgccgaccgctgctgctggtctgctgctcctcg cGGCCCAGCCGGCCatggagcTCAAGATGACACAGACTACATCCTCC CTGTCAGCCTCTCTGGGAGACAGAGTCACCATCAGTTGCAGGGCAAG TCAGGACATTAGCGATTATTTAAACTGGTATCAGCAGAAACCAGATG GAACTGTTAAACTCCTGATCTATTACACATCAAGTTTACACTCAGGA GTCCCATCAAGGTTCAGTGGCGGTGGGTCTGGAACAGATTATTCTCT CACCATTAGCAACCTGGAGCAAGAAGATATTGCCACTTACTTTTGCC AACAGGGTAATACGCTTCCGTGGACGTTTGGTGGAGGCACCAAGCTG GAAATCAAACGGGCTGATGCTGCACCAACTgtaGGCCtctGCGGCCG CagaGcaaaaactcatctcagaagaggatctgaatggggccgcaTAG ggttccggtgattttgattatgaaaagatggcaaacgctaataaggg ggctatgaccgaaaatgccgatgaaaacgcgctacagtctgacgcta aaggcaaacttgattctgtcgctactgattacggtgctgctatcgat ggtttcattggtgacgtttccggccttgctaatggtaatggtgctac tggtgattttgctggctctaattcccaaatggctcaagtcggtgacg gtgataattcacctttaatgaataatttccgtcaatatttaccttcc ctccctcaatcggttgaatgtcgcccttttgtctttagcgctggtaa accatatgaattttctattgattgtgacaaaataaacttattccgtg gtgtctttgcgtttcttttatatgttgccacctttatgtatgtattt tctacgtttgctaacatactgcgtaataaggagtctTAATAAgaatt cactggccgtcgttttacaacgtcgtgactgggaaaaccctggcgtt acccaacttaatcgccttgcagcacatccccctttcgccagctggcg taatagcgaagaggcccgcaccgatcgcccttcccaacagttgcgca gcctgaatggcgaatggcgcctgatgcggtattttctccttacgcat ctgtgcggtatttcacaccgCATATGaAAATTGTAAgcgttaatatt ttgttaaaattcgcgttaaatttttgttaaatcagctcattttttaa ccaataggccgaaatcggcaaaatcccttataaatcaaaagaataga ccgagatagggttgagtgttgttccagtttggaacaagagtccacta ttaaagaacgtggactccaacgtcaaagggcgaaaaaccgtctatca gggcgatggcccactacgtgaaccatcaccctaatcaagttttttgg ggtcgaggtgccgtaaagcactaaatcggaaccctaaagggagcccc cgatttagagcttgacggggaaagccggcgaacgtggcgagaaagga agggaagaaagcgaaaggagcgggcgctagggcgctggcaagtgtag cggtcacgctgcgcgtaaccaccacacccgccgcgcttaatgcgccg ctacaGGGCGCGTcccatATGgtgcactctcagtacaatctgctctg atgccgcatagttaagccagccccgacacccgccaacacccgctgac gcgccctgacgggcttgtctgctcccggcatccgcttacagacaagc tgtgaccgtctccgggagctgcatgtgtcagaggttttcaccgtcat caccgaaacgcgcga
[0069] Similarly, the gene library of the VHH antibody was treated with the restriction enzyme Sfil. In this way, VHH antibody gene fragments were obtained.
[0070] The thus-treated plasmid Vector 1 was mixed with the VHH antibody gene fragments at a ratio of 1:2. An enzyme (available from Toyobo Co. Ltd., trade name: Ligation High ver. 2) was injected into the mixture solution. The mixture solution was left at rest at a temperature of 16 degrees Celsius for two hours. In this way, each of the VHH antibody gene fragments was ligated into the plasmid Vector 1.
[0071] Coli bacteria (available from Takara Bio Inc., trade name: HST02) were transfected with the thus-ligated plasmid Vector 1.
[0072] Then, the coli bacteria were incubated for fifteen hours on a 2YT plate culture medium containing ampicillin at a concentration of 100 micrograms/milliliter. In this way, obtained was a library of phages each of which displays a protein obtained from the gene fragment included in the gene library of the VHH antibody.
[0073] After the incubation, a concentration of the library was calculated by counting the number of single colonies formed on the 2YT plate culture medium. As a result, the library of the phages had a concentration of 2.6E+8/milliliter.
Biopanning
[0074] VHH antibodies capable of specifically binding to the HA protein were obtained from the phage library in accordance with the following procedures.
[0075] In order to extract the clones each capable of binding to the antigen from among the phages which expressed the VHH antibody, biopanning was conducted twice.
[0076] Coli bacteria (HST02) to which the VHH antibody gene fragment included in the gene library of the VHH antibody had been introduced were incubated at a temperature of 30 degrees Celsius in the 2YT AG culture medium containing 100 micrograms/milliliter of ampicillin and 1% glucose until a value OD.sub.600 indicating absorbance reached 1.0. The 2YT AG culture medium had a volume of 100 milliliters. In this way, the coli bacteria were proliferated.
[0077] Helper phages (available from Invitrogen company, trade name: M13K07) were added to the coli bacteria culture medium in such a manner that the multiplicity of infection (hereinafter, referred to as “MOI”) was approximately twenty.
[0078] Then, the culture medium was warmed for about thirty minutes at a temperature of 37 degrees Celsius. Then, the culture medium was subjected to centrifugation at a rotation speed of 4000 rpm for ten minutes to collect the coli bacteria. The coli bacteria were incubated overnight at a temperature of 30 degrees Celsius in a 2YTAK culture medium containing 100 micrograms/milliliter of ampicillin and 50 micrograms/milliliter of kanamycin, while subjected to centrifugation at 213 rpm.
[0079] The incubation liquid (100 milliliters) containing the thus-incubated coli bacteria was injected into two centrifugation tubes (volume: 50 milliliters, each). The two centrifugation tubes were subjected to centrifugation for ten minutes at a rotation speed of 4,000 rpm. Then, the supernatants (20 milliliters, each) were collected.
[0080] The supernatants (40 milliliters) were added to a 20% polyethylene glycol solution (10 milliliters) containing NaCl (2.5 M). Then, the mixture solution was inverted and mixed. Subsequently, the mixture solution was cooled on ice for approximately one hour. The mixture was subjected to centrifugation for ten minutes at a rotation speed of 4,000 rpm. Then, the supernatant was removed. PBS containing 10% glycerol was injected toward the precipitate. Finally, the precipitate was loosened and dissolved. In this way, a library of phages each of which displays the VHH antibody was obtained.
Screening of VHH Antibody Capable of Specifically Binding to HA
[0081] (A) Immobilization of HA Antigen
[0082] HA was mixed with PBS to prepare an HA solution. The concentration of HA was 10 micrograms/milliliter. The HA solution (2 milliliters) was injected into an immunotube (available from NUNC Co. Ltd.). The HA solution was left at rest in the immunotube for one hour. In this way, HA was immobilized in the immunotube.
[0083] Then, the inside of the immunotube was washed three times with PBS.
[0084] The inside of the immunotube was filled with PBS which contained 3% skim milk (available from Wako Pure Chemical Industries, Ltd.). In this way, HA was blocked as an antigen in the immunotube.
[0085] The immunotube was left at rest at room temperature for one hour. Subsequently, the inside of the immunotube was washed three times with PBS.
[0086] (B) Panning
[0087] The library of the phages each of which displays the VHH antibody (concentration: approximately 10E+11/milliliter) was mixed with 2 milliliters of PBS containing 3% skim milk to prepare a mixture solution. The mixture solution was injected into the immunotube in which the HA antigen was immobilized.
[0088] The immunotube was provided with a lid formed of Parafilm. Then, the immunotube was rotated upside down in a rotator for ten minutes.
[0089] The immunotube was left at rest at room temperature for one hour.
[0090] The inside of the immunotube was washed ten times with PBS containing 0.05% Tween 20. Hereinafter, such PBS is referred to as “PBST”.
[0091] The inside of the immunotube was filled with PBST. Subsequently, the immunotube was left at rest for ten minutes. Then, the inside of the immunotube was washed ten times with PBST.
[0092] In order to extract phages each of which displays the VHH antibody bound to the HA antigen, 100 mM trimethylamine solution (1 milliliter) was injected into the immunotube.
[0093] The immunotube was provided with a lid formed of Parafilm. Then, the immunotube was rotated upside down in a rotator for ten minutes.
[0094] In order to neutralize the solution, the solution was moved to a tube containing 1 mL of 0.5 M Tris/HCl (pH: 6.8). Again, the extraction of the phage was repeated using a 100 mM trimethylamine solution (1 milliliter). In this way, 3 mL of an extraction liquid was obtained.
[0095] The extraction liquid (1 mL) was mixed with 9 mL of coli bacteria HST02. The mixture solution was left at rest for one hour at a temperature of 30 degrees Celsius.
[0096] In order to count the number of colonies, 10 microliters of the mixture solution containing the coli bacteria HST02 was distributed onto a small plate containing a 2TYA culture medium (10 milliliters/plate).
[0097] The rest of the mixture solution was subjected to centrifugation. The supernatant was removed, and the precipitate was distributed onto a large plate containing a 2TYA culture medium (40 milliliters/plate). These two plates were left at rest overnight at a temperature of 30 degrees Celsius. In this way, first panning was conducted.
[0098] Second panning was conducted identically to the procedure of the first panning. In other words, the panning was repeated. In this way, the monoclonal phages on which the VHH antibody was displayed were purified.
[0099] After the second panning, a colony of the coli bacteria was picked up with a toothpick. The picked-up one colony was put onto one well of 96-flat-bottom plate. This was repeated. One well contained 200 microliters of a 2YTAG culture medium.
[0100] The solutions contained in the wells were stirred at a rotation speed of 213 rpm at a temperature of 30 degrees Celsius.
[0101] The solution (50 microliters) containing grown coli bacteria was collected. The collected solution was mixed with 50 microliters of a 2YTA culture medium contained in a plate. The 2YTA culture medium contained helper phages such that the multiplicity of infection (i.e., MOO was set to be 20. The solution was left at rest at a temperature of 37 degrees Celsius for forty minutes.
[0102] The plate containing the 2YTA culture medium was subjected to centrifugation at 1,800 rpm for twenty minutes. The supernatant was removed. The precipitate contained the coli bacteria. The precipitate was mixed with 200 microliters of a 2YTAK culture medium. The mixture solution was left at rest overnight at a temperature of 30 degrees Celsius.
[0103] The mixture solution was subjected to centrifugation at 1800 rpm for twenty minutes. The supernatant containing the coli bacteria was collected.
[0104] (C) Qualitative Evaluation of Phage-Displayed VHH Antibody and Antigen by ELISA
[0105] An HA protein solution having a concentration of 100 micrograms/milliliter was injected as an antigen into each of the wells of a 96-well plate (available from Thermo Fisher Scientific K.K., trade name: maxisorp). The volume of the HA protein solution in each well was 50 microliters. The 96-well plate was left at rest at room temperature for one hour. In this way, the HA antigen was immobilized in each well.
[0106] Each of the wells was washed with PBS three times. Then, PBS containing 3% skim milk (available from Wako Pure Chemical Industries, Ltd.) was injected into each well (200 microliters/well). The 96-well plate was left at rest at room temperature for one hour. In this way, the HA protein was blocked in each well. Subsequently, each well was washed three times with PBS.
[0107] The monoclonal phages each of which displays the VHH antibody were injected into each well (50 microliters/well). Then, the 96-well plate was left at rest for one hour. In this way, the phages reacted with the HA antigen.
[0108] Each well was washed three times with PBST. Then, an anti-M13 antibody (available from ABCAM company, trade name: ab50370, 10,000-fold dilution) was injected into each well (50 microliters/well). Then, each well was washed three times with PBST.
[0109] A color-producing agent (available from Thermo Scientific, trade name: 1-step ultra TMB-ELISA) was injected into each well (50 microliters/well). The 96-well plate was left at rest for two minutes to cause the color-producing agent to react with the antibody.
[0110] A sulfuric acid aqueous solution (normal, i.e., 1 N) was injected into each well at a concentration of 50 microliters/well to cease the reaction.
[0111] The absorbance of the solution at a wavelength of 450 nanometers was measured.
[0112] Six wells each having good absorbance measurement result were selected. The DNA sequences included in the phages contained in the selected six wells were analyzed by Greiner Company. The analysis results of the DNA sequences will be described below. The following one DNA sequence was found.
TABLE-US-00004 (SEQ ID NO: 18) GAGGTGCAGCTCGTGGAGTCTGGGGGAGGCTTGGTGCAGCCTGGGGG GTCTCTGAGAGTCTCCTGTGCAGCCTCTGGATTCACCTTCAGTAGCT ACTACATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTCGAGTGG GTCTCAACTATTAATACTGGTGGTGGTAGCACATACTATGCAGACTC CGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACACCC TCTATCTGCAAATGGACAGTCTGAAATCTGAAGATACAGCCGTGTAT TATTGTGCAAAAGATGGGCCATATGGCGGGTACGACTACTGGGGCCA GGGGACCCAGGTCACCGTCTCCCCA
[0113] The protein synthesized from the DNA sequence represented by SEQ ID NO: 18 consists of the following amino acid sequence.
TABLE-US-00005 (SEQ ID NO: 08) EVQLVESGGGLVQPGGSLRVSCAASGFTFSSYYMSWVRQAPGKGLEW VSTINTGGGSTYYADSVKGRFTISRDNAKNTLYLQMDSLKSEDTAVY YCAKDGPYGGYDYWGQGTQVTVSP
Expression of Anti-H12N1 VHH Antibody
[0114] A vector pET22b(+) was purchased from Merck Millipore Company. Using PrimeStar Mutagenesis Basal Kit (available from Takara Bio Inc.), a 3xFlag tag and two restriction enzyme sites Sfil(a) and Sfil(b) were added to the vector pET22b(+) by a PCR method. See
[0115] First , the restrict ion enzyme site Sfil(a) was add to the vector pET22b(+) by a PCR method using the following two primers and a restrict ion enzyme (available from Takara Bio Inc., trade name: PrimeSTAR Max DNA polymerase).
TABLE-US-00006 Primer 1: (SEQ ID NO: 19) 5′-GCCGGCTGGGCcGCGAGGAGCAGCAGACCA-3′ Primer 2: (SEQ ID NO: 20) 5′-GCCCAGCCGGCcATGGCCATGGATATCGGA-3′
[0116] Then, a 3xFlag tag DNA fragment having restriction enzyme sites BamHl and Xhol at 5′-terminal end and 3′-terminal end, respectively, was formed using the following two primers and restriction enzymes (available from Takara Bio Inc., trade name: PrimeSTAR Max DNA polymerase).
TABLE-US-00007 Primer 1: (SEQ ID NO: 21) 5′-CATGGATATCGGAATTAATTCggatccGACTACAAAGACCATGA CGGTGATTATAAAGATCATGACATCctcgagCACCACCACCACCACC ACTGA-3′ Primer 2: (SEQ ID NO: 22) 5′-TCAGTGGTGGTGGTGGTGGTGctcgagGATGTCATGATCTTTAT AATCACCGTCATGGTCTTTGTAGTCggatccGAATTAATTCCGATAT CCATG-3′
[0117] This 3xFlag tag DNA fragment and the vector pET22b(+) were treated with two restriction enzymes BamHl and Xhol (available from Takara Bio Inc.)
[0118] The 3xFlag tag DNA fragment was ligated into the vector pET22b(+) using Ligation Kit (available from Takara Bio Inc.). In this way, obtained was the vector pET22b(+) to which the 3xFlag tag and the restriction enzyme site Sfil(a) were added.
[0119] A DNA fragment having restriction enzyme sites Ncol and BamHl at 5′ -terminal end and 3′ -terminal end, respectively, was formed using the following two primers and restriction enzymes (available from Takara Bio Inc., trade name: PrimeSTAR Max DNA polymerase).
TABLE-US-00008 Primer 1: (SEQ ID NO: 23) 5′-AAATACCTGCTGCCGccatggATATCGGAATTAATTCggcctct gcggccGCAggatccGACTACAAAGACCAT-3′ Primer 2: (SEQ ID NO: 24) 5′-ATGGTCTTTGTAGTCggatccTGCggccgcagaggccGAATTAA TTCCGATATccatggCGGCAGCAGGTATTT-3′
[0120] Then, this DNA fragment and the vector pET22b(+) were treated with two restriction enzymes Ncol and BamHl (available from Takara Bio Inc.)
[0121] This DNA fragment was ligated into the vector pET22b(+) using Ligation Kit (available from Takara Bio Inc.). In this way, obtained was the vector pET22b(+) to which the 3xFlag tag and the restriction enzyme sites Sfil(a) and Sfil(b) were added.
[0122] The sequence of the vector pET22b(+) was analyzed by Greiner Company. For the analysis of the sequence, a general T7 promotor primer set was used.
[0123] Selected were the vectors pET22b(+) which were confirmed through the analysis of the sequence to have been formed as planned.
[0124] Vectors pET22b(+) included in the liquid obtained by the PCR method were purified and collected in 50 microliters of diluted water using a DNA extraction kit (available from Promega KK). The thus-collected vectors pET22b(+) was treated with the Sfil restriction enzyme.
[0125] On the other hand, the plasmid Vector 1 into which the VHH antibody gene fragment included in the gene library of the VHH antibody was ligated was treated with the Sfil restriction enzyme. In this way, obtained were the following DNA (SEQ ID NO: 25) including the gene sequence coding for the amino acid sequence represented by SEQ ID NO: 08.
TABLE-US-00009 (SEQ ID NO: 25) 5′-GGCCCAGCCGGCCATGGCTGAGGTGCAGCTCGTGGAGTCTGGGG GAGGCTTGGTGCAGCCTGGGGGGTCTCTGAGAGTCTCCTGTGCAGCC TCTGGATTCACCTTCAGTAGCTACTACATGAGCTGGGTCCGCCAGGC TCCAGGGAAGGGGCTCGAGTGGGTCTCAACTATTAATACTGGTGGTG GTAGCACATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCC AGAGACAACGCCAAGAACACCCTCTATCTGCAAATGGACAGTCTGAA ATCTGAAGATACAGCCGTGTATTATTGTGCAAAAGATGGGCCATATG GCGGGTACGACTACTGGGGCCAGGGGACCCAGGTCACCGTCTCCCCA GCGCACCACAGCGAAGACCCCACGGCCTCTGCGGCCGCAGGATCCGA CTACAAAGACCATGACGGTGATTATAAAGATCATGACATCGATTACA AAGATGACGATGACAAACTCGAGCACCACCACCACCACCACTGATCT GCGGCC-3′
[0126] The DNA was treated with the Sfil restriction enzyme. Then, the thus-treated DNA was collected by an electrocataphoresis method. Using a DNA ligation set (available from Takara Bio Inc.), the collected DNA (SEQ ID NO: 26) was ligated into the plasmid treated with the Sfil restriction enzyme.
TABLE-US-00010 (SEQ ID NO: 26) 5′-CGGCCATGGCTGAGGTGCAGCTCGTGGAGTCTGGGGGAGGCTTG GTGCAGCCTGGGGGGTCTCTGAGAGTCTCCTGTGCAGCCTCTGGATT CACCTTCAGTAGCTACTACATGAGCTGGGTCCGCCAGGCTCCAGGGA AGGGGCTCGAGTGGGTCTCAACTATTAATACTGGTGGTGGTAGCACA TACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAA CGCCAAGAACACCCTCTATCTGCAAATGGACAGTCTGAAATCTGAAG ATACAGCCGTGTATTATTGTGCAAAAGATGGGCCATATGGCGGGTAC GACTACTGGGGCCAGGGGACCCAGGTCACCGTCTCCCCAGCGCACCA CAGCGAAGACCCCACGGCCTCTGCGGCCGCAGGATCCGACTACAAAG ACCATGACGGTGATTATAAAGATCATGACATCGATTACAAAGATGAC GATGACAAACTCGAGCACCACCACCACCACCACTGATCTG-3′
[0127] The ligation solution (2.5 microliters) and coli bacteria DH5α (available from Nippon Gene, 25 microliters) were mixed on ice. The mixture solution was left at rest on the ice for six minutes. Then, the mixture solution was heated at a temperature of 42 degrees Celsius for forty five seconds. Finally, the mixture solution was left at rest on the ice for one minute. This procedure is known as a general heat shock method.
[0128] The total amount of the mixture solution was distributed onto a LBA culture medium containing ampicillin at a concentration of 100 micrograms/milliliter. The LBA culture medium was left at rest overnight at a temperature of 37 degrees Celsius.
[0129] Three colonies were selected from among the colonies formed on the LBA culture medium. The selected three colonies were incubated in the LBA culture medium (3 milliliters) overnight.
[0130] The plasmids contained in the incubated coli bacteria were extracted from the LBA culture medium using a plasmid extract ion kit (available from QIAGEN, trade name: QIAprepspin miniprep kit) In order to confirm that the gene of the targeted VHH antibody was inserted in the plasmid, the sequence of the plasmid was analyzed by Greiner Company. For the analysis of the sequence, a general T7 promotor primer set was used.
[0131] Selected were plasmids which were confirmed through the analysis of the sequence to have been formed as planned.
[0132] Coli bacteria (Competent Cell BL21 (DE3) pLysS, available from Life technologies Company) were transfected with the selected plasmids by a heat shock method.
[0133] An SOC culture medium (50 microliters) was injected into the solution containing the transfected coli bacteria. Then, the coli bacteria were rescued at a temperature of 37 degrees Celsius for one hour, while shaken at 213 rpm.
[0134] Then, the coli bacteria solution was collected. The collected coli bacteria solution (5 milliliters) was distributed onto a LBA culture medium. The LBA culture medium was left at rest overnight at a temperature of 37 degrees Celsius.
[0135] One colony was selected from among the colonies formed in the LBA culture medium. The selected colony was picked up with a toothpick. The picked-up colony was incubated in a LBA culture medium (3 milliliters) at a temperature of 37 degrees Celsius, while shaken at 213 rpm. In this way, a culture liquid was obtained.
[0136] In addition, the culture liquid (25 milliliters) was mixed with a LBA culture medium (500 milliliters). Until the absorbance of the mixture solution at a wavelength of 600 nanometers reached 0.5, the mixture solution was shaken at 160 rpm at a temperature of 37 degrees Celsius.
[0137] After the absorbance reached 0.5, an isopropylthiogalactoside solution (hereinafter, referred to as “IPTG solution”) was added to the mixture solution. The final concentration of the IPTG solution was 1 mM. The coli bacteria contained in the mixture solution were incubated at a temperature of 37 degrees Celsius for six hours. In order to collect the thus-incubated coli bacteria, the mixture solution was subjected to centrifugation at 6,000 rpm for ten minutes at a temperature of 4 degrees Celsius.
[0138] The collected coli bacteria were mixed with ten times its volume of PBS. The mixture solution was stirred with a vortex mixer. In this way, the coli bacteria were washed. Then, the mixture solution was subjected to centrifugation at 6,000 rpm for ten minutes at a temperature of 4 degrees Celsius to collect coli bacteria. The collected coli bacteria were mixed again with ten times its volume of PBS. The coli bacteria contained in the mixture solution were disintegrated with an ultrasonic wave.
[0139] The disintegration liquid containing coli bacteria was subjected to centrifugation at 10,000 rpm for fifteen minutes at a temperature of 4 degrees Celsius. The supernatant was collected. The collected supernatant was filtered through a 0.45-micrometer filter.
[0140] The filtrate was purified with His-trap (available from GE Healthcare) in accordance with the recommended protocol. In the purification, an elution buffer having a total amount of 3 microliters was used for 1 milliliter of the filtrate. The buffer solution contained in the filtrate was substituted with PBS, using PD-10 (available from GE Healthcare). In the substitution, PBS having a total amount of 2.5 microliters was used for 1 milliliter of the filtrate. In this way, a solution containing the anti-H12N1 antibody was obtained.
[0141] The anti-H12N1 antibody contained in the thus-obtained solution was quantified with an absorption spectrometer (available from Scrum Inc., trade name: nanodrop) on the basis of the absorption measurement value at a wavelength of 280 nanometers. As a result, the concentration of the anti-H12N1 antibody was 4 milligrams/milliliter.
[0142] (D-1) Surface Plasmon Resonance Evaluation of Anti-H12N1 Antibody Using Recombinant HA
[0143] The anti-H12N1 antibody was evaluated as below using a recombinant HA and a surface plasmon resonance evaluation device. The details of the surface plasmon resonance (hereinafter, referred to as “SPR”) will be described below.
[0144] SPR evaluation device: T200 (available from GE Healthcare)
[0145] Immobilization buffer: HBS-EP (available from GE Healthcare)
[0146] Running buffer: HBS-EP+ (available from GE Healthcare)
[0147] Sensor chip: CM5 (available from GE Healthcare)
[0148] Immobilization reagents: N-hydroxysuccinimide (NHS) and N-[3-(dimethylamino)propyl]-N′-ethylcarbodiimide (EDC)
[0149] H12: recombinant hemagglutinin (HA) protein derived from influenza virus subtype A H12N5 (available from Sino Biological Inc., trade name: 17718-V08H)
[0150] H12 was immobilized in accordance with the wizard included in the control software of the SPR evaluation device T200. For the immobilization of H12, an acetic acid solution having a pH of 5.0 was used. The acetic acid solution had a concentration of 1 microgram/milliliter. The immobilization amount was set to be 200 RU.
[0151] The anti-H12N1 antibody consisting of the amino acid sequence represented by SEQ ID NO: 08 was used as an analyte. In the first to fourth analyses, the concentrations of the anti-H12N1 antibody contained in the running buffer were adjusted to 1000 nM, 500 nM, 250 nM, 50 nM, 10 nM and 2 nM, respectively.
[0152] (D-2) Evaluation of Cross Reactivity to Other Influenza Virus Subtypes by ELISA
[0153] The binding ability of the VHH antibody consisting of the amino acid sequence represented by SEQ ID NO: 08 to the HA protein was evaluated by an ELISA measurement method.
[0154] Prepared was a solution containing the VHH #20 consisting of the amino acid sequence represented by SEQ ID NO: 08 at a concentration of 1 microgram/milliliter in 3% skim milk PBS. Hereinafter, this solution is referred to as “Solution A”.
[0155] Each PBS solution containing one hemagglutinin (H1, H2, H3, H4, H5, H6, H7, H8, H9, H10, H11, H12, H13, H14, H15 or H16, at a concentration of 1 microgram/milliliter) was injected into each well of a 96-well microplate (Maxisorp, Nunc). Each well contained 50 microliters of the solution. The 96-well microplate was left at rest at room temperature for two hours to immobilize the virus in the wells.
[0156] PBS containing 0.05% Tween 20 was injected into each well to wash the well. The PBS had a pH of 7.4. The volume of the PBS injected into each well was 200 microliters. This was repeated twice.
[0157] PBS containing 3% skim milk (available from Wako Pure Chemical Industries, Ltd.) was injected into each well to block the hemagglutinins. The volume of the PBS injected into each well was 200 microliters. The 96-well microplate was left at rest at room temperature for one hour.
[0158] PBS containing 0.05% Tween 20 was injected into each well to wash the well. The PBS had a pH of 7.4. The volume of the PBS injected into each well was 200 microliters. This was repeated twice.
[0159] The solution A was injected into each well. The volume of the solution injected into each well was 50 microliters. The 96-well microplate was left at rest at room temperature. Thus, the VHH antibodies contained in the solution A bound to the HA protein of the virus contained in the wells.
[0160] PBS containing 0.05% Tween 20 was injected into each well to wash the well. The PBS had a pH of 7.4. The volume of the PBS injected into each well was 200 microliters. This was repeated twice.
[0161] Labelled antibodies(available from Sigma-Aldrich, trade name: Monoclonal ANTI-FLAG M2 HRP antibody produced in mouse) were diluted 10,000 fold with PBS. The thus-diluted labelled antibodies were injected into each well (50 microliters/well). Then, the 96-well microplate was left at rest for one hour in a dark place.
[0162] PBS containing 0.05% Tween 20 was injected into each well to wash the well. The PBS had a pH of 7.4. The volume of the PBS injected into each well was 200 microliters. This was repeated twice.
[0163] The color-producing agent (available from Thermo Scientific, trade name: 1-step ultra TMB-ELISA) was injected into each well (50 microliters/well). The 96-well microplate was left at rest for thirty minutes to cause the color-producing agent to react with the antibody.
[0164] A sulfuric acid aqueous solution (normal, i.e., 1 N) was injected into each well at a concentration of 50 microliters/well to cease the reaction.
[0165] The absorbance of the solution at a wavelength of 450 nanometers was measured.
[0166] As understood from
INDUSTRIAL APPLICABILITY
[0167] The present invention provides a novel antibody capable of binding to an influenza virus.