Described herein are antibodies that target Leukemia Inhibitory Factor (LIF). Also described herein are uses of these antibodies for the treatment of cancer.

The technology described herein is directed to structural analysis, particularly of small proteins via cryo-EM.

Provided herein are compositions and methods for vaccination and research applications. In particular, provided herein are non-neuroinvasive herpesviruses and alpha herpesviruses and uses thereof.

The present invention relates to antibodies or antigen-binding fragments that are useful for treating influenza B viruses. The present invention also relates to various pharmaceutical compositions and methods of treating influenza using the antibodies or antigen-binding fragments.

Disclosed herein is a system for discovering a drug active site of protein using a pathogenic mutation. The system includes: a pathogenic mutation position detection unit for detecting a pathogenic mutation position corresponding to a pathogenic mutation in a three-dimensional structure of protein, using pathogenic mutation data containing information on a pathogenic mutation causing an abnormal protein function and protein structure data containing information on the three-dimensional structure corresponding to genetic sequencing of the protein; and a drug active site detection unit detecting a drug active site, corresponding to the pathogenic mutation position, and, to which a drug is bindable.

The present disclosure is directed to antibodies binding to and neutralizing henipavirus and methods for use thereof. Thus, in accordance with the present disclosure, there is provided a method of detecting a henipavirus infection in a subject comprising (a) contacting a sample from said subject with an antibody or antibody fragment having clone-paired heavy and light chain CDR sequences from Tables 3 and 4, respectively; and (b) detecting henipavirus in said sample by binding of said antibody or antibody fragment to a henipavirus antigen in said sample.

The present disclosure relates to a method of protein structure and amino acid residue interaction prediction based on saturation suppressor mutagenesis screening of a protein of interest. The method of the instant disclosure can be adapted for multi-protein complexes, and is useful where crystal structure of a protein of interest is not available.

The invention relates to antibodies and derivatives thereof such as bispecific antibodies and chimeric antigen receptors (CARs) with affinity matured and/or humanized targeting domains specific to the ROR2 antigen. The invention encompasses the nucleic acids and vectors encoding said antibodies and derivatives, the cells and pharmaceutical compositions containing them, in particular for their use in cancer therapy.

Provided herein are antibodies that immunospecifically bind to CD123. Also described are related polynucleotides capable of encoding the provided CD123-specific antibodies or antigen-binding fragments, cells expressing the provided antibodies or antigen-binding fragments, as well as associated vectors and detectably labeled antibodies or antigen-binding fragments. In addition, methods of using the provided antibodies are described. For example, the provided antibodies may be used to diagnose, treat, or monitor CD123-expressing cancer progression, regression, or stability; to determine whether or not a patient should be treated for cancer; or to determine whether or not a subject is afflicted with CD123-expressing cancer and thus may be amenable to treatment with a CD123-specific anti-cancer therapeutic, such as the multispecific antibodies against CD123 and CD3 described herein.

Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX.sub.1AMGWFRQAPGKEREX.sub.2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X.sub.1 is selected from Y or F, and X.sub.2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.