Patent classifications
A23L3/16
Drink water treatment composition, and method of making a drink water treatment composition
A drink water treatment composition comprises a first edible, water-soluble salt that has a weight, e.g., between about 15% and about 25% by weight of the composition, and a second edible, water-soluble salt that has a weight, e.g., between about 65% and about 75% by weight of the composition and in admixture with the first edible, water-soluble salt. The composition can also include a third edible, water-soluble salt that has a weight, e.g., between about 5% and about 10% by weight of the composition and in admixture with the first and second edible, water-soluble salts. The mixture of edible, water-soluble salts is packaged in an effective amount to be mixed and dissolved in a reference amount of drinking water to re-mineralize the drinking water for human ingestion.
Drink water treatment composition, and method of making a drink water treatment composition
A drink water treatment composition comprises a first edible, water-soluble salt that has a weight, e.g., between about 15% and about 25% by weight of the composition, and a second edible, water-soluble salt that has a weight, e.g., between about 65% and about 75% by weight of the composition and in admixture with the first edible, water-soluble salt. The composition can also include a third edible, water-soluble salt that has a weight, e.g., between about 5% and about 10% by weight of the composition and in admixture with the first and second edible, water-soluble salts. The mixture of edible, water-soluble salts is packaged in an effective amount to be mixed and dissolved in a reference amount of drinking water to re-mineralize the drinking water for human ingestion.
Composition for Gelled Food with Soft Mouthfeel and Preparation Method Therefor
The present application relates to a composition for a gelled food including vegetable cream, and a gelling agent which includes agar and guar gum, a gelled food including the composition for a gelled food, a method for preparing a composition for a gelled food, the method including (A) mixing a gelling agent which includes agar and guar gum in water to prepare a gelled product and (B) mixing the gelled product with vegetable cream to prepare a mixture, and a method for producing a gelled food, the method including heat sterilizing a composition for a gelled food produced by the method for producing a composition for a gelled food.
Composition for Gelled Food with Soft Mouthfeel and Preparation Method Therefor
The present application relates to a composition for a gelled food including vegetable cream, and a gelling agent which includes agar and guar gum, a gelled food including the composition for a gelled food, a method for preparing a composition for a gelled food, the method including (A) mixing a gelling agent which includes agar and guar gum in water to prepare a gelled product and (B) mixing the gelled product with vegetable cream to prepare a mixture, and a method for producing a gelled food, the method including heat sterilizing a composition for a gelled food produced by the method for producing a composition for a gelled food.
Oat bran composition comprising beta glucan and method of making
Providing an oat bran composition that contains water, optionally an acid, and oat bran delivering at least about 0.75 g of beta glucan per serving to provide a heart-healthy and consumer-acceptable product through application of shear to reduce viscosity.
Process for Aseptically Preparing Fruits and Vegetables
Provided are processes for aseptically preparing fruits and vegetables, such as mashed potatoes wherein the process minimizes and/or eliminates free starch in the final product, thereby resulting in a product having a superior taste and/or texture. The process includes heating of the fruit or vegetable to a temperature sufficient to gelatinize starch in the fruit or vegetable. Moreover, the fruit or vegetable may then be cooled, such as to set the structure of the fruit's or vegetable's starch cells. The fruit or vegetable may be reduced in size, such as to about inch before mixing with further ingredients. The fruit or vegetable is then sterilized, which may include a 5 log kill step and result in halting the enzymatic reactions within the fruit or vegetable. After sterilization, the potatoes may then be cooled before being aseptically packaged and stored.
ANTIBACTERIAL METHOD
The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINVVYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINVVYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.
ANTIBACTERIAL METHOD
The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.
Avocado extract composition has bactericidal and antiviral properties and method of manufacturing the same
The present invention relates to the provision of a bactericidal, antiviral preparation obtained from the process of forming a homogeneous solution mixture by mixing an emulsion of butter extract. The method of making this composition is a systematic technical solution to create a multi-polar substance that can dissolve easily in water but still has to be soluble in oil, along with an osmotic substance that dissolves the lipid layer capsid inactivates the virus. Compositions obtained from this method have the effect of bactericidal, antiviral, environmental treatmentdeodorizinganti-pollution in order to meet the urgent needs of people, society and environment.
METHOD FOR RECOVERING POMACE
A method of recovering pomace produced during the processing of whole fruits and vegetables is described. The method includes optionally enzymatically treating a cold mash during a blanching step to form a hot mash which is finished and then pasteurized and cooled to a temperature no greater than about 2 C. Thereafter, the pasteurized and cooled product is separated into juice and pomace, which has a temperature no greater than about 13 C. and which can be packaged for use.