CANCER TREATMENT WITH 237 CAR-T CELL BASED THERAPEUTICS RECOGNIZING THE TN EPITOPE
20220047631 · 2022-02-17
Assignee
- The University Of Chicago (Chicago, IL)
- The Board Of Trustees Of The University Of Illinois (Urbana, IL)
Inventors
- Hans SCHREIBER (Chicago, IL, US)
- David KRANZ (Champaign, IL, US)
- Karin SCHREIBER (Chicago, IL, US)
- Yanran HE (Chicago, IL, US)
- Preeti SHARMA (Urbana, IL, US)
Cpc classification
C12N5/0638
CHEMISTRY; METALLURGY
C07K14/70535
CHEMISTRY; METALLURGY
A61K35/17
HUMAN NECESSITIES
International classification
A61K35/17
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The disclosure provides Tn epitope-specific chimeric antigen receptors and scFvs, including soluble scFvs and multimeric scFvs, as well as methods of identifying cancer subjects and cancer subject sub-populations amenable to anti-Tn immunotherapy and methods of treating cancer.
Claims
1. A chimeric antigen receptor (CAR) that specifically binds a Tn glycopeptide comprising: (a) a single chain variable fragment (scFv) that specifically binds a Tn glycopeptide, wherein the scFv comprises a heavy chain complementarity determining region 1 (CDRH1) sequence at positions 150-159 of SEQ ID NO:19, a CDRH2 sequence at positions 177-186 of SEQ ID NO:19, a CDRH3 sequence at positions 227-232 of SEQ ID NO:19, a light chain complementarity determining region 1 (CDRL1) at positions 26-37 of SEQ ID NO:19, a CDRL2 at positions 55-57 of SEQ ID NO:19, and a variant of the CDRL3 sequence at positions 96-100 of SEQ ID NO:19 comprising at least one amino acid variation from the wild-type antibody 237 light chain complementarity determining region 3 sequence at positions 96-100 of SEQ ID NO:19; and (b) a T-cell signaling domain.
2. The chimeric antigen receptor of claim 1, wherein the scFv is a variant of the wild-type scFv of antibody 237 comprising at least one amino acid variation from the wild-type antibody 237 light chain complementarity determining region 3 sequence at positions 96-100 of SEQ ID NO:19.
3. The chimeric antigen receptor of claim 1 wherein the CAR specifically binds a cancer-specific Tn glycopeptide.
4. The chimeric antigen receptor of claim 1 wherein the scFv is soluble.
5. The chimeric antigen receptor of claim 1 wherein the CAR comprises an antibody 237 light chain complementarity determining region 3 sequence of positions 96-100 of SEQ ID NO:27.
6. The chimeric antigen receptor of claim 1 wherein the CAR comprises an antibody 237 light chain complementarity determining region 3 sequence of positions 96-100 of SEQ ID NO:28.
7. The chimeric antigen receptor of claim 1 wherein the CAR comprises an antibody 237 light chain complementarity determining region 3 sequence of positions 96-100 of SEQ ID NO:20.
8. The chimeric antigen receptor of claim 1 wherein the CAR comprises a light chain complementarity determining region 3 (CDRL3) sequence of TTWAP (SEQ ID NO:3), STWAP (SEQ ID NO:4), STWSP (SEQ ID NO:5), STWGP (SEQ ID NO:6), STWQP (SEQ ID NO:7), STWEP (SEQ ID NO:8), or SVWEP (SEQ ID NO:9).
9. The chimeric antigen receptor of claim 1 wherein the CAR has a K.sub.D for Tn-Podoplanin of less than 100 nM.
10. The chimeric antigen receptor of claim 1, wherein the T-cell signaling domain is CD3ζ or FcRγ.
11. The chimeric antigen receptor of claim 10, wherein the FcRγ is FcεRγ.
12. The chimeric antigen receptor of claim 11, further comprising a CD28 transmembrane region, an ICOS transmembrane region, 4-1BB, or OX-40.
13. The chimeric antigen receptor of claim 1, wherein the chimeric antigen receptor comprises the CD28 transmembrane region, and further comprises 4-1BB, OX-40, or Lck.
14. The chimeric antigen receptor of claim 1 wherein the 237 scFv variant exhibits a greater sensitivity to a Tn epitope than the wild-type 237 scFv.
15. The chimeric antigen receptor of claim 1 wherein the 237 scFv variant exhibits a broader therapeutic range in treating cancer than the wild-type 237 scFv.
16. The chimeric antigen receptor of claim 1 wherein the CAR comprises the sequence set forth in SEQ ID NOs:21, 22, 23 or 24.
17. A soluble cancer-specific 237 single chain variable fragment (scFv) that specifically binds a Tn glycopeptide comprising a heavy chain complementarity determining region 1 (CDRH1) sequence at positions 150-159 of SEQ ID NO:19, a CDRH2 sequence at positions 177-186 of SEQ ID NO:19, a CDRH3 sequence at positions 227-232 of SEQ ID NO:19, a light chain complementarity determining region 1 (CDRL1) at positions 26-37 of SEQ ID NO:19, a CDRL2 at positions 55-57 of SEQ ID NO:19, and a variant of the CDRL3 sequence at positions 96-100 of SEQ ID NO:19 comprising at least one amino acid variation from the wild-type antibody 237 light chain complementarity determining region 3 sequence at positions 96-100 of SEQ ID NO:19.
18. The 237 scFv variant of claim 17, wherein the scFv is a variant of the wild-type scFv of antibody 237 comprising the heavy chain variable region amino acid sequence at positions 127-244 of SEQ ID NO:19 and a variant of the light chain variable region amino acid sequence at positions 1-111 of SEQ ID NO:19, wherein the variation comprises at least one amino acid variation from the wild-type antibody 237 light chain complementarity determining region 3 sequence at positions 96-100 of SEQ ID NO:19.
19. The 237 scFv variant of claim 17, wherein a nanomolar concentration of the 237 scFv variant detectably binds a Tn epitope or exhibits detectable binding to a target Tn epitope that is not detectably bound by the wild-type 237 scFv at a nanomolar concentration.
20. The 237 scFv variant of claim 17, wherein the scFv is a multimer.
21. The 237 scFv variant of claim 20, wherein the multimer is a tetramer.
22. The 237 scFv variant of claim 20, wherein the scFv multimerizes to a form that detectably binds to Tn antigen with a K.sub.D value less than 100 nM.
23. The 237 scFv variant of claim 21 comprising a tryptophan substitution for a histidine residue at position 98 of SEQ ID NO:27 in the complementarity determining region 3 of the antibody 237 light chain variable region.
24. The 237 scFv variant of claim 21 comprising a glutamate substitution for a valine residue at position 99 of SEQ ID NO:28 in the complementarity determining region 3 of the antibody 237 light chain variable region.
25. The 237 scFv variant of claim 24 further comprising a tryptophan substitution for a histidine residue at position 98 of SEQ ID NO:20 in the CDRL3 domain of the antibody 237 light chain variable region.
26. The 237 scFv variant of claim 21 comprising a light chain complementarity determining region 3 sequence of TTWAP (SEQ ID NO:3), STWAP (SEQ ID NO:4), STWSP (SEQ ID NO:5), STWGP (SEQ ID NO:6), STWQP (SEQ ID NO:7), STWEP (SEQ ID NO:8), or SVWEP (SEQ ID NO:9).
27. The 237 scFv variant of claim 17, wherein the 237 scFv variant has a K.sub.D for Tn-Podoplanin of less than 100 nM.
28. A method of identifying a cancer subject sub-population amenable to anti-Tn epitope cancer therapy comprising: (a) contacting a sample from a cancer subject with a detection agent, wherein the detection agent is the chimeric antigen receptor of claim 1, the soluble 237 scFv variant of claim 17, or the scFv multimer of claim 20; (b) assessing the binding of the detection agent to material in the sample; and (c) identifying the cancer subject as amenable to anti-Tn epitope cancer therapy if the detection agent detectably binds to material in the sample.
29. The method of claim 28, wherein the detection agent is the chimeric antigen receptor of claim 1.
30. The method of claim 28, wherein the detection agent is the soluble 237 scFv variant of claim 17.
31. The method of claim 28, wherein the detection agent is the scFv multimer of claim 20.
32. The method of claim 28, wherein the detection agent comprises a tryptophan substitution for a histidine residue at position 98 of SEQ ID NO:27 in the complementarity determining region 3 of the antibody 237 light chain variable region.
33. The method of claim 28, wherein the detection agent comprises a glutamate substitution for a valine residue at position 99 of SEQ ID NO:28 in the complementarity determining region 3 of the antibody 237 light chain variable region.
34. The method of claim 33, wherein the detection agent further comprises a tryptophan substitution for a valine residue at position 98 of SEQ ID NO:20 in the complementarity determining region 3 domain of the antibody 237 light-chain variable region.
35. The method of claim 31, wherein the scFv multimer is a tetramer.
36. The method of claim 28, wherein a nanomolar concentration of the detection agent detectably binds to a Tn epitope.
37. The method of claim 36, wherein a sub-nanomolar concentration of the detection agent detectably binds to a Tn epitope.
38. A method of treating cancer in a subject amenable to anti-Tn epitope cancer therapy comprising administering a therapeutically effective amount of a therapeutic agent to the subject, wherein the therapeutic agent is the chimeric antigen receptor of claim 1, the soluble 237 scFv variant of claim 17, or the scFv multimer of claim 20.
39. The method of claim 38, wherein the therapeutic agent is the chimeric antigen receptor of claim 1.
40. The method of claim 38, wherein the therapeutic agent is the soluble 237 scFv variant of claim 17.
41. The method of claim 38, wherein the therapeutic agent is the multimer of claim 20.
42. The method of claim 38, wherein the cancer is Acute Lymphoblastic Leukemia (ALL), Acute Myeloid Leukemia (AML), Adrenocortical Carcinoma, AIDS-Related Cancers, Kaposi Sarcoma (Soft Tissue Sarcoma), AIDS-Related Lymphoma, Primary CNS Lymphoma, Anal Cancer, Astrocytomas, Atypical Teratoid/Rhabdoid Tumor, Central Nervous System Cancer, Bile Duct Cancer, Bladder Cancer, Bone Cancer (includes Ewing Sarcoma and Osteosarcoma and Malignant Fibrous Histiocytoma), Brain Tumors, Breast Cancer, Bronchial Tumors, Carcinoid Tumor (Gastrointestinal), Carcinoma of Unknown Primary, Cardiac (Heart) Tumors, Embryonal Tumors, Primary CNS Lymphoma, Cervical Cancer, Chordoma, Chronic Lymphocytic Leukemia (CLL), Chronic Myelogenous Leukemia (CML), Chronic Myeloproliferative Neoplasms, Colorectal Cancer, Craniopharyngioma, Endometrial Cancer (Uterine Cancer), Esophageal Cancer, Esthesioneuroblastoma, Ewing Sarcoma (Bone Cancer), Extracranial Germ Cell Tumor, Eye Cancer, Intraocular Melanoma, Retinoblastoma, Fallopian Tube Cancer, Fibrous Histiocytoma of Bone, Gallbladder Cancer, Gastric (Stomach) Cancer, Gastrointestinal Carcinoid Tumor, Gastrointestinal Stromal Tumors (GIST) (Soft Tissue Sarcoma), Extragonadal Germ Cell Tumors, Ovarian Germ Cell Tumors, Testicular Cancer, Gestational Trophoblastic Disease, Hairy Cell Leukemia, Head and Neck Cancer, Heart Tumors, Hepatocellular (Liver) Cancer, Histiocytosis, Langerhans Cell Histiocytosis, Hodgkin Lymphoma, Hypopharyngeal Cancer, Intraocular Melanoma, Islet Cell Tumors, Pancreatic Neuroendocrine Tumors, Kidney (Renal Cell) Cancer, Laryngeal Cancer, Leukemia, Lip and Oral Cavity Cancer, Liver Cancer, Lung Cancer (Non-Small Cell and Small Cell), Lymphoma, Male Breast Cancer, Malignant Fibrous Histiocytoma of Bone and Osteosarcoma, Melanoma, Merkel Cell Carcinoma, Mesothelioma, Metastatic Cancer, Metastatic Squamous Neck Cancer with Occult Primary, Midline Tract Carcinoma With NUT Gene Changes, Mouth Cancer, Multiple Endocrine Neoplasia Syndromes, Multiple Myeloma/Plasma Cell Neoplasms, Mycosis Fungoides, Myelodysplastic Syndromes, Myelodysplastic/Myeloproliferative Neoplasms, Chronic Myeloproliferative Neoplasms, Nasal Cavity and Paranasal Sinus Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Hodgkin Lymphoma, Oral Cancer, Lip and Oral Cavity Cancer, Oropharyngeal Cancer, Osteosarcoma, Malignant Fibrous Histiocytoma of Bone, Ovarian Cancer, Pancreatic Neuroendocrine Tumors (Islet Cell Tumors), Papillomatosis, Paraganglioma, Paranasal Sinus and Nasal Cavity Cancer, Parathyroid Cancer, Penile Cancer, Pharyngeal Cancer, Pheochromocytoma, Pituitary Tumor, Plasma Cell Neoplasm/Multiple Myeloma, Pleuropulmonary Blastoma, Primary Central Nervous System (CNS) Lymphoma, Primary Peritoneal Cancer, Prostate Cancer, Rectal Cancer, Recurrent Cancer, Renal Cell (Kidney) Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer, Sarcoma, Soft Tissue Sarcoma, Uterine Sarcoma, Sézary Syndrome (Lymphoma), Skin Cancer, Small Intestine Cancer, Squamous Neck Cancer with Occult Primary, Metastatic, Stomach (Gastric) Cancer, T-Cell Lymphoma, Testicular Cancer, Throat Cancer, Nasopharyngeal Cancer, Oropharyngeal Cancer, Hypopharyngeal Cancer, Thymoma and Thymic Carcinoma, Thyroid Cancer, Transitional Cell Cancer of the Renal Pelvis and Ureter, Ureter and Renal Pelvis Cancers, Transitional Cell Cancer (Kidney (Renal Cell) Cancer, Urethral Cancer, Uterine Cancer, Endometrial Uterine Sarcoma, Vaginal Cancer, Vascular Tumors, Vulvar Cancer, or Wilms Tumor.
43. The method of claim 38, wherein the therapeutic agent comprises a tryptophan substitution for a histidine residue at position 98 of SEQ ID NO:27 in the complementarity determining region 3 of the antibody 237 light chain variable region.
44. The method of claim 38, wherein the therapeutic agent comprises a glutamate substitution for a valine residue at position 99 of SEQ ID NO:28 in the complementarity determining region 3 of the antibody 237 light chain variable region.
45. The method of claim 44 further comprising a tryptophan substitution for a histidine residue at position 98 of SEQ ID NO:20 in the complementarity determining region 3 of the antibody 237 light chain variable region.
46. The method of claim 41 wherein the scFv multimer is a tetramer.
47. The method of claim 38, wherein a nanomolar concentration of the therapeutic agent detectably binds to a Tn epitope.
48. The method of claim 47, wherein a sub-nanomolar concentration of the therapeutic agent detectably binds to a Tn epitope.
49. A method of identifying a subject as a cancer patient amenable to anti-Tn epitope cancer therapy comprising (a) determining if there is a mutation in the cosmc gene of the subject; and (b) identifying the subject as a cancer patient amenable to anti-Tn epitope cancer therapy if the subject harbors a mutant cosmc gene.
50. The method of claim 49 wherein the mutation is determined by sequencing at least a portion of the cosmc gene of the subject.
51. The method of claim 50 wherein a nucleic acid comprising the cosmc gene is amplified.
52. The method of claim 51 wherein the amplification is achieved using a polymerase chain reaction or reverse transcription polymerase chain reaction.
53. The method of claim 49 wherein the subject identified as a cancer patient amenable to anti-Tn epitope cancer therapy has a mutation in a cosmc coding region.
54. The method of claim 53 wherein the mutation in cosmc is a homozygous mutation.
55. The method of claim 49 further comprising treating the subject by administering a therapeutically effective amount of a therapeutic agent to the subject, wherein the therapeutic agent is the chimeric antigen receptor of claim 1, the soluble 237 scFv variant of claim 17, or the scFv multimer of claim 20.
56. The method of claim 55, wherein the therapeutic agent is the chimeric antigen receptor of claim 1.
57. The method of claim 55, wherein the therapeutic agent is the soluble 237 scFv variant of claim 17.
58. The method of claim 55, wherein the therapeutic agent is the multimer of claim 20.
59. The method of claim 55, wherein the cancer is Acute Lymphoblastic Leukemia (ALL), Acute Myeloid Leukemia (AML), Adrenocortical Carcinoma, AIDS-Related Cancers, Kaposi Sarcoma (Soft Tissue Sarcoma), AIDS-Related Lymphoma, Primary CNS Lymphoma, Anal Cancer, Astrocytomas, Atypical Teratoid/Rhabdoid Tumor, Central Nervous System Cancer, Bile Duct Cancer, Bladder Cancer, Bone Cancer (includes Ewing Sarcoma and Osteosarcoma and Malignant Fibrous Histiocytoma), Brain Tumors, Breast Cancer, Bronchial Tumors, Carcinoid Tumor (Gastrointestinal), Carcinoma of Unknown Primary, Cardiac (Heart) Tumors, Embryonal Tumors, Primary CNS Lymphoma, Cervical Cancer, Chordoma, Chronic Lymphocytic Leukemia (CLL), Chronic Myelogenous Leukemia (CML), Chronic Myeloproliferative Neoplasms, Colorectal Cancer, Craniopharyngioma, Endometrial Cancer (Uterine Cancer), Esophageal Cancer, Esthesioneuroblastoma, Ewing Sarcoma (Bone Cancer), Extracranial Germ Cell Tumor, Eye Cancer, Intraocular Melanoma, Retinoblastoma, Fallopian Tube Cancer, Fibrous Histiocytoma of Bone, Gallbladder Cancer, Gastric (Stomach) Cancer, Gastrointestinal Carcinoid Tumor, Gastrointestinal Stromal Tumors (GIST) (Soft Tissue Sarcoma), Extragonadal Germ Cell Tumors, Ovarian Germ Cell Tumors, Testicular Cancer, Gestational Trophoblastic Disease, Hairy Cell Leukemia, Head and Neck Cancer, Heart Tumors, Hepatocellular (Liver) Cancer, Histiocytosis, Langerhans Cell Histiocytosis, Hodgkin Lymphoma, Hypopharyngeal Cancer, Intraocular Melanoma, Islet Cell Tumors, Pancreatic Neuroendocrine Tumors, Kidney (Renal Cell) Cancer, Laryngeal Cancer, Leukemia, Lip and Oral Cavity Cancer, Liver Cancer, Lung Cancer (Non-Small Cell and Small Cell), Lymphoma, Male Breast Cancer, Malignant Fibrous Histiocytoma of Bone and Osteosarcoma, Melanoma, Merkel Cell Carcinoma, Mesothelioma, Metastatic Cancer, Metastatic Squamous Neck Cancer with Occult Primary, Midline Tract Carcinoma With NUT Gene Changes, Mouth Cancer, Multiple Endocrine Neoplasia Syndromes, Multiple Myeloma/Plasma Cell Neoplasms, Mycosis Fungoides, Myelodysplastic Syndromes, Myelodysplastic/Myeloproliferative Neoplasms, Chronic Myeloproliferative Neoplasms, Nasal Cavity and Paranasal Sinus Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Hodgkin Lymphoma, Oral Cancer, Lip and Oral Cavity Cancer, Oropharyngeal Cancer, Osteosarcoma, Malignant Fibrous Histiocytoma of Bone, Ovarian Cancer, Pancreatic Neuroendocrine Tumors (Islet Cell Tumors), Papillomatosis, Paraganglioma, Paranasal Sinus and Nasal Cavity Cancer, Parathyroid Cancer, Penile Cancer, Pharyngeal Cancer, Pheochromocytoma, Pituitary Tumor, Plasma Cell Neoplasm/Multiple Myeloma, Pleuropulmonary Blastoma, Primary Central Nervous System (CNS) Lymphoma, Primary Peritoneal Cancer, Prostate Cancer, Rectal Cancer, Recurrent Cancer, Renal Cell (Kidney) Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer, Sarcoma, Soft Tissue Sarcoma, Uterine Sarcoma, Sézary Syndrome (Lymphoma), Skin Cancer, Small Intestine Cancer, Squamous Neck Cancer with Occult Primary, Metastatic, Stomach (Gastric) Cancer, T-Cell Lymphoma, Testicular Cancer, Throat Cancer, Nasopharyngeal Cancer, Oropharyngeal Cancer, Hypopharyngeal Cancer, Thymoma and Thymic Carcinoma, Thyroid Cancer, Transitional Cell Cancer of the Renal Pelvis and Ureter, Ureter and Renal Pelvis Cancers, Transitional Cell Cancer (Kidney (Renal Cell) Cancer, Urethral Cancer, Uterine Cancer, Endometrial Uterine Sarcoma, Vaginal Cancer, Vascular Tumors, Vulvar Cancer, or Wilms Tumor.
60. The method of claim 55, wherein the therapeutic agent comprises a tryptophan substitution for a histidine residue at position 98 of SEQ ID NO:27 in the complementarity determining region 3 of the antibody 237 light chain variable region.
61. The method of claim 55, wherein the therapeutic agent comprises a glutamate substitution for a valine residue at position 99 of SEQ ID NO:28 in the complementarity determining region 3 of the antibody 237 light chain variable region.
62. The method of claim 61 further comprising a tryptophan substitution for a histidine residue at position 98 of SEQ ID NO:20 in the complementarity determining region 3 of the antibody 237 light chain variable region.
63. The method of claim 58 wherein the scFv multimer is a tetramer.
64. The method of claim 55, wherein a nanomolar concentration of the therapeutic agent detectably binds to a Tn epitope.
65. A method of identifying a subject as a cancer patient amenable to anti-Tn epitope cancer therapy comprising (a) obtaining a biological sample from a subject; (b) determining the level of core 1 β3-Gal-T-specific molecular chaperone (COSMC) and/or T-Synthase in the sample; (c) comparing the level of COSMC and/or T-Synthase in the sample to a control; and (d) identifying the subject as a cancer patient amenable to anti-Tn epitope cancer therapy if the level of COSMC and/or T-Synthase is lower in the sample of the subject than in the control.
66. The method of claim 65 wherein the sample of the subject has a lower level of COSMC than the control.
67. The method of claim 65 wherein the sample of the subject has a lower level of T-Synthase than the control.
68. The method of claim 65 wherein the subject has a mutation in the gene encoding COSMC and/or the gene encoding T-Synthase.
69. The method of claim 65 further comprising treating the subject by administering a therapeutically effective amount of a therapeutic agent to the subject, wherein the therapeutic agent is the chimeric antigen receptor of claim 1, the soluble 237 scFv variant of claim 17, or the scFv multimer of claim 20.
70. The method of claim 69, wherein the therapeutic agent is the chimeric antigen receptor of claim 1.
71. The method of claim 69, wherein the therapeutic agent is the soluble 237 scFv variant of claim 17.
72. The method of claim 69, wherein the therapeutic agent is the multimer of claim 20.
73. The method of claim 69, wherein the cancer is Acute Lymphoblastic Leukemia (ALL), Acute Myeloid Leukemia (AML), Adrenocortical Carcinoma, AIDS-Related Cancers, Kaposi Sarcoma (Soft Tissue Sarcoma), AIDS-Related Lymphoma, Primary CNS Lymphoma, Anal Cancer, Astrocytomas, Atypical Teratoid/Rhabdoid Tumor, Central Nervous System Cancer, Bile Duct Cancer, Bladder Cancer, Bone Cancer (includes Ewing Sarcoma and Osteosarcoma and Malignant Fibrous Histiocytoma), Brain Tumors, Breast Cancer, Bronchial Tumors, Carcinoid Tumor (Gastrointestinal), Carcinoma of Unknown Primary, Cardiac (Heart) Tumors, Embryonal Tumors, Primary CNS Lymphoma, Cervical Cancer, Chordoma, Chronic Lymphocytic Leukemia (CLL), Chronic Myelogenous Leukemia (CML), Chronic Myeloproliferative Neoplasms, Colorectal Cancer, Craniopharyngioma, Endometrial Cancer (Uterine Cancer), Esophageal Cancer, Esthesioneuroblastoma, Ewing Sarcoma (Bone Cancer), Extracranial Germ Cell Tumor, Eye Cancer, Intraocular Melanoma, Retinoblastoma, Fallopian Tube Cancer, Fibrous Histiocytoma of Bone, Gallbladder Cancer, Gastric (Stomach) Cancer, Gastrointestinal Carcinoid Tumor, Gastrointestinal Stromal Tumors (GIST) (Soft Tissue Sarcoma), Extragonadal Germ Cell Tumors, Ovarian Germ Cell Tumors, Testicular Cancer, Gestational Trophoblastic Disease, Hairy Cell Leukemia, Head and Neck Cancer, Heart Tumors, Hepatocellular (Liver) Cancer, Histiocytosis, Langerhans Cell Histiocytosis, Hodgkin Lymphoma, Hypopharyngeal Cancer, Intraocular Melanoma, Islet Cell Tumors, Pancreatic Neuroendocrine Tumors, Kidney (Renal Cell) Cancer, Laryngeal Cancer, Leukemia, Lip and Oral Cavity Cancer, Liver Cancer, Lung Cancer (Non-Small Cell and Small Cell), Lymphoma, Male Breast Cancer, Malignant Fibrous Histiocytoma of Bone and Osteosarcoma, Melanoma, Merkel Cell Carcinoma, Mesothelioma, Metastatic Cancer, Metastatic Squamous Neck Cancer with Occult Primary, Midline Tract Carcinoma With NUT Gene Changes, Mouth Cancer, Multiple Endocrine Neoplasia Syndromes, Multiple Myeloma/Plasma Cell Neoplasms, Mycosis Fungoides, Myelodysplastic Syndromes, Myelodysplastic/Myeloproliferative Neoplasms, Chronic Myeloproliferative Neoplasms, Nasal Cavity and Paranasal Sinus Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Hodgkin Lymphoma, Oral Cancer, Lip and Oral Cavity Cancer, Oropharyngeal Cancer, Osteosarcoma, Malignant Fibrous Histiocytoma of Bone, Ovarian Cancer, Pancreatic Neuroendocrine Tumors (Islet Cell Tumors), Papillomatosis, Paraganglioma, Paranasal Sinus and Nasal Cavity Cancer, Parathyroid Cancer, Penile Cancer, Pharyngeal Cancer, Pheochromocytoma, Pituitary Tumor, Plasma Cell Neoplasm/Multiple Myeloma, Pleuropulmonary Blastoma, Primary Central Nervous System (CNS) Lymphoma, Primary Peritoneal Cancer, Prostate Cancer, Rectal Cancer, Recurrent Cancer, Renal Cell (Kidney) Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer, Sarcoma, Soft Tissue Sarcoma, Uterine Sarcoma, Sézary Syndrome (Lymphoma), Skin Cancer, Small Intestine Cancer, Squamous Neck Cancer with Occult Primary, Metastatic, Stomach (Gastric) Cancer, T-Cell Lymphoma, Testicular Cancer, Throat Cancer, Nasopharyngeal Cancer, Oropharyngeal Cancer, Hypopharyngeal Cancer, Thymoma and Thymic Carcinoma, Thyroid Cancer, Transitional Cell Cancer of the Renal Pelvis and Ureter, Ureter and Renal Pelvis Cancers, Transitional Cell Cancer (Kidney (Renal Cell) Cancer, Urethral Cancer, Uterine Cancer, Endometrial Uterine Sarcoma, Vaginal Cancer, Vascular Tumors, Vulvar Cancer, or Wilms Tumor.
74. The method of claim 69, wherein the therapeutic agent comprises a tryptophan substitution for a histidine residue at position 98 of SEQ ID NO:27 in the complementarity determining region 3 of the antibody 237 light chain variable region.
75. The method of claim 69, wherein the therapeutic agent comprises a glutamate substitution for a valine residue at position 99 of SEQ ID NO:28 in the complementarity determining region 3 of the antibody 237 light chain variable region.
76. The method of claim 75 further comprising a tryptophan substitution for a histidine residue at position 98 of SEQ ID NO:20 in the complementarity determining region 3 of the antibody 237 light chain variable region.
77. The method of claim 72 wherein the scFv multimer is a tetramer.
78. The method of claim 69, wherein a nanomolar concentration of the therapeutic agent detectably binds to a Tn epitope.
79. A cell expressing a detection agent, wherein the detection agent is the chimeric antigen receptor of claim 1, the soluble scFv variant of claim 19, or the scFv multimer of claim 22, and wherein a nanomolar or sub-nanomolar concentration of the detection agent detectably binds to a Tn-glycopeptide with truncated glycosylation.
80. An engineered T-cell comprising the CAR of any one of claims 1-16.
81. The engineered T-cell of claim 80 wherein the CAR specifically binds to at least one glycopeptide comprising a Tn epitope.
82. The engineered T-cell of claim 80 wherein the CAR specifically binds to at least two glycopeptides that each comprise a Tn epitope.
83. The engineered T-cell of either of claim 81 or 82 wherein the glycopeptide comprising a Tn epitope of PDPN, TFRC, MUC1, TFRC, ZIP6, EVI2B, LAMP, PCDH, CD43, or PDXL.
Description
BRIEF DESCRIPTION OF THE DRAWING
[0036] This patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the United States Patent and Trademark Office upon request and payment of the necessary fee.
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
DETAILED DESCRIPTION
[0086] About 1-3% of all human cancers have somatic mutations in COSMC, coding for a chaperone protein that is essential for the normal activity of T-synthase, the only enzyme that catalyzes the formation of core 1 O-glycan Galβ1-3GalNAcα1-Ser/Thr (T antigen). The COSMC loss-of-function mutations abolish T-synthase activity and cause the extension of O-linked glycans to stop after the formation of the common O-glycan precursor N-acetyl galactosamine (GalNAc)-O-Ser/Thr, which is called Tn antigen (32). Disruption of Cosmc in mice is embryonically lethal, and Tn expression on the cell surface in humans has only been disclosed in cases of cancers or autoimmune diseases acquired via somatic mutation of COSMC (39, 42, 102). The 237 antibody is a monoclonal IgG antibody that recognizes a Tn-glycosylated epitope on murine podoplanin (PDPN), formed due to incomplete O-glycosylation at Thr77 because of a Cosmc mutation (16). As revealed by crystallography, 237 antibody binding requires interaction with the PDPN backbone, as well as with the GalNAc moiety resulting from the cancer-specific COSMC mutation (3). CAR-engineered T cells have shown great potential in treating late-stage leukemia (139,140), but broader application of the technology is largely limited by the severe toxicity occurring when targeting non-cancer-specific targets like tumor-associated antigens (TAAs), and relapses from mono-targeting therapies due to tumor heterogeneity. To address the needs for tumor-specific engineered T cell therapies, the 237 antibody was made into a CAR construct, and the 237 CAR-transduced T cells are shown herein to recognize Tn-linked targets on cancer cells with higher sensitivity than those recognized by the 237 antibody that are predicted by 237 antibody binding (59). The experiments disclosed herein demonstrate the in vitro and in vivo recognition of targets generated by COSMC mutations, by 237 CAR-T cells. Moreover, the 237CAR-engineered T cells target multiple Tn-glycopeptide antigens on a single cancer cell.
[0087] As noted above, COSMC mutations are present in 1-3% of all human cancers (
[0088] One main obstacle in engineered T cell therapies is the relapse/outgrowth of antigen-loss variants due to the heterogeneous nature of the disease. Having discovered that 237 CAR-T cells could recognize COSMC mutant cancer cells without PDPN expression, the specificity of which was not even predicted by 237 antibody binding, an investigation was launched to discover what other Tn-glycopeptides could be recognized by 237 CAR-T cells. To further analyze the cross-reactivity of 237CART cells compared to the 237Ab, single or multiple alanine (Ala, A) replacements in the 237Ab-recognized Tn-mPDPN motif G(T77*Tn)KPPLEE (SEQ ID NO: 35) were made as described previously (3, 16) and incorporated herein in relevant part. The Tn-glycosylated and unglycosylated versions of the original motif, as well as single or multiple Ala replacement variants, were chemically synthesized by ElimBiopharm. Thr77 was always preceded by APLVPTQRERG (SEQ ID NO: 36) as in mPDPN (16). The N-terminal biotinylated peptides were immobilized on streptavidin-coated plates at the indicated coating concentrations (
[0089] The disclosure provides immunotherapeutics in the form of CAR molecules that specifically recognize the Tn epitope, an epitope associated with a variety of cancers. The Tn epitope arises from a modification of the glycosylation of a Threonine or Serine residue in a protein, and is schematically illustrated in
[0090] The disclosure provides a dramatically sensitive, specific yet broadly effective immunotherapeutic approach to cancer identification and/or treatment using a chimeric antigen receptor (CAR) therapeutic based on the 237 antibody, an anti-Tn epitope antibody. Engineering the variable fragments of the 237 antibody into a CAR format revealed the surprising results of broader recognition of proteins exhibiting the modified glycosylation pattern characteristic of the Tn epitope. Significantly, the 237 CAR and its derivatives disclosed herein recognize the modified glycosylation pattern of the Tn epitope, but the epitope does not appear to include any specific peptide sequence, resulting in a CAR that recognizes the Tn epitope, known to be associated with a variety of cancers, and that recognition is not confined to proteins or peptides of any particular sequence. In addition, the data disclosed herein shows that multimerization of the soluble 237 scFv protein yielded unexpectedly increased sensitivity which makes the soluble 237 scFv, and molecular forms incorporating the soluble 237 scFv, useful as diagnostics for Tn antigen-expressing cancers. The derivatives of the 237 CAR disclosed herein also showed increased sensitivity to the Tn epitope.
[0091] The disclosure also provides methods of identifying a cancer subject amenable to anti-Tn epitope cancer therapy by obtaining a biological sample from a subject, determining the level of COSMC and/or T-Synthase in the sample, comparing the level of COSMC and/or T-Synthase in the sample to a control, and identifying the subject as a cancer subject amenable to anti-Tn epitope cancer therapy if the level of COSMC and/or T-Synthase is lower in the sample of the subject than in the control. The control is any control known in the art, including a level of COSMC and/or T-Synthase from one or more healthy individuals, regardless of when the level of COSMC and/or T-Synthase from the healthy individual(s) was or were determined. In subjects identified as cancer subjects, the relatively low level of COSMC and/or T-Synthase can be associated with a mutation in the gene encoding COSMC and/or the gene encoding T-Synthase. The method of identifying cancer subjects amenable to anti-Tn epitope cancer therapy may further comprise cancer treatment by administration of a therapeutically effective amount of a therapeutic agent according to the disclosure.
[0092] In constructing 237 CAR molecules, the Tn-epitope-recognizing domain of the CAR, based on the 237 antibody, is coupled to a T cell signaling domain. T cell signaling domains of the 237 CARs according to the disclosure include, but are not limited to, CD3ζ, CD3ζ (EBV), CD3ζ (Influenza MP-1), CD3ζ (VSV), CD3ε, 4-1BB, CD28, FCεRIγ, FcεRIγ (alloantigen), 4-1BB-CD3ζ, CD28-CD3ζ, CD28-CD3ζ (EBV), CD28-CD3ζ (Influenza), CD4-CD3ζ, CD28-4-1BB, CD4-FCεRIγ, CD28-FcεRIγ, CD28-41BB-CD3ζ, and CD28-OX40-CD3ζ.
EXAMPLES
Example 1
[0093] 237 scFv Construct and Soluble 237 scFv
[0094] A 237 scFv was constructed from the variable regions of the light and heavy chains of the 237 antibody. As schematically illustrated in
Example 2
[0095] Soluble Monomeric and Multimeric Forms of 237 scFv Bind Cancer Cells
[0096] Based on the premise that increased avidity would lower the detection threshold of an immunological agent, such as the 237 scFv, for the Tn epitope, multimeric forms of the 237 scFv were engineered. Towards that end, the 237 scFv coding region was cloned with a N-terminal 6×His tag (to aid in purification using a Ni-affinity column), and a C-terminal Avitag (to aid in site-specific biotinylation of the 237 scFv) in pET28a (
[0097] Three cancer cell lines, i.e., ACosmc cells, Jurkat cells, and Ag104A cells, were exposed to a monomeric form of 237 scFv labeled with biotin or a tetrameric form of 237 scFv labeled with biotin and multimerized by adding streptavidin-647. Following exposure to the monomeric or tetrameric form of 237 scFv, cells were subjected to flow cytometry and the results are presented in
[0098] The tetrameric form of the 237 scFv was then subjected to binding assays using the cancer cell lines Ag104A, Jurkat and SKOV3 having one of the following genetic backgrounds: Cosmc.sup.+/PDPN.sup.+, Cosmc.sup.+/PDPN.sup.−, Cosmc.sup.−/PDPN.sup.+, and Cosmc.sup.−/PDPN.sup.−. The results showed that the tetrameric scFv specifically bound to each of the three cancer cell types exhibiting a Cosmc.sup.− phenotype, regardless of the PDPN genotype, but did not detectably bind to Cosmc.sup.+ cancer cells, regardless of PDPN genotype (
[0099] In another experiment, the high affinity CAR (237-WE-CAR) and wild-type CAR transduced T cells were titrated with various concentrations of Tn-OTS8 peptide and Tn-Muc1 peptide (
[0100] As noted, the binding affinity of the 237 scFv for cancer cells was investigated using conventional binding assays and flow cytometry to detect results. Various concentrations of biotinylated monomeric 237 scFv were exposed to ACosmc cells or Ag104A cells. Subsequently, streptavidin-647 was added and the binding was analyzed by flow cytometry. The results showed that 2 nM to 33 μM 237 scFv resulted in detectable binding to the Ag104A cancer cell line, but not to the Cosmc rescue cell line ACosmc (
Example 3
The 237 Antibody Recognizes Podoplanin but the 237 CAR-T Cell has a Broader Activity Toward Multiple Tn-Linked Antigens
[0101] The murine Tn-podoplanin (Tn-mPDPN)-specific antibody 237, when made into the single-chain CAR format and expressed on T cells, eradicated human cancer that lacked Tn-mPDPN. The 237 antibody was characterized in an immunostaining study involving an anti-Tn antibody and an anti-Podoplanin (anti-PDPN) antibody as controls. Cosmc encodes a chaperone for the T-synthase essential for elongation of glycans beyond the initial Tn-structure. Ag104A is a murine sarcoma cell line that carries a Cosmc null mutation. It results in Tn-glycosylation of all O-linked glycoproteins on the cell surface, including murine podoplanin (PDPN). For the Ag104A cell line, a PDPN-negative variant was made by CRISPR-Cas9 knockout of Pdpn; both this variant and the parental Ag104A cell line were reconstituted with wild-type Cosmc to generate the two additional variants with normal glycosylation. For the Jurkat cell line, a human T cell lymphoma cell line that carries a natural Cosmc null mutation, a Cosmc wild-type variant was made by Cosmc transduction; both the Cosmc wild-type and the parental Jurkat cell lines were transduced with Pdpn to make the two murine PDPN-expressing variants. For the SKOV3 cell line, a human ovarian cancer cell line with normal COSMC function, a Tn-glycosylated variant was made by CRISPR-Cas9 knockout of Cosmc; both the Cosmc knockout and the parental SKOV3 cell lines were transduced with Pdpn to generate the two murine PDPN-expressing variants. Each cell line was separately stained with each of the three primary murine monoclonal antibodies (mAbs) indicated in
[0102] Analysis of the binding site interactions of PDPN and the 237 antibody led to the identification of a PDPN epitope of eight amino acids, as indicated in the inset to
Example 4
CAR-T Cells Recognize Cowie Cancers Independent of Podoplanin Binding
[0103] Because of the discrepant reactivities of 237CART cells and 237Ab, the specificities of these two reagents for cell lines expressing or lacking Tn-mPDPN or COSMC function were compared. 237Ab selectively bound only cell lines expressing mPDPN and lacking COSMC. The 237Ab neither bound COSMC wild-type cell lines with normally glycosylated mPDPN nor COSMC-mutant cell lines lacking mPDPN expression. The ability of higher concentrations of the 237Ab to predict the cross-reactivity of the 237CART cells was examined. In contrast to the 237 antibody, the host range for the 237 CAR-T cell isn't limited to cells that are PDPN. An experiment was performed to determine the CAR-T cell effector to cancer target ratio. 237 CAR-T cells lyse COSMC null cell lines even in the absence of murine PDPN expression. 5000 .sup.51Cr-labeled target cells per well of a 96-well plate were incubated for 4 hours with 237 CAR-T cells at the indicated effector-to-target ratio. The level of .sup.51Cr release into the medium by CAR-T-exposed targets (experimental release) was compared to the level of release in the absence of CAR-T cells (spontaneous release). For maximum release, targets were lysed by ZAP-OGLOBIN II. The percentage of specific lysis was calculated by the formula: % cytolysis=[(experimental release−spontaneous release)/(maximum release−spontaneous release)]×100. Spontaneous release was less than 15% of maximum release. 237 CAR-T cells were brought into contact with Ag104A, Jurkat or SKOV3 cells, and the percent cytolysis induced by the CAR-T cells was monitored at CAR-T cell:cancer cell ratios of 0.03:1, 0.33:1, 3.3:1 and 30:1. As shown in
[0104] IFNγ is a cytokine produced by various T cells that is involved in innate and adaptive immune responses, as well as in cancer cell surveillance. Recent data indicate that IFNγ has pro-cancer as well as anti-cancer effects. An experiment was designed to examine whether varying the ratio of IFNγ level (ng/ml) to CAR-T cells (cell count) would influence the level of cytolysis in Ag104A, Jurkat and SKOV3 cells. As noted in
[0105] An experiment conducted in vivo in mice yielded consistent results. Cohorts of immunocompromised mice were injected with parental Jurkat cells, Pdpn-transduced Jurkat cell derivatives, or Cosmc.sup.+, CD19-transduced Jurkat cell derivatives. Each of the three groups of mice were then sub-divided into three groups, with each group receiving treatment in the form of 237 CAR-T cells, CD19 CAR-T cells, or phosphate-buffered saline as a control treatment. Five million of each of the Jurkat cell variants, as indicated, were i.v.-injected into each NSG mouse. After Jurkat leukemia had established in the host 14 days post-transplantation, 5 million 237 CAR- or CD19 CAR-transduced OT1Rag/KO T cells were administered via i.p. injection. Injection of the same volume of PBS was used as negative control. Disease progression was followed weekly by bioluminescence (luciferase), as described in (138). Mice were monitored for 98 days following treatment, and the results shown in
Example 5
[0106] 237 scFv Mutagenesis and Characterization of 237scFv Variants
Rational Design of 237 scFv Variants
[0107] The promise of 237 scFv as the targeting moiety in an anti-cancer CAR-T cell led to efforts to develop 237 scFv variants using rational design. Rational design of the variants was based on the structure of the 237 antibody interaction with the OTS-8 glycopeptide, as illustrated in
PCR Mutagenesis and Yeast Surface Display
[0108] Yeast surface display was used to screen 237 scFv mutants binding the Tn epitope-containing peptide OTS-8. The 237 scFv was cloned in-frame with Aga-2 (a yeast mating agglutinin protein), with an N-terminal hemagluttinin (HA) and a C-terminal myc (c-myc) tag. Aga2, through its known association with yeast protein Aga1 anchored to the yeast cell wall, allowed expression of 237 scFv as a fusion protein on the yeast cell surface. In schematic terms, the construct used for yeast surface display was H2N-Aga2-Hemagglutinin (HA)-scFv (or scTCR)-c-myc-CO.sub.2H, also shown in
[0109] Implementing screens based on yeast surface display initially involved cloning the bioreceptor gene (scFv or scTCR) into pCT302 as a suitable vector (
[0110] PCR was used to introduce mutations into this construct, e.g., by error-prone amplification or by directed degeneracies. A library of mutated constructs was transformed into yeast by homologous recombination. The library was expanded and expression was induced. The expanded and induced library was stained using conditions designed to reveal a desired property such as protein folding, stability or affinity for a ligand. The library was sorted by degree of staining, which included, e.g., sorting for the best yeast binders to a given ligand. Expansion, expression induction, staining and sorting were then repeated 2-5 times to improve the selection. Next, the sorted clones were isolated and characterized. These clones were then used as a starting point for additional rounds of mutation and selection, ultimately resulting in the identification of a mutant bioreceptor tailored to optimize the selection criterion or criteria applied.
Diversity of CDR Libraries in 237 scFv
[0111] Nine CDR libraries were constructed from the CDRs of 237 scFv, with either 3 or 4 residues mutated at a time. Each library was transformed into electrocompetent yeast, and approximate library size was calculated based on observed transformation efficiency. Observed sizes were higher than theoretical sizes by at least an order of magnitude. Table 1 provides the observed and theoretical diversity of complementarity determining region libraries constructed in 237 scFv. The Table identifies the CDR mutated, the residues where libraries were made, the library size obtained and the theoretical library size expected.
TABLE-US-00001 TABLE 1 Library Library size obtained (Loop-Targeted residues) (Based on colony count) Theoretical size CDRL1-HSNG 4.2 × 10.sup.7 (32).sup.4 = 1.05 × 10.sup.6 CDRL1-GNTY 1.7 × 10.sup.8 (32).sup.4 = 1.05 × 10.sup.6 CDRL2-KVS 7.1 × 10.sup.7 (32).sup.3 = 3.3 × 10.sup.4 CDRL3-STHW 2.6 × 10.sup.7 (32).sup.4 = 1.05 × 10.sup.6 CDRH1-DAW 1 × 10.sup.8 (32).sup.3 = 3.3 × 10.sup.4 CDRH2-EIRN 2 × 10.sup.7 (32).sup.4 = 1.05 × 10.sup.6 CDRH2-NKAN 1.3 × 10.sup.7 (32).sup.4 = 1.05 × 10.sup.6 CDRH2-NNHE 1 × 10.sup.8 (32).sup.4 = 1.05 × 10.sup.6 CDRH3-KVR 7.1 × 10.sup.7 (32).sup.3 = 3.3 × 10.sup.4
[0112] Sequences of clones from each CDR library showed mutational diversity in the expected region. Plasmid DNA isolated from single colonies of each library was sequenced to confirm mutational diversity in the targeted regions. All libraries showed mutational diversity in expected regions, as shown in Table 2.
TABLE-US-00002 TABLE 2 Mutations Mutations outside at library library location Colonies location in in colonies Library sequenced colonies (n of mutations) HSNG 10 10/10 3/10 (n = 1) GNTY 10 10/10 1/10 (n = 1) KVS 10 10/10 2/10 (n = 1) STHV 10 10/10 1/10 (n = 1); 1/10 (n = 2) DAW 8 8/8 2/8 (n = 1) 1/8 (n = 2) EIRN 10 10/10 — NKAN 4 4/4 2/4 (n = 1) NNHE 9 9/9 2/9 (n = 1); 1/9 (n = 2) KVR 10 10/10 —
[0113] Exemplary data showing the binding of 237 scFv variants containing mutations in CDRL3 (see
[0114] The data disclosed herein supports the capacity of the 237 CAR-T cell, and 237 CAR-T cell variants, in particular variants in which 1, 2, 3, or 4 amino acids in one or more CDR regions have been substituted, to be effective in specifically binding to the Tn epitope found on various peptides and proteins, and thereby providing anti-cancer therapies for Cosmc.sup.− cancers.
Example 6
[0115] Isolation of 237scFv and 237 scFv Variants
[0116] The 237 scFv and 237 scFv variants generated by mutagenesis as described herein were isolated using both Fluorescence Activated Cell Sorting (FACS) and Magnetically Activated Cell Sorting (MACS). In particular, the sorting scheme involved a combination of MACS and FACS. The combined approach was adopted to take advantage of both sorting techniques. MACS is a rapid sorting technique capable of sorting 10.sup.9 cells in 15 minutes, but small sub-populations of cells cannot be enriched using this technique. FACS typically sorts about 2×10.sup.7 cells per hour, but sub-populations of cells of interest can be enriched. The combined sorting scheme was used to isolate 237 scFv variants having higher affinity than the wild-type 237 scFv (
TABLE-US-00003 TABLE 3 Tn-linked SEQUENCE antigen scFv IDENTIFIER Sequence of scFv Tn-OTS8 237- 19 DIQLTQSPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQ peptide wt KPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISSVEAE DLGVYFCSQSTHVPTFGGGTKLEIKGGGGSGGGGSGGGGSQVQ LQQSGGGLVQPGGSMKIFCAASGFTFSDAWMDWVRQSPEKGLE WVAEIRNKANNHETYYAESVKGRFTITRDDSKSRMSLQMNSLR AEDTGIYYCSGGKVRNAYWGQGTTVTVSS Tn-OTS8 237- 20 DIQLTQSPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQ peptide WE KPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISSVEAE DLGVYFCSQSTWEPTFGGGTKLEIKGGGGSGGGGSGGGGSQVQ LQQSGGGLVQPGGSMKIFCAASGFTFSDAWMDWVRQSPEKGLE WVAEIRNKANNHETYYAESVKGRFTITRDDSKSRMSLQMNSLR AEDTGIYYCSGGKVRNAYWGQGTTVTVSS Tn-OTS8 237- 21 DIQLTQSPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQ peptide LGQ KPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISSVEAE DLGVYFCSQSLGQPTFGGGTKLEIKGGGGSGGGGSGGGGSQVQ LQQSGGGLVQPGGSMKIFCAASGFTFSDAWMDWVRQSPEKGLE WVAEIRNKANNHETYYAESVKGRFTITRDDSKSRMSLQMNSLR AEDTGIYYCSGGKVRNAYWGQGTTVTVSS Tn-OTS8 237- 22 DIQLTQSPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQ peptide TNGK KPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISSVEAE DLGVYFCSQTNGKPTFGGGTKLEIKGGGGSGGGGSGGGGSQVQ LQQSGGGLVQPGGSMKIFCAASGFTFSDAWMDWVRQSPEKGLE WVAEIRNKANNHETYYAESVKGRFTITRDDSKSRMSLQMNSLR AEDTGIYYCSGGKVRNAYWGQGTTVTVSS Tn-MUC1 237- 23 DIQLTQSPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQ peptide LGQ KPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISSVEAE DLGVYFCSQSLGQPTFGGGTKLEIKGGGGSGGGGSGGGGSQVQ LQQSGGGLVQPGGSMKIFCAASGFTFSDAWMDWVRQSPEKGLE WVAEIRNKANNHETYYAESVKGRFTITRDDSKSRMSLQMNSLR AEDTGIYYCSGGKVRNAYWGQGTTVTVSS Tn-MUC1 237- 24 DIQLTQSPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQ peptide TNGK KPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISSVEAE DLGVYFCSQTNGKPTFGGGTKLEIKGGGGSGGGGSGGGGSQVQ LQQSGGGLVQPGGSMKIFCAASGFTFSDAWMDWVRQSPEKGLE WVAEIRNKANNHETYYAESVKGRFTITRDDSKSRMSLQMNSLR AEDTGIYYCSGGKVRNAYWGQGTTVTVSS
[0117] FACS and MACS were used in combination to sort 237 libraries. Initial sorts were conducted by MACS that facilitated the screening of high mutational diversity (approximately, 7×10.sup.8 transformants after pooling nine 237 libraries) in initial stages. In order to identify individual mutants from the libraries, later sorts, involving lower levels of mutational diversity, were conducted with FACS, which facilitated the collection of a specific percentage of cells of interest.
[0118] Sorts were also used to obtain variants of 237 scFv that would bind to other Tn-linked epitope(s), not just to the Tn epitope found on PDPN (i.e., the OTS-8 peptide). Using MUC-1, which bears an O-glycosylated residue that can yield the Tn epitope, binding studies were performed on the 237 scFv and on the 5E5 scFv (i.e., the scFv derived from the anti-MUC1 antibody recognizing the MUC1 Tn epitope). The results of serial sorting shown in
Example 7
Activation of T Cells
[0119] Following the purification of the 237 CAR-T cell and 237 variant CAR-T cells, these cells were investigated to determine if they would be activated by cancer cells due to the presence of a cell-surface, cancer-associated antigen to activate the T cells. Total T cells were initially isolated from C57BL/6 mice and transduced with either 237-CAR (237) or WE-CAR (WE) to yield 237 CAR-T cells and WE-237 CAR-T cells. These T cells were then separately co-cultured with 25,000 target cells of (A) murine Ag104A cancer cells, or (B) 58.sup.−/− control murine cells, for 24 hours at 37° C., 5% CO.sub.2 at various effector:target (E:T) ratios. The amount of IFN-γ released in the supernatants under each co-culture condition was measured by ELISA. The results shown in
Example 8
[0120] Engineering 237 scFv for More Effective Targeting of Tn-Linked Antigens
[0121] To optimize the targeting of Tn-linked antigens on cancer cells, an antibody form with high affinity against the targeting agent is desired, whether the antibody form is a CAR, a BiTE, or another antibody form. For T cell receptors (TCRs), the optimal affinity window is narrow due to their higher sensitivities because of the involvement of CD3 subunits and other cellular signaling machinery (98, 99). CARs and soluble reagents like antibodies or BiTEs, however, often require higher affinity (e.g., low nanomolar to picomolar K.sub.D values) for higher efficacy. For example, Lynn et al. demonstrated efficacy of a high affinity, folate receptor beta-targeted CAR (K.sub.D=2.5 nM) in a mouse model of human acute myeloid leukemia (AML), and against primary human AML (109). In fact, the scFv used in the FDA-approved CD19 CAR for the treatment of acute lymphoblastic leukemia (ALL), and relapsed or refractory large B-cell lymphoma, exhibits a K.sub.D of 5 nM for CD19 (113, 114, 129, 130). In addition, density of the cancer antigen also has an impact on the affinity requirement. A low density target may require a high affinity CAR for efficient targeting; however, its affinity may need fine tuning to discriminate tumor from normal tissue expressing low levels of antigen (87, 107, 126). In the case of BiTEs, however, lower affinities are correlated with higher therapeutic potential. For example, the FDA-approved Blinatumomab for ALL has an affinity of 1 nM for CD19, and was shown to induce lymphoma-directed T cell cytotoxicity at very low concentrations (10-100 pg/ml) (100, 108). This BiTE has now been shown to induce durable responses in patients at low doses in several studies (82, 137). Similarly, ImmTACs, which replace high affinity scFv in BiTEs with high affinity TCRs (nanomolar to low picomolar K.sub.D) but target intracellular antigens, have been shown to allow T-cell mediated killing of tumor lines, and control tumor growth in mouse models (74, 115).
[0122] In order to develop Tn-specific CARs and BiTEs that are able to efficiently target a cancer antigen of interest, a panel of high-affinity 237 scFv mutants was engineered using yeast display. For this purpose, a structure-guided approach was used to design libraries of 237 scFv mutants in residues that are in proximity to, or mediate binding to, the antigen (e.g., the sugar-binding and peptide-binding residues of the 237 antibody that contact Tn-OTS8) (
[0123] An experiment was also conducted to compare the binding of the monomeric and tetrameric forms of the 237 scFv to Jurkat cancer cells. The 237 scFv monomer was labeled with biotin, and the tetramer was produced by adding streptavidin-647. As a control, the 237 antibody was also exposed to Jurkat cancer cells. Various concentrations of these binding agents were exposed to Jurkat cancer cells and binding was analyzed by flow cytometry. The results of the binding study are shown in
Example 9
[0124] 237 scFv Binding to OTS8 Peptide Epitope Variants
[0125] The OTS-8 epitope of PDPN that binds the 237 scFv was chosen for further studying its binding interactions with 237 scFv. An initial binding titration was performed by coating microtiter wells with unglycosylated OTS-8 peptide (OTS8p) at 2.5 or 5 μg/ml, or with the OTS-8 peptide exhibiting the Tn epitope, again at 2.5 or 5 μg/ml. Biotinylated 237 scFv was added to the wells at various concentrations, and bound 237 scFv was detected using streptavidin-HRP by ELISA. The results, shown in
[0126] The binding of 237 scFv to the OTS-8 epitope of PDPN led to an exploration of the essential content of that epitope required for binding to the 237 scFv. As shown in
[0127] The greater range of cancer epitopes recognized by the 237 CAR-T cell compared to the parent 237 antibody was confirmed by examining binding to OTS-8 variants containing multiple Ala substitutions. Again, the binding assay assessed 237 antibody binding to immobilized OTS-8 variant peptide using a colorimetric assay detected at OD.sub.450 and assessed 237 CAR-T cell activation by measuring IFNγ production. The results shown in
[0128] Another experiment was designed to assess the capacity of the various binding agents to bind to OTS-8 variants that differed in length. The binding assay compared 237 antibody binding and 237 CAR-T cell binding to immobilized OTS-8 length variants. The OTS-8 length variants were a series of OTS-8 variants beginning with the 4-Ala substitute (see above), the OTS-8 variant of greatest divergence from wild-type OTS-8 that was still bound by both the 237 antibody and the 237 CAR-T cell. The length variants involved a progressive shortening of the epitope peptide by one Ala residue deleted from the C-terminus, yielding a nested set of OTS-8 length variants. For 237 antibody binding, a colorimetric assay was used with results detected at OD.sub.450. For the 237 CAR-T cell, activation was measured by IFNγ production.
Example 10
[0129] Variants of 237 scFv with Broadened Specificity
[0130] In order to broaden the number of Tn-linked cancer antigens that can be targeted with a single reagent, such as a CAR or a BiTE, 237 scFv mutants were sought that could bind to several members of the mucin family of proteins, which have been shown to be upregulated in a variety of human cancers. For example, MUC1 is upregulated in breast cancer, colon cancer, multiple myeloma, lymphoma and myeloid leukemia; MUC4 is upregulated in colon and pancreatic cancer; and MUC16 is upregulated in pancreatic and ovarian cancer (80, 83, 85, 93, 94, 96, 104, 105, 106, 121, 123, 134). MUC16 is diagnostically very significant as its extracellular portion (also known as CA125) is shed into blood, and is established as a biomarker for diagnosing and monitoring ovarian cancer patients in FDA-approved assays (83).
[0131] Mucin proteins contain tandem repeat structures containing multiple N- and O-linked glycosylation sites. They are normally heavily glycosylated, and their aberrant glycosylation leads to formation of several Tn-linked antigens during cancer, which are expected to be recognizable, and thus targetable, by 237 scFv mutants (and ultimately, 237 CARs and BiTEs). While the pathways and the enzymes involved in glycosylation have been extensively studied, there seems to be limited knowledge about the exact sequence of Tn antigens arising from these mucin proteins. Several antibodies have been isolated that bind to the CA125 epitope of MUC16, e.g., OC125-like antibodies, M11-like antibodies, OV197-like antibodies and 5E11. While it has been challenging to precisely identify the epitopes of these antibodies, 5E11 was generated against a minimal epitope (FNTTER; SEQ ID NO:14) (84, 110, 111). In terms of offering therapeutic advantage, an OC125-like antibody (B43.13) that binds with high affinity (K.sub.D of 0.1 nM) to tandem repeats of MUC16 was shown to induce immune responses in patients that led to improvement in overall survival, and currently this therapy is in clinical trials (NCT03162562, NCT03100006) (116). Additionally, a CAR based on another MUC16-directed antibody (4H11) has been shown to be effective against human ovarian cancer cell lines, and in mouse models of human ovarian cancer, and is also in clinical trials currently (NCT02498912) (88, 90). Interestingly, most of these antibodies have been shown to recognize epitopes on MUC16 that are not glycosylated (84, 97, 110, 111). Regarding MUC4, the 8G7 antibody was isolated against the STGDTTPLPVTDTSSV (SEQ ID NO:15) epitope and its binding was also not dependent on the level of glycosylation (117). Another study established a MUC4 peptide (GHAT(GalNAc)PLPVTD; SEQ ID NO:16) that could be glycosylated (135). In the case of MUC1, 5E5 antibody that binds with Tn-MUC1 (VT(GalNAc)SAPDTRPAPGS(GalNAc)T(GalNAc)APPAHG; SEQ ID NO:17) with high affinity (K.sub.D of 1.7 nM) was isolated by Clausen and colleagues (35, 36, 106). They also isolated additional Tn-MUC1 antibodies (for example, 2D9 and VU3C6) and established their minimal epitope requirements in MUC1, i.e., the GSTA motif for antibodies 5E5 and 2D9, and the PDTR motif for the VU3C6 antibody (5). Clausen and colleagues also demonstrated the presence of autoantibodies against MUC1 peptides in serum of breast, ovarian and prostate cancer patients (48), indicating the importance of MUC1 as a target for cancer therapy. The inventors thus investigated whether 237 scFv mutants could target a Tn epitope of a mucin family protein expected to be associated with cancer.
[0132] The experimental design reflected an interest in isolating 237 scFv mutants that could either bind to an antigen of choice (for example, Tn-MUC1 peptide), or have broadened specificity so as to target multiple Tn-linked antigens (for example, both Tn-MUC1 and Tn-OTS8 peptides). As a starting point, 237 libraries were sorted with a Tn-MUC1p peptide (
[0133] Because Jurkat cells were effectively eliminated by 237CART cells even though Jurkat cells lacked Tn-mPDPN, the reactivity of 237CART cells to other Tn-glycopeptide antigens found in Jurkat cells was tested. 237Ab binding can be detected only with Tn-mPDPN, whereas 237CART cells reacted with multiple Tn-glycopeptides from Jurkat cells at different levels. 237CART cells made from the Tn-m-PDPN-specific 237Ab recognize multiple different Tn-glycopeptides from Jurkat cells. 237Ab binding would not have predicted the cross-reactivity of 237CART cells (
[0134] To test the generality of these observations, a different Tn-glycopeptide-specific antibody, converted into the single-chain CAR format and expressed on T cells, was examined to determine whether it would cross-react with other Tn-glycopeptides. The 5E5CAR was derived from 5E5Ab that had been generated by immunizing a mouse with Tn-glycosylated human mucin 1 (Tn-MUC1). Consistent with the foregoing, an experiment was conducted that revealed that the 237 CAR-T cell bound to a broader range of different peptides than a CAR-T cell constructed based on an anti-MUC1 antibody, i.e., the 5E5 CAR-T cell, which recognizes a Tn epitope on MUC 1. The following peptides were coated on microtiter wells: GTKPPLEE (SEQ ID NO:18), GTKAAAA (SEQ ID NO:10), MUC1, ZIP6, CD43, EV12B, and NoTn. All peptides except NoTn had O-glycosylation sites capable of forming a Tn epitope. The concentration of peptide coated in the wells varied from 1 nM to 20 μM. IFNγ production was used to measure activation. The 237 CAR-T cell was activated in the presence of all tested peptides except CD43, EV12B and NoTn (
[0135] Consistent with the foregoing observation, an experiment was conducted to determine if MUC1 expression would affect the activation of 237 CAR-T cells exposed to Cosmc.sup.− SKOV3 cancer cells. The experiment tested the effect of four target cells on 237 CAR-T cell activation using an activation assay in which each target was varied from 4 targets/well to 10000 targets/well, as shown in
TABLE-US-00004 TABLE 4 Sequence (−1, (−1, Identifier +3) −1 0 +1 +2 +3 +4 +5 +6 +6) score + PDPN GTKPPLEE 18 0 0 0 0 0 0 0 0 0 0 + MUC1 STAPPAHG 37 −3.4 −2.7 0 −0.7 0 0 −1 −6 −1 −10.9 − CD43 ETPHATSH 38 −5.18 −0.3 0 −0.8 −4.1 −0.7 −3 −1.2 −3 −12.9 1 Zinc STPPSVTS 39 −2.8 −2.7 0 −0.8 0 0.6 1 −4 −2 −7.63 transporter ZIP6 3 Protein STQPTSTV 40 −3.23 −2.7 0 −0.6 0 0 −2 −4 −1 −9.95 EV12B 5 LAMP1 TTAPPAPP 41 −3.5 −2.8 0 −0.7 0 0 −1 −3 −5 −12.7 6 Podocalyxin STKAEHLT 42 −3/9 −2.7 0 0 0.3 −1.6 −0 −6 −3 −13 7 CD43 TTSITSDP 43 −4.47 −2.8 0 −1.7 0 0 −2 −1 −5 −11.9 8 Seizure 6- TTAVTPNG 44 −5.21 −2.8 0 −0.7 −1.7 0 −5 −2 −1 −13 like protein 2 9 Transferrin GTESPVRE 45 −5.5 0 0 −1.5 −4 0 1 −3 0 −7.95 receptor protein 1
Example 11
Cancer Treatment
[0136] An experiment was conducted to determine the effectiveness of the 237 CAR-T cell as an anti-cancer therapy in vivo. Mice were transplanted with SKOV3-COSMC.sup.KO-PDPN cells and tumors were allowed to develop. Two separate trials were run with mice divided into four groups for treatment, i.e., group 1 received 237 CAR-T cell therapy using a (237)-(4-1BB)-(CD28ζ) CAR construct, group 2 received CAR-T cell therapy using an (α-Her2)-(4-1BB)-(CD28ζ) CAR construct, group 3 received CAR-T cell therapy using a (237)-(CD28ζ) construct, and group 4 received CAR-T cell therapy using an (α-Her2)-(CD28ζ) CAR construct. Tumor size was monitored over time, and the results are presented in
[0137] Although the specificity of an antibody predicts the reactivity of CARs derived from the antibody, proteins such as enzymes and antibodies may have polyfunctional combining regions for recognition of structurally related ligands. As disclosed herein, two different CARs exhibited cross-reactivity to structurally related but molecularly different ligands. This ability of the CART cells to recognize multiple different Tn-glycopeptides on Jurkat leukemia cells may have contributed to the absence of antigen loss variants (ALVs) and the long-term disease-free survival observed in in vivo experiments.
[0138] One of the mechanisms for the observed cross-reactivity could be an enhanced avidity of 237CARs compared to 237Ab. CART cells commonly express several 100,000 CARs per cell and use as few as 100-200 CAR engagements per cell to lyse a target. Without wishing to be bound by theory, recognition of multiple weak-binding or a few strong-binding Tn glycopeptide mimotopes may have a cumulative effect on signaling by the immunological synapse, and this could be the reason for 237CART cells recognizing multiple target molecules and different cancer cells. By contrast, 237Ab has only two binding sites and a flow-cytometric signal requires the presence of at least about 1000 epitopes for detecting any binding. A second, not mutually exclusive, explanation could be that the single-chain variable fragment (scFv) used for the 237CAR construction has an altered specificity. Construction of sc237CAR requires an artificial peptide linker to replace the natural disulfide bonds that link VH and VL of the 237Ab and this could possibly result in altered specificity.
[0139] Cumulative recognition of weak ligands or ligands expressed at very low levels could be problematic for CART cells, as this could lead to serious toxicity if the ligand were expressed on normal cells. Fortunately, in the case of the Tn-glycopeptide-specific 237CART cells, cross-reactions have only been detected with other Tn-glycopeptide antigens and remained cancer-specific because of the essential requirement of the GalNAc moiety (Tn) for 237 binding. The molecular basis of this observation may be explained by our previous crystallographic analyses showing that the 237mAb uses a deep pocket encoded entirely by germ-line residues of the antibody to envelop the GalNAc carbohydrate moiety completely and this seems to make binding entirely dependent on the presence of the carbohydrate moiety of the epitope. In the normally glycosylated normal cells, the Tn antigens are hidden by the extended O-linked glycosylation and therefore no longer fit inside the pocket. In addition to enveloping Tn within the pocket, there are also some interactions between the 237 complementarity determining regions (CDRs) and the peptide backbone, explaining the preference of 237CART cells to bind some Tn-glycopeptide antigens over others. Aberrant Tn expression can be found in various type of human cancers.
[0140] COSMC mutation is one major mechanism that leads to Tn expression, which can be found in 1-6% of human cancers across various cancer types (
Example 12 Methods and Materials
[0141] Mice. C57BL/6-Rag1.sup.−/− (B6.129S7-Rag1tm1Mom/J), OT-1(C57BL/6-Tg(TcraTcrb)1100Mjb/J) and NSGTM NOD.Cg-Prkdcscid Il2rgtm1Wjl/SzJ were purchased from the Jackson Laboratory (Bar Harbor, Me.). The B6-Rag1.sup.−/− was subsequently bred to OT-1 to generate OT-1Rag.sup.−/− mice.
[0142] Cell lines. Ag104A and Neuro2A are spontaneous murine cancer cell lines lacking COSMC due to somatic cancer-specific Cosmc null mutations. COSMC-expressing variants were generated by retrovirally transducing a wild-type Cosmc pMFG vector. Ag104A naturally expresses high levels of mPDPN. mPDPN-negative Ag104A variants were made by CRISPR-Cas9 targeting exon 1 of Pdpn using the guiding sequence GAT ATT GTG ACC CCA GGT AC (SEQ ID NO:32). Jurkat is a human T cell leukemia line carrying a null mutation of COSMC. The Jurkat E6-1 cell line was either retrovirally transduced with mPDPN or we lentivirally truncated human CD19 (thCD19, which lacks the intracellular signaling domain) in tandem with the gene coding for wild-type COSMC linked by a P2A sequence. Neuro2A naturally lacks mPDPN. mPDPN-expressing variants of SKOV3, Jurkat and Neuro2A were made by retroviral transduction of Pdpn. SKOV3 and T47D are human cancer cell lines with normal COSMC function. COSMC was knocked out by CRISPR-Cas9 using CAC CGG GAC ACA TTA GGA TTG G (SEQ ID NO:33) as guiding sequence to target exon 1 of COSMC. Targeting exon 1 of MUC1 with the CRISPR-Cas9 guiding sequence CGG CCA CGG AAC CAG CTT CA (SEQ ID NO:34) was used to generate MUC1 knockout variants of SKOV3 and Jurkat cells. Cancer cell lines and their variants were maintained in DMEM except Jurkat lines were maintained in RPMI1640. Culture media were supplemented with 10% FCS.
[0143] CRISPR-Cas9 vectors. For CRISPR/Cas9-mediated gene knockouts, guiding sequences (gsRNA) were generated using the gsRNA designer from the Broad Institute and cloned over a BbsI side into the vector pSPCas9(BB)-2A-GFP (PX458, Addgene) as described (145). Cell lines were transfected by calcium phosphate and sorted for GFP-positive populations using FACSAriaII.
[0144] Flow cytometry. Samples were incubated with primary Abs followed by secondary APC-goat anti-mouse IgG(H+L) polyclonal Ab (SouthernBiotech). Cytometry data were collected on LSR II (BD Bioscience), and analyzed by Flowjo (TreeStar). The binding ratio represents the value of median fluorescence intensity (MFI) of a cell line stained with primary and secondary Abs divided by the MFI when stained with the secondary Ab only. Typically, Ab staining of cell surface antigens is performed at concentrations of about 10 μg/ml (about 67 nM), but we started at 3000 nM concentrations.
[0145] T cell transduction. 237CAR, 5E5CAR or CD19CAR was retrovirally transduced into T cells isolated from OT-1Rag.sup.−/− splenocytes, as described in (146).
[0146] Cytokine release assay. IFN-γ released for 24 hours into the medium by the 10,000 CART cells upon recognition of stimulator cells or after co-incubation with immobilized peptides was measured by ELISA (146).
[0147] Cytotoxicity assay. The capability of CART cells to lyse target cells was evaluated in a 4-hour .sup.51Cr release assay, as described (8).
[0148] Ab binding to peptides immobilized on plate surfaces. 50 μl of 10 μg/ml 237Ab or 5E5Ab was added to each well containing immobilized peptides and incubated for one hour at room temperature. Ab binding was detected by sandwich ELISA according to the manufacturer's protocol (Invitrogen).
[0149] Bioluminescence imaging. Jurkat cells were modified to express Click Beetle Green. 5×10.sup.6 Jurkat cells were injected through the tail vein and disease progression was monitored by weekly bioluminescence imaging on a Xenogen IVIS-200 Spectrum camera (Perkin Elmer), as described (119).
[0150] Statistical analysis. Data were analyzed using Prism software (GraphPad). For comparison of two groups with normally distributed data, the two-tailed Student's t-test was used. For comparison of non-parametric data, the Wilcoxon Rank Sum Test was employed. The significance level of the difference among the survival of animals from the different treatment groups was determined by the log-rank Mantel-Cox test. In the figure legends, ns stands for P>0.05, * stands for P≤0.05, ** stands for P≤0.01.
REFERENCES
[0151] 1. Moreau, R., J. Dausset, J. Bernard, and J. Moullec. 1957. Acquired hemolytic anemia with polyagglutinability of erythrocytes by a new factor present in normal blood. Bull Mem Soc Med Hop Paris 73:569-587. [0152] 2. Dausset, J., J. Moullec, and J. Bernard. 1959. Acquired hemolytic anemia with polyagglutinability of red blood cells due to a new factor present in normal human serum (Anti-Tn). Blood 14:1079-1093. [0153] 3. Brooks, C. L., A. Schietinger, S. N. Borisova, P. Kufer, M. Okon, T. Hirama, C. R. Mackenzie, L. X. Wang, H. Schreiber, and S. V. Evans. 2010. Antibody recognition of a unique tumor-specific glycopeptide antigen. Proc Natl Acad Sci USA 107:10056-10061. [0154] 4. Steentoft, C., K. T. Schjoldager, E. Clo, U. Mandel, S. B. Levery, J. W. Pedersen, K. Jensen, O. Blixt, and H. Clausen. 2010. Characterization of an immunodominant cancer-specific O-glycopeptide epitope in murine podoplanin (OTS8). Glycoconj J 27:571-582. [0155] 5. Blixt, O., E. Clo, A. S. Nudelman, K. K. Sorensen, T. Clausen, H. H. Wandall, P. O. Livingston, H. Clausen, and K. J. Jensen. 2010. A high-throughput O-glycopeptide discovery platform for seromic profiling. J Proteome Res 9:5250-5261. [0156] 6. Monach, P. A., S. C. Meredith, C. T. Siegel, and H. Schreiber. 1995. A unique tumor antigen produced by a single amino acid substitution. Immunity 2:45-59. [0157] 7. Liu, R. B., B. Engels, A. Arina, K. Schreiber, E. Hyjek, A. Schietinger, D. C. Binder, E. Butz, T. Krausz, D. A. Rowley, B. Jabri, and H. Schreiber. 2012. Densely Granulated Murine NK Cells Eradicate Large Solid Tumors. Cancer Res 72:1964-1974. [0158] 8. Morgan, R. A., J. C. Yang, M. Kitano, M. E. Dudley, C. M. Laurencot, and S. A. Rosenberg. 2010. Case report of a serious adverse event following the administration of T cells transduced with a chimeric antigen receptor recognizing ERBB2. Mol Ther 18:843-851. [0159] 9. Parkhurst, M. R., J. C. Yang, R. C. Langan, M. E. Dudley, D. A. Nathan, S. A. Feldman, J. L. Davis, R. A. Morgan, M. J. Merino, R. M. Sherry, M. S. Hughes, U. S. Kammula, G. Q. Phan, R. M. Lim, S. A. Wank, N. P. Restifo, P. F. Robbins, C. M. Laurencot, and S. A. Rosenberg. 2011. T cells targeting carcinoembryonic antigen can mediate regression of metastatic colorectal cancer but induce severe transient colitis. Mol Ther 19:620-626. [0160] 10. Fong, Y. 2012. Minutes of the Recombinant DNA Advisory Committee, 6/19/12. In Recombinant DNA Advisory Committee. U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES, National Institutes of Health, Bethesda, Md. 1-34. [0161] 11. Morgan, R. A., N. Chinnasamy, D. Abate-Daga, A. Gros, P. F. Robbins, Z. Zheng, M. E. Dudley, S. A. Feldman, J. C. Yang, R. M. Sherry, G. Q. Phan, M. S. Hughes, U. S. Kammula, A. D. Miller, C. J. Hessman, A. A. Stewart, N. P. Restifo, M. M. Quezado, M. Alimchandani, A. Z. Rosenberg, A. Nath, T. Wang, B. Bielekova, S. C. Wuest, N. Akula, F. J. McMahon, S. Wilde, B. Mosetter, D. J. Schendel, C. M. Laurencot, and S. A. Rosenberg. 2013. Cancer Regression and Neurological Toxicity Following Anti-MAGE-A3 TCR Gene Therapy. J Immunother 36:133-151. [0162] 12. Ju, T., V. I. Otto, and R. D. Cummings. 2011. The Tn antigen-structural simplicity and biological complexity. Angew Chem Int Ed Engl 50:1770-1791. [0163] 13. Springer, G. F. 1984. T and Tn, general carcinoma autoantigens. Science 224:1198-1206. [0164] 14. Springer, G. F., and H. Tegtmeyer. 1981. Origin of anti-Thomsen-Friedenreich (T) and Tn agglutinins in man and in White Leghorn chicks. Br J Haematol 47:453-460. [0165] 15. Spiotto, M. T., P. Yu, D. A. Rowley, M. I. Nishimura, S. C. Meredith, T. F. Gajewski, Y. X. Fu, and H. Schreiber. 2002. Increasing tumor antigen expression overcomes “ignorance” to solid tumors via crosspresentation by bone marrow-derived stromal cells. Immunity 17:737-747. [0166] 16. Schietinger, A., M. Philip, B. A. Yoshida, P. Azadi, H. Liu, S. C. Meredith, and H. Schreiber. 2006. A mutant chaperone converts a wild-type protein into a tumor-specific antigen. Science 314:304-308. [0167] 17. Ju, T., G. S. Lanneau, T. Gautam, Y. Wang, B. Xia, S. R. Stowell, M. T. Willard, W. Wang, J. Y. Xia, R. E. Zuna, Z. Laszik, D. M. Benbrook, M. H. Hanigan, and R. D. Cummings. 2008. Human tumor antigens Tn and sialyl Tn arise from mutations in Cosmc. Cancer Res 68:1636-1646. [0168] 18. Prokop, O., and G. Uhlenbruck. 1969. [N-acetyl-D-galactosamine in tumor cell membranes: demonstration by means of Helix agglutinins]. Med Welt 46:2515-2519. [0169] 19. Springer, G. F., P. R. Desai, and I. Banatwala. 1974. Blood group MN specific substances and precursors in normal and malignant human breast tissues. Naturwissenschaften 61:457-458. [0170] 20. Springer, G. F., P. R. Desai, and I. Banatwala. 1975. Blood group MN antigens and precursors in normal and malignant human breast glandular tissue. J Natl Cancer Inst 54:335-339. [0171] 21. Hirohashi, S., H. Clausen, T. Yamada, Y. Shimosato, and S. Hakomori. 1985. Blood group A cross-reacting epitope defined by monoclonal antibodies NCC-LU-35 and -81 expressed in cancer of blood group O or B individuals: its identification as Tn antigen. Proc Natl Acad Sci USA 82:7039-7043. [0172] 22. Wen, F. T., R. A. Thisted, D. A. Rowley, and H. Schreiber. 2012. A systematic analysis of experimental immunotherapies on tumors differing in size and duration of growth. Oncoimmunology 1:172-178. [0173] 23. Coulie, P. G., F. Lehmann, B. Lethe, J. Herman, C. Lurquin, M. Andrawiss, and T. Boon. 1995. A mutated intron sequence codes for an antigenic peptide recognized by cytolytic T lymphocytes on a human melanoma. Proc. Natl. Acad. Sci. U.S.A 92:7976-7980. [0174] 24. Wölfel, T., M. Hauer, J. Schneider, M. Serrano, C. Wölfel, E. Klehmann-Hieb, E. De Plaen, T. Hankeln, K. H. Meyer zum Buschenfelde, and D. Beach. 1995. A p16INK4a-insensitive CDK4 mutant targeted by cytolytic T lymphocytes in a human melanoma. Science 269:1281-1284. [0175] 25. Dubey, P., R. C. Hendrickson, S. C. Meredith, C. T. Siegel, J. Shabanowitz, J. C. Skipper, V. H. Engelhard, D. F. Hunt, and H. Schreiber. 1997. The immunodominant antigen of an ultraviolet-induced regressor tumor is generated by a somatic point mutation in the DEAD box helicase p68. J. Exp. Med. 185:695-705. [0176] 26. Yang, L., C. Lin, and Z. R. Liu. 2005. Phosphorylations of DEAD box p68 RNA helicase are associated with cancer development and cell proliferation. Mol Cancer Res 3:355-363. [0177] 27. Suzuki, H. I., K. Yamagata, K. Sugimoto, T. Iwamoto, S. Kato, and K. Miyazono. 2009. Modulation of microRNA processing by p53. Nature 460:529-533. [0178] 28. Fuller-Pace, F. V. 2006. DExD/H box RNA helicases: multifunctional proteins with important roles in transcriptional regulation. Nucleic Acids Res 34:4206-4215. [0179] 29. Schreiber, K., A. Arina, B. Engels, M. T. Spiotto, J. Sidney, A. Sette, T. Karrison, R. R. Weichselbaum, D. A. Rowley, and H. Schreiber. 2012. Spleen cells from young but not old immunized mice eradicate large established cancers. Clin Cancer Res 18:2526-2533. [0180] 30. Apostolopoulos, V., E. Yuriev, P. A. Ramsland, J. Halton, C. Osinski, W. Li, M. Plebanski, H. Paulsen, and I. F. McKenzie. 2003. A glycopeptide in complex with MHC class I uses the GalNAc residue as an anchor. Proc Natl Acad Sci USA 100:15029-15034. [0181] 31. Napoletano, C., A. Rughetti, M. P. Agervig Tarp, J. Coleman, E. P. Bennett, G. Picco, P. Sale, K. Denda-Nagai, T. Irimura, U. Mandel, H. Clausen, L. Frati, J. Taylor-Papadimitriou, J. Burchell, and M. Nuti. 2007. Tumor-associated Tn-MUC1 glycoform is internalized through the macrophage galactose-type C-type lectin and delivered to the HLA class I and II compartments in dendritic cells. Cancer Res 67:8358-8367. [0182] 32. Ju, T. and R. D. Cummings. 2002. A unique molecular chaperone Cosmc required for activity of the mammalian core 1 beta 3-galactosyltransferase. Proc Natl Acad Sci USA 99:16613-16618. [0183] 33. Fu, J., B. Wei, T. Wen, M. E. Johansson, X. Liu, E. Bradford, K. A. Thomsson, S. McGee, L. Mansour, M. Tong, J. M. McDaniel, T. J. Sferra, J. R. Turner, H. Chen, G. C. Hansson, J. Braun, and L. Xia. 2011. Loss of intestinal core 1-derived O-glycans causes spontaneous colitis in mice. J Clin Invest 121:1657-1666. [0184] 34. Blixt, O., O. I. Lavrova, D. V. Mazurov, E. Clo, S. K. Kracun, N. V. Bovin, and A. V. Filatov. 2012. Analysis of Tn antigenicity with a panel of new IgM and IgG1 monoclonal antibodies raised against leukemic cells. Glycobiology 22:529-542. [0185] 35. Sorensen, A. L., C. A. Reis, M. A. Tarp, U. Mandel, K. Ramachandran, V. Sankaranarayanan, T. Schwientek, R. Graham, J. Taylor-Papadimitriou, M. A. Hollingsworth, J. Burchell, and H. Clausen. 2006. Chemoenzymatically synthesized multimeric Tn/STn MUC1 glycopeptides elicit cancer-specific anti-MUC1 antibody responses and override tolerance. Glycobiology 16:96-107. [0186] 36. Tarp, M. A., A. L. Sorensen, U. Mandel, H. Paulsen, J. Burchell, J. Taylor-Papadimitriou, and H. Clausen. 2007. Identification of a novel cancer-specific immunodominant glycopeptide epitope in the MUC1 tandem repeat. Glycobiology 17:197-209. [0187] 37. Van Elssen, C. H., P. W. Frings, F. J. Bot, K. K. Van de Vijver, M. B. Huls, B. Meek, P. Hupperets, W. T. Germeraad, and G. M. Bos. 2010. Expression of aberrantly glycosylated Mucin-1 in ovarian cancer. Histopathology 57:597-606. [0188] 38. Blixt, O., D. Bueti, B. Burford, D. Allen, S. Julien, M. Hollingsworth, A. Gammerman, I. Fentiman, J. Taylor-Papadimitriou, and J. M. Burchell. 2011. Autoantibodies to aberrantly glycosylated MUC1 in early stage breast cancer are associated with a better prognosis. Breast Cancer Res 13:R25. [0189] 39. Wang, Y., T. Ju, X. Ding, B. Xia, W. Wang, L. Xia, M. He, and R. D. Cummings. 2010. Cosmc is an essential chaperone for correct protein O-glycosylation. Proc Natl Acad Sci USA 107:9228-9233. [0190] 40. Xia, L., T. Ju, A. Westmuckett, G. An, L. Ivanciu, J. M. McDaniel, F. Lupu, R. D. Cummings, and R. P. McEver. 2004. Defective angiogenesis and fatal embryonic hemorrhage in mice lacking core 1-derived O-glycans. J Cell Biol 164:451-459. [0191] 41. Cloosen, S., J. Arnold, M. Thio, G. M. Bos, B. Kyewski, and W. T. Germeraad. 2007. Expression of tumor-associated differentiation antigens, MUC1 glycoforms and CEA, in human thymic epithelial cells: implications for self-tolerance and tumor therapy. Cancer Res 67:3919-3926. [0192] 42. Ju, T., and R. D. Cummings. 2005. Protein glycosylation: chaperone mutation in Tn syndrome. Nature 437:1252. [0193] 43. Schreiber, H., and D. A. Rowley. 1999. Inflammation and Cancer. In Inflammation: Basic Principles and Clinical Correlates. J. I. Gallin, and R. Snyderman, editors. Lippincott Williams & Wilkins, Philadelphia. 1117-1129. [0194] 44. Philip, M., D. A. Rowley, and H. Schreiber. 2004. Inflammation as a tumor promoter in cancer induction. Semin Cancer Biol 14:433-439. [0195] 45. Kudo, T., T. Iwai, T. Kubota, H. Iwasaki, Y. Takayma, T. Hiruma, N. Inaba, Y. Zhang, M. Gotoh, A. Togayachi, and H. Narimatsu. 2002. Molecular cloning and characterization of a novel UDP-Gal:GalNAc(alpha) peptide beta 1,3-galactosyltransferase (C1Gal-T2), an enzyme synthesizing a core 1 structure of O-glycan. J Biol Chem 277:47724-47731. [0196] 46. Vlad, A. M., S. Muller, M. Cudic, H. Paulsen, L. Otvos, Jr., F. G. Hanisch, and O. J. Finn. 2002. Complex carbohydrates are not removed during processing of glycoproteins by dendritic cells: processing of tumor antigen MUC1 glycopeptides for presentation to major histocompatibility complex class II-restricted T cells. J Exp Med 196:1435-1446. [0197] 47. Ninkovic, T., L. Kinarsky, K. Engelmann, V. Pisarev, S. Sherman, O. J. Finn, and F. G. Hanisch. 2009. Identification of O-glycosylated decapeptides within the MUC1 repeat domain as potential MHC class I (A2) binding epitopes. Mol Immunol 47:131-140. [0198] 48. Wandall, H. H., O. Blixt, M. A. Tarp, J. W. Pedersen, E. P. Bennett, U. Mandel, G. Ragupathi, P. O. Livingston, M. A. Hollingsworth, J. Taylor-Papadimitriou, J. Burchell, and H. Clausen. 2010. Cancer biomarkers defined by autoantibody signatures to aberrant O-glycopeptide epitopes. Cancer Res 70:1306-1313. [0199] 49. Kalos, M., B. L. Levine, D. L. Porter, S. Katz, S. A. Grupp, A. Bagg, and C. H. June. 2011. T cells with chimeric antigen receptors have potent antitumor effects and can establish memory in patients with advanced leukemia. Sci Transl Med 3:95ra73. [0200] 50. Porter, D. L., B. L. Levine, M. Kalos, A. Bagg, and C. H. June. 2011. Chimeric antigen receptor-modified T cells in chronic lymphoid leukemia. N Engl J Med 365:725-733. [0201] 51. Carpenito, C., M. C. Milone, R. Hassan, J. C. Simonet, M. Lakhal, M. M. Suhoski, A. Varela-Rohena, K. M. Haines, D. F. Heitjan, S. M. Albelda, R. G. Carroll, J. L. Riley, I. Pastan, and C. H. June. 2009. Control of large, established tumor xenografts with genetically retargeted human T cells containing CD28 and CD137 domains. Proc Natl Acad Sci USA 106:3360-3365. [0202] 52. Lanitis, E., M. Poussin, I. S. Hagemann, G. Coukos, R. Sandaltzopoulos, N. Scholler, and D. J. Powell, Jr. 2012. Redirected antitumor activity of primary human lymphocytes transduced with a fully human anti-mesothelin chimeric receptor. Mol Ther 20:633-643. [0203] 53. Zhao, Y., Q. J. Wang, S. Yang, J. N. Kochenderfer, Z. Zheng, X. Zhong, M. Sadelain, Z. Eshhar, S. A. Rosenberg, and R. A. Morgan. 2009. A herceptin-based chimeric antigen receptor with modified signaling domains leads to enhanced survival of transduced T lymphocytes and antitumor activity. J Immunol 183:5563-5574. [0204] 54. Ando, H., T. Matsushita, M. Wakitani, T. Sato, S. Kodama-Nishida, K. Shibata, K. Shitara, and S. Ohta. 2008. Mouse-human chimeric anti-Tn IgG1 induced anti-tumor activity against Jurkat cells in vitro and in vivo. Biol Pharm Bull 31:1739-1744. [0205] 55. Welinder, C., B. Baldetorp, C. Borrebaeck, B. M. Fredlund, and B. Jansson. 2011. A new murine IgG1 anti-Tn monoclonal antibody with in vivo anti-tumor activity. Glycobiology 21:1097-1107. [0206] 56. Li, Q., M. R. Anver, D. O. Butcher, and J. C. Gildersleeve. 2009. Resolving conflicting data on expression of the Tn antigen and implications for clinical trials with cancer vaccines. Mol Cancer Ther 8:971-979. [0207] 57. Yu, L. G. 2007. The oncofetal Thomsen-Friedenreich carbohydrate antigen in cancer progression. Glycoconj J 24:411-420. [0208] 58. Akita, K., S. Fushiki, T. Fujimoto, M. Inoue, K. Oguri, M. Okayama, I. Yamashina, and H. Nakada. 2001. Developmental expression of a unique carbohydrate antigen, Tn antigen, in mouse central nervous tissues. J Neurosci Res 65:595-603. [0209] 59. Stone, J. D., D. H. Aggen, A. Schietinger, H. Schreiber, and D. M. Kranz. 2012. A sensitivity scale for targeting T cells with chimeric antigen receptors (CARs) and bispecific T-cell Engagers (BiTEs). Oncoimmunology 1:863-873. [0210] 60. Ward, P. L., H. Koeppen, T. Hurteau, and H. Schreiber. 1989. Tumor antigens defined by cloned immunological probes are highly polymorphic and are not detected on autologous normal cells. J. Exp. Med. 170:217-232. [0211] 61. Milone, M. C., J. D. Fish, C. Carpenito, R. G. Carroll, G. K. Binder, D. Teachey, M. Samanta, M. Lakhal, B. Gloss, G. Danet-Desnoyers, D. Campana, J. L. Riley, S. A. Grupp, and C. H. June. 2009. Chimeric receptors containing CD137 signal transduction domains mediate enhanced survival of T cells and increased antileukemic efficacy in vivo. Mol Ther 17:1453-1464. [0212] 62. Sadelain, M., R. Brentjens, and I. Riviere. 2009. The promise and potential pitfalls of chimeric antigen receptors. Curr Opin Immunol 21:215-223. [0213] 63. Schreiber, H. 2013. Cancer Immunology. In Fundamental Immunology. W. E. Paul, editor Lippincott-Wlliams & Wilkins, Philadelphia, Pa. 1200-1234. [0214] 64. Schietinger, A., M. Philip, R. B. Liu, K. Schreiber, and H. Schreiber. 2010. Bystander killing of cancer requires the cooperation of CD4(+) and CD8(+) T cells during the effector phase. J Exp Med 207:2469-2477. [0215] 65. Bos, R., and L. A. Sherman. 2010. CD4+ T-cell help in the tumor milieu is required for recruitment and cytolytic function of CD8+ T lymphocytes. Cancer Res 70:8368-8377. [0216] 66. Zhang, B., T. Karrison, D. A. Rowley, and H. Schreiber. 2008. IFN-gamma- and TNF-dependent bystander eradication of antigen-loss variants in established mouse cancers. J Clin Invest 118:1398-1404. [0217] 67. Neeson, P., A. Shin, K. M. Tainton, P. Guru, H. M. Prince, S. J. Harrison, S. Peinert, M. J. Smyth, J. A. Trapani, M. H. Kershaw, P. K. Darcy, and D. S. Ritchie. 2010. Ex vivo culture of chimeric antigen receptor T cells generates functional CD8+ T cells with effector and central memory-like phenotype. Gene Ther 17:1105-1116. [0218] 68. Steentoft, C., S. Y. Vakhrushev, M. B. Vester-Christensen, K. T. Schjoldager, Y. Kong, E. P. Bennett, U. Mandel, H. Wandall, S. B. Levery, and H. Clausen. 2011. Mining the O-glycoproteome using zinc-finger nuclease-glycoengineered SimpleCell lines. Nat Methods 8:977-982. [0219] 69. Taupier, M. A., J. F. Kearney, P. J. Leibson, M. R. Loken, and H. Schreiber. 1983. Nonrandom escape of tumor cells from immune lysis due to intraclonal fluctuations in antigen expression. Cancer Res 43:4050-4056. [0220] 70. Gupta, P. B., C. M. Fillmore, G. Jiang, S. D. Shapira, K. Tao, C. Kuperwasser, and E. S. Lander. 2011. Stochastic state transitions give rise to phenotypic equilibrium in populations of cancer cells. Cell 146:633-644. [0221] 71. Guba, M., G. Cernaianu, G. Koehl, E. K. Geissler, K. W. Jauch, M. Anthuber, W. Falk, and M. Steinbauer. 2001. A primary tumor promotes dormancy of solitary tumor cells before inhibiting angiogenesis. Cancer Res 61:5575-5579. [0222] 72. Louis, C. U., B. Savoldo, G. Dotti, M. Pule, E. Yvon, G. D. Myers, C. Rossig, H. V. Russell, O. Diouf, E. Liu, H. Liu, M. F. Wu, A. P. Gee, Z. Mei, C. M. Rooney, H. E. Heslop, and M. K. Brenner. 2011. Antitumor activity and long-term fate of chimeric antigen receptor-positive T cells in patients with neuroblastoma. Blood 118:6050-6056. [0223] 73. Baeuerle, P. A., P. Kufer, and R. Bargou. 2009. BiTE: Teaching antibodies to engage T-cells for cancer therapy. Curr Opin Mol Ther 11:22-30. [0224] 74. Liddy, N., G. Bossi, K. J. Adams, A. Lissina, T. M. Mahon, N. J. Hassan, J. Gavarret, F. C. Bianchi, N. J. Pumphrey, K. Ladell, E. Gostick, A. K. Sewell, N. M. Lissin, N. E. Harwood, P. E. Molloy, Y. Li, B. J. Cameron, M. Sami, E. E. Baston, P. T. Todorov, S. J. Paston, R. E. Dennis, J. V. Harper, S. M. Dunn, R. Ashfield, A. Johnson, Y. McGrath, G. Plesa, C. H. June, M. Kalos, D. A. Price, A. Vuidepot, D. D. Williams, D. H. Sutton, and B. K. Jakobsen. 2012. Monoclonal TCR-redirected tumor cell killing. Nat Med 18(6):980-987. [0225] 75. Narni-Mancinelli, E., J. Chaix, A. Fenis, Y. M. Kerdiles, N. Yessaad, A. Reynders, C. Gregoire, H. Luche, S. Ugolini, E. Tomasello, T. Walzer, and E. Vivier. 2011. Fate mapping analysis of lymphoid cells expressing the NKp46 cell surface receptor. Proc Natl Acad Sci USA 108:18324-18329. [0226] 76. Brentjens, R. J., J. B. Latouche, E. Santos, F. Marti, M. C. Gong, C. Lyddane, P. D. King, S. Larson, M. Weiss, I. Riviere, and M. Sadelain. 2003. Eradication of systemic B-cell tumors by genetically targeted human T lymphocytes co-stimulated by CD80 and interleukin-15. Nat Med 9:279-286. [0227] 77. Davila, M. L., R. Brentjens, X. Wang, I. Riviere, and M. Sadelain. 2012. How do CARs work?: Early insights from recent clinical studies targeting CD19. Oncoimmunology 1:1577-1583. [0228] 78. Mukherjee, P., L. B. Pathangey, J. B. Bradley, T. L. Tinder, G. D. Basu, E. T. Akporiaye, and S. J. Gendler. 2007. MUC1-specific immune therapy generates a strong anti-tumor response in a MUC1-tolerant colon cancer model. Vaccine 25:1607-1618. [0229] 79. Liu, Q. P., G. Sulzenbacher, H. Yuan, E. P. Bennett, G. Pietz, K. Saunders, J. Spence, E. Nudelman, S. B. Levery, T. White, J. M. Neveu, W. S. Lane, Y. Bourne, M. L. Olsson, B. Henrissat, and H. Clausen. 2007. Bacterial glycosidases for the production of universal red blood cells. Nat Biotechnol 25:454-464. [0230] 80. Pedersen, J. W., O. Blixt, E. P. Bennett, M. A. Tarp, I. Dar, U. Mandel, S. S. Poulsen, A. E. Pedersen, S. Rasmussen, P. Jess, H. Clausen, and H. H. Wandall. 2011. Seromic profiling of colorectal cancer patients with novel glycopeptide microarray. Int J Cancer 128:1860-1871. [0231] 81. Altman J. D., Moss P. A. H., Goulder P. J. R., Barouch D. H., McHeyzer-Williams M. G., Bell J. I., McMicheal A. J. and Davis M. M. (1996) Phenotypic analysis of antigen-specific T lymphocytes. Science 274, 94-96. [0232] 82. Bargou R., Leo E., Zugmaier G., Klinger M., Goebeler M., Knop S., Noppeney R., Viardot A., Hess G., Schuler M., Einsele H., Brandl C., Wolf A., Kirchinger P., Klappers P., Schmidt M., Riethmuller G., Reinhardt C., Baeuerle P. A. and Kufer P. (2008) Tumor regression in cancer patients by very low doses of a T cell-engaging antibody. Science 321, 974-977. [0233] 83. Bast R. C., Jr., Klug T. L., St John E., Jenison E., Niloff J. M., Lazarus H., Berkowitz R. S., Leavitt T., Griffiths C. T., Parker L., Zurawski V. R., Jr. and Knapp R. C. (1983) A radioimmunoassay using a monoclonal antibody to monitor the course of epithelial ovarian cancer. N Engl J Med 309, 883-887. [0234] 84. Bressan A., Bozzo F., Maggi C. A. and Binaschi M. (2013) OC125, M11 and OV197 epitopes are not uniformly distributed in the tandem-repeat region of CA125 and require the entire SEA domain. Dis Markers 34, 257-267 [0235] 85. Brossart P., Schneider A., Dill P., Schammann T., Grunebach F., Wirths S., Kanz L., Buhring H. J. and Brugger W. (2001) The epithelial tumor antigen MUC1 is expressed in hematological malignancies and is recognized by MUC1-specific cytotoxic T-lymphocytes. Cancer Res 61, 6846-6850. [0236] 87. Caruso H. G., Hurton L. V., Najjar A., Rushworth D., Ang S., Olivares S., Mi T., Switzer K., Singh H., Huls H., Lee D. A., Heimberger A. B., Champlin R. E. and Cooper L. J. (2015) Tuning Sensitivity of CAR to EGFR Density Limits Recognition of Normal Tissue While Maintaining Potent Antitumor Activity. Cancer Res 75, 3505-3518. [0237] 88. Chekmasova A. A., Rao T. D., Nikhamin Y., Park K. J., Levine D. A., Spriggs D. R. and Brentjens R. J. (2010) Successful eradication of established peritoneal ovarian tumors in SCID-Beige mice following adoptive transfer of T cells genetically targeted to the MUC16 antigen. Clin Cancer Res 16, 3594-3606. [0238] 89. Crawford F., Kozono H., White J., Marrack P. and Kappler J. (1998) Detection of antigen-specific T cells with multivalent soluble class II MHC covalent peptide complexes. Immunity 8, 675-682. [0239] 90. Dharma Rao T., Park K. J., Smith-Jones P., Iasonos A., Linkov I., Soslow R. A. and Spriggs D. R. (2010) Novel monoclonal antibodies against the proximal (carboxy-terminal) portions of MUC16. Appl Immunohistochem Mol Morphol 18, 462-472. [0240] 91. Doherty P. C. (2011) The tetramer transformation. J Immunol 187, 5-6. [0241] 92. Dolton G., Lissina A., Skowera A., Ladell K., Tungatt K., Jones E., Kronenberg-Versteeg D., Akpovwa H., Pentier J. M., Holland C. J., Godkin A. J., Cole D. K., Neller M. A., Miles J. J., Price D. A., Peakman M. and Sewell A. K. (2014) Comparison of peptide-major histocompatibility complex tetramers and dextramers for the identification of antigen-specific T cells. Clin Exp Immunol 177, 47-63. [0242] 93. Dyomin V. G., Palanisamy N., Lloyd K. O., Dyomina K., Jhanwar S. C., Houldsworth J. and Chaganti R. S. (2000) MUC1 is activated in a B-cell lymphoma by the t(1;14)(q21;q32) translocation and is rearranged and amplified in B-cell lymphoma subsets. Blood 95, 2666-2671. [0243] 94. Fatrai S., Schepers H., Tadema H., Vellenga E., Daenen S. M. and Schuringa J. J. (2008) Mucinl expression is enriched in the human stem cell fraction of cord blood and is upregulated in majority of the AML cases. Exp Hematol 36, 1254-1265. [0244] 95. Hadrup S. R., Bakker A. H., Shu C. J., Andersen R. S., van Veluw J., Hombrink P., Castermans E., Thor Straten P., Blank C., Haanen J. B., Heemskerk M. H. and Schumacher T. N. (2009) Parallel detection of antigen-specific T-cell responses by multidimensional encoding of MHC multimers. Nat Methods 6, 520-526. [0245] 96. Haridas D., Chakraborty S., Ponnusamy M. P., Lakshmanan I., Rachagani S., Cruz E., Kumar S., Das S., Lele S. M., Anderson J. M., Wittel U. A., Hollingsworth M. A. and Batra S. K. (2011) Pathobiological implications of MUC16 expression in pancreatic cancer. PLoS One 6, e26839. [0246] 97. Haridas D., Ponnusamy M. P., Chugh S., Lakshmanan I., Seshacharyulu P. and Batra S. K. (2014) MUC16: molecular analysis and its functional implications in benign and malignant conditions. FASEB J 28, 4183-4199. [0247] 98. Harris D. T., Hager M. V., Smith S. N., Cai Q., Stone J. D., Kruger P., Lever M., Dushek O., Schmitt T. M., Greenberg P. D. and Kranz D. M. (2018) Comparison of T Cell Activities Mediated by Human TCRs and CARs That Use the Same Recognition Domains. J Immunol 200, 1088-1100. [0248] 99. Harris D. T. and Kranz D. M. (2016) Adoptive T Cell Therapies: A Comparison of T Cell Receptors and Chimeric Antigen Receptors. Trends Pharmacol Sci 37, 220-230. [0249] 100. Hoffmann P., Hofmeister R., Brischwein K., Brandl C., Crommer S., Bargou R., Itin C., Prang N. and Baeuerle P. A. (2005) Serial killing of tumor cells by cytotoxic T cells redirected with a CD19-/CD3-bispecific single-chain antibody construct. Int J Cancer 115, 98-104. [0250] 101. Huang J., Zeng X., Sigal N., Lund P. J., Su L. F., Huang H., Chien Y. H. and Davis M. M. (2016) Detection, phenotyping, and quantification of antigen-specific T cells using a peptide-MHC dodecamer. PNAS 113, E1890-1897. [0251] 102. Ju T., Aryal R. P., Kudelka M. R., Wang Y. and Cummings R. D. (2014) The Cosmc connection to the Tn antigen in cancer. Cancer Biomark 14, 63-81. [0252] 103. Ju T. and Cummings R. D. (2002) A unique molecular chaperone Cosmc required for activity of the mammalian core 1 beta 3-galactosyltransferase. PNAS 99, 16613-16618. [0253] 104. Krishn S. R., Kaur S., Smith L. M., Johansson S. L., Jain M., Patel A., Gautam S. K., Hollingsworth M. A., Mandel U., Clausen H., Lo W. C., Fan W. T., Manne U. and Batra S. K. (2016) Mucins and associated glycan signatures in colon adenoma-carcinoma sequence: Prospective pathological implication(s) for early diagnosis of colon cancer. Cancer Lett 374, 304-314. [0254] 105. Kufe D. W. (2009) Mucins in cancer: function, prognosis and therapy. Nat Rev Cancer 9, 874-885. [0255] 106. Lavrsen K., Madsen C. B., Rasch M. G., Woetmann A., Odum N., Mandel U., Clausen H., Pedersen A. E. and Wandall H. H. (2013) Aberrantly glycosylated MUC1 is expressed on the surface of breast cancer cells and a target for antibody-dependent cell-mediated cytotoxicity. Glycoconj J 30, 227-236. [0256] 107. Liu X., Jiang S., Fang C., Yang S., Olalere D., Pequignot E. C., Cogdill A. P., Li N., Ramones M., Granda B., Zhou L., Loew A., Young R. M., June C. H. and Zhao Y. (2015) Affinity-Tuned ErbB2 or EGFR Chimeric Antigen Receptor T Cells Exhibit an Increased Therapeutic Index against Tumors in Mice. Cancer Res 75, 3596-3607. [0257] 108. Loffler A., Kufer P., Lutterbuse R., Zettl F., Daniel P. T., Schwenkenbecher J. M., Riethmuller G., Dorken B. and Bargou R. C. (2000) A recombinant bispecific single-chain antibody, CD19×CD3, induces rapid and high lymphoma-directed cytotoxicity by unstimulated T lymphocytes. Blood 95, 2098-2103. [0258] 109. Lynn R. C., Feng Y., Schutsky K., Poussin M., Kalota A., Dimitrov D. S. and Powell D. J., Jr. (2016) High-affinity FRbeta-specific CAR T cells eradicate AML and normal myeloid lineage without HSC toxicity. Leukemia 30, 1355-1364. [0259] 110. Marcos-Silva L., Narimatsu Y., Halim A., Campos D., Yang Z., Tarp M. A., Pereira P. J., Mandel U., Bennett E. P., Vakhrushev S. Y., Levery S. B., David L. and Clausen H. (2014) Characterization of binding epitopes of CA125 monoclonal antibodies. J Proteome Res 13, 3349-3359. [0260] 111. Marcos-Silva L., Ricardo S., Chen K., Blixt O., Arigi E., Pereira D., Hogdall E., Mandel U., Bennett E. P., Vakhrushev S. Y., David L. and Clausen H. (2015) A novel monoclonal antibody to a defined peptide epitope in MUC16. Glycobiology 25, 1172-1182. [0261] 112. Matsui K., Boniface J. J., Reay P. A., Schild H., de St. Groth B. F. and Davis M. M. (1991) Low affinity interaction of peptide-MHC complexes with T cell receptors. Science 254, 1788-1791. [0262] 113. Maude S. L., Frey N., Shaw P. A., Aplenc R., Barrett D. M., Bunin N. J., Chew A., Gonzalez V. E., Zheng Z., Lacey S. F., Mahnke Y. D., Melenhorst J. J., Rheingold S. R., Shen A., Teachey D. T., Levine B. L., June C. H., Porter D. L. and Grupp S. A. (2014) Chimeric antigen receptor T cells for sustained remissions in leukemia. N Engl J Med 371, 1507-1517. [0263] 114. Maude S. L., Laetsch T. W., Buechner J., Rives S., Boyer M., Bittencourt H., Bader P., Verneris M. R., Stefanski H. E., Myers G. D., Qayed M., De Moerloose B., Hiramatsu H., Schlis K., Davis K. L., Martin P. L., Nemecek E. R., Yanik G. A., Peters C., Baruchel A., Boissel N., Mechinaud F., Balduzzi A., Krueger J., June C. H., Levine B. L., Wood P., Taran T., Leung M., Mueller K. T., Zhang Y., Sen K., Lebwohl D., Pulsipher M. A. and Grupp S. A. (2018) Tisagenlecleucel in Children and Young Adults with B-Cell Lymphoblastic Leukemia. N Engl J Med 378, 439-448. [0264] 115. McCormack E., Adams K. J., Hassan N. J., Kotian A., Lissin N. M., Sami M., Mujic M., Osdal T., Gjertsen B. T., Baker D., Powlesland A. S., Aleksic M., Vuidepot A., Morteau O., Sutton D. H., June C. H., Kalos M., Ashfield R. and Jakobsen B. K. (2013) Bi-specific TCR-anti CD3 redirected T-cell targeting of NY-ESO-1- and LAGE-1-positive tumors. Cancer Immunol Immunother 62, 773-785. [0265] 116. Mobus V. J., Baum R. P., Bolle M., Kreienberg R., Noujaim A. A., Schultes B. C. and Nicodemus C. F. (2003) Immune responses to murine monoclonal antibody-B43.13 correlate with prolonged survival of women with recurrent ovarian cancer. Am J Obstet Gynecol 189, 28-36. [0266] 117. Moniaux N., Varshney G. C., Chauhan S. C., Copin M. C., Jain M., Wittel U. A., Andrianifahanana M., Aubert J. P. and Batra S. K. (2004) Generation and characterization of anti-MUC4 monoclonal antibodies reactive with normal and cancer cells in humans. J Histochem Cytochem 52, 253-261. [0267] 118. Newell E. W., Klein L. O., Yu W. and Davis M. M. (2009) Simultaneous detection of many T-cell specificities using combinatorial tetramer staining. Nat Methods 6, 497-499. [0268] 119. Posey A. D., Jr., Schwab R. D., Boesteanu A. C., Steentoft C., Mandel U., Engels B., Stone J. D., Madsen T. D., Schreiber K., Haines K. M., Cogdill A. P., Chen T. J., Song D., Scholler J., Kranz D. M., Feldman M. D., Young R., Keith B., Schreiber H., Clausen H., Johnson L. A. and June C. H. (2016) Engineered CAR T Cells Targeting the Cancer-Associated Tn-Glycoform of the Membrane Mucin MUC1 Control Adenocarcinoma. Immunity 44, 1444-1454. [0269] 120. Radhakrishnan P., Dabelsteen S., Madsen F. B., Francavilla C., Kopp K. L., Steentoft C., Vakhrushev S. Y., Olsen J. V., Hansen L., Bennett E. P., Woetmann A., Yin G., Chen L., Song H., Bak M., Hlady R. A., Peters S. L., Opaysky R., Thode C., Qvortrup K., Schjoldager K. T., Clausen H., Hollingsworth M. A. and Wandall H. H. (2014) Immature truncated O-glycophenotype of cancer directly induces oncogenic features. PNAS 111, E4066-4075. [0270] 121. Ricardo S., Marcos-Silva L., Pereira D., Pinto R., Almeida R., Soderberg O., Mandel U., Clausen H., Felix A., Lunet N. and David L. (2015) Detection of glyco-mucin profiles improves specificity of MUC16 and MUC1 biomarkers in ovarian serous tumours. Mol Oncol 9, 503-512. [0271] 122. RodrIguez E., Schetters S. T. T. and van Kooyk Y. (2018) The tumour glyco-code as a novel immune checkpoint for immunotherapy. Nat Rev Immunol 18, 204-211. [0272] 123. Saitou M., Goto M., Horinouchi M., Tamada S., Nagata K., Hamada T., Osako M., Takao S., Batra S. K., Aikou T., Imai K. and Yonezawa S. (2005) MUC4 expression is a novel prognostic factor in patients with invasive ductal carcinoma of the pancreas. J Clin Pathol 58, 845-852. [0273] 124. Schietinger A., Philip M. and Schreiber H. (2008) Specificity in cancer immunotherapy. Semin Immunol 20, 276-285. [0274] 125. Schmitt T. M., Aggen D. H., Ishida-Tsubota K., Ochsenreither S., Kranz D. M. and Greenberg P. D. (2017) Generation of higher affinity T cell receptors by antigen-driven differentiation of progenitor T cells in vitro. Nat Biotechnol 35, 1188-1195. [0275] 126. Sharma P. and Kranz D. M. (2016) Recent advances in T-cell engineering for use in immunotherapy. F1000Res 5 [0276] 127. Sharma P. and Kranz D. M. (2018) Subtle changes at the variable domain interface of the T-cell receptor can strongly increase affinity. J Biol Chem 293, 1820-1834. [0277] 128. Smith S. N., Wang Y., Baylon J. L., Singh N. K., Baker B. M., Tajkhorshid E. and Kranz D. M. (2014) Changing the peptide specificity of a human T-cell receptor by directed evolution. Nat Commun 5, 5223. [0278] 129. Sommermeyer D., Hill T., Shamah S. M., Salter A. I., Chen Y., Mohler K. M. and Riddell S. R. (2017) Fully human CD19-specific chimeric antigen receptors for T-cell therapy. Leukemia 31, 2191-2199. [0279] 130. Sommermeyer D., Hudecek M., Kosasih P. L., Gogishvili T., Maloney D. G., Turtle C. J. and Riddell S. R. (2016) Chimeric antigen receptor-modified T cells derived from defined CD8+ and CD4+ subsets confer superior antitumor reactivity in vivo. Leukemia 30, 492-500. [0280] 131. Sorensen A. L., Reis C. A., Tarp M. A., Mandel U., Ramachandran K., Sankaranarayanan V., Schwientek T., Graham R., Taylor-Papadimitriou J., Hollingsworth M. A., Burchell J. and Clausen H. (2006) Chemoenzymatically synthesized multimeric Tn/STn MUC1 glycopeptides elicit cancer-specific anti-MUC1 antibody responses and override tolerance. Glycobiology 16, 96-107. [0281] 132. Stone J. D., Artyomov M. N., Chervin A. S., Chakraborty A. K., Eisen H. N. and Kranz D. M. (2011) Interaction of streptavidin-based peptide-MHC oligomers (tetramers) with cell-surface TCRs. J Immunol 187, 6281-6290. [0282] 133. Sykulev Y., Brunmark A., Jackson M., Cohen R. J., Peterson P. A. and Eisen H. N. (1994) Kinetics and affinity of reactions between an antigen-specific T cell receptor and peptide-MHC complexes. Immunity 1, 15-22. [0283] 134. Takahashi T., Makiguchi Y., Hinoda Y., Kakiuchi H., Nakagawa N., Imai K. and Yachi A. (1994) Expression of MUC1 on myeloma cells and induction of HLA-unrestricted CTL against MUC1 from a multiple myeloma patient. J Immunol 153, 2102-2109. [0284] 135. Tarhan Y. E., Kato T., Jang M., Haga Y., Ueda K., Nakamura Y. and Park J. H. (2016) Morphological Changes, Cadherin Switching, and Growth Suppression in Pancreatic Cancer by GALNT6 Knockdown. Neoplasia 18, 265-272. [0285] 136. Tarp M. A., Sorensen A. L., Mandel U., Paulsen H., Burchell J., Taylor-Papadimitriou J. and Clausen H. (2007) Identification of a novel cancer-specific immunodominant glycopeptide epitope in the MUC1 tandem repeat. Glycobiology 17, 197-209. [0286] 137. Topp M. S., Kufer P., Gokbuget N., Goebeler M., Klinger M., Neumann S., Horst H. A., Raff T., Viardot A., Schmid M., Stelljes M., Schaich M., Degenhard E., Kohne-Volland R., Bruggemann M., Ottmann O., Pfeifer H., Burmeister T., Nagorsen D., Schmidt M., Lutterbuese R., Reinhardt C., Baeuerle P. A., Kneba M., Einsele H., Riethmuller G., Hoelzer D., Zugmaier G. and Bargou R. C. (2011) Targeted therapy with the T-cell-engaging antibody blinatumomab of chemotherapy-refractory minimal residual disease in B-lineage acute lymphoblastic leukemia patients results in high response rate and prolonged leukemia-free survival. J Clin Oncol 29, 2493-2498. [0287] 138. Zinn et al., 2008. “Noninvasive bioluminescence imaging in small animals.” ILAR J. 49(1): 103-115. [0288] 139. Brentjens, R. J., Davila, M. L., Riviere, L, Park, J., Wang, X., Cowell, L. G., Bartido, S., Stefanski, J., Taylor, C., Olszewska, M. and Borquez-Ojeda, O., 2013. CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute lymphoblastic leukemia. Science translational medicine, 5(177), pp. 177ra38-177ra38. [0289] 140. Grupp, S. A., Kalos, M., Barrett, D., Aplenc, R., Porter, D. L., Rheingold, S. R., Teachey, D. T., Chew, A., Hauck, B., Wright, J. F. and Milone, M. C., 2013. Chimeric antigen receptor-modified T cells for acute lymphoid leukemia. New England Journal of Medicine, 368(16), pp. 1509-1518. [0290] 141. Sun, X., Ju, T., Cummings, R. D., 2018. Differential expression of Cosmc, T-synthase and mucins in Tn-positive colorectal cancers. BMC Cancer 18:827. [0291] 142. Zlocowski, N., Grupe, V., Garay, Y. C., Nores, G. A., Lardone, R. D., and Irazoqui, F. J., 2019. Purified human anti-Tn and anti-T antibodies specifically recognize carcinoma tissues. Nature. 9:8097. [0292] 143. June, C H, Sadelain, M. 2018. Chimeric Antigen Receptor Therapy, N Engl J Med 379(1):64-73. [0293] 144. Movahedin, M., Brroks, T. M., Supekar, N. T., Gokanapudi, N., Boons, G. J., Brooks, C. L. 2017 Glycosylation of MUC1 influences the binding of a therapeutic antibody by altering the conformational equilibrium of the antigen. Glycobiology. 27(7):677-87. [0294] 145. Ran, F. A., Hsu, P. D., Wright, J., Agarwala, V., Scott, D. A., Zhang, F. 2013 Genome engineering using the CRISPR-Cas9 system. Nat Protoc 8(11):2281-308. [0295] 146. Leisegang, M., Engels, B., Schreiber, K., Yew, P. Y., Kiyotani., K., Idel, C., et al. 2016. Eradication of large solid tumors by gene therapy with a T-cell receptor targeting a single cancer-specific point mutation. Clin Cancer Res 22(11):2734-43.
[0296] Each of the references cited herein is hereby incorporated by reference in its entirety or in relevant part, as would be apparent from the context of the citation.
[0297] From the disclosure herein it will be appreciated that, although specific embodiments of the disclosure have been described herein for purposes of illustration, various modifications may be made without deviating from the spirit and scope of the disclosure.