Provided are: a method for producing a nasal drop composition suitable for treatment or prevention of a disease or symptom in the nasal cavities; and a nasal drop composition produced by the production method. The nasal drop composition production method characterized by including a mixing step of mixing earthworm castings with water and a collecting step of collecting vaporized water generated from a mixture obtained in the mixing step to obtain a liquid; and the nasal drop composition produced by the production method. It is preferred to further mix an organic substance together with the earthworm castings and the water in the mixing step.

Provided are: a method for producing a nasal drop composition suitable for treatment or prevention of a disease or symptom in the nasal cavities; and a nasal drop composition produced by the production method. The nasal drop composition production method characterized by including a mixing step of mixing earthworm castings with water and a collecting step of collecting vaporized water generated from a mixture obtained in the mixing step to obtain a liquid; and the nasal drop composition produced by the production method. It is preferred to further mix an organic substance together with the earthworm castings and the water in the mixing step.

The invention provides liquid formulation compositions and medicament delivery devices, and methods for preparing and using the same. For example, the liquid formulation composition is an emulsion including a solvent and liquid particles, which includes surfactants and are dispersed in the solvent. The volume average particle size of the liquid particles is less than about 100 μm; the surface tension of the liquid formulation composition is less than about 60 mN/m; and the absolute value of zeta potential is greater than about 15 mV. The containment vessel may be a sprayer or a dropping device. The invention also provides methods for preparation of the liquid formulation compositions and medicament delivery devices as well as methods for using the same in treatment of various diseases and condition, for example, otitis media, otitis externa, rhinitis, sinusitis, lower respiratory tract inflammation, xerostomia (dry mouth), xerophthalmia (dry eyes) and xeromycteria (dry nose).

This invention provides compounds of Formula I

##STR00001##

wherein B, G, A, E, R.sup.1, R.sup.2, R.sup.3, m and n are as defined herein, which are useful as type I receptor tyrosine kinase inhibitors, and methods of use thereof in the treatment of hyperproliferative disorders in mammals.

Mucolytic agents for use in treating pulmonary sarcoidosis are described herein. Patients in need of treatment for pulmonary sarcoidosis are administered a therapeutically effective amount of a mucolytic agent such as DNase I, Mesna or DiMesna. In some embodiments, the DNase I is a recombinant human DNase I such as dornase alfa.

Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX.sub.1AMGWFRQAPGKEREX.sub.2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X.sub.1 is selected from Y or F, and X.sub.2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.

The present disclosure provides a method of treating a respiratory disease or disorder in a subject in need thereof, the method comprising: administering a protein having hyaluronidase activity and/or 4-methylumbelliferone (4-MU) to a lung of the subject including, for example, in an aerosolized formulation.

Compound I of the formula (formula) A pharmaceutically acceptable salt of Compound I. Pharmaceutical compositions containing at least Compound I and methods of treating cystic fibrosis comprising administering at least Compound I. Pharmaceutical compositions containing a pharmaceutically acceptable salt of at least Compound I and methods of treating cystic fibrosis comprising administering a pharmaceutically acceptable salt of at least Compound I. ##STR00001##

Provided herein are methods, compositions, and uses relating to inhibitors of stem cell factor. For example, provided herein are antibodies targeting stem cell factor and methods for treating fibrotic and tissue remodeling diseases.

The present invention relates to the field of medicine. It relates more particularly to the use of compounds to prevent and/or treat lipotoxicity in a subject, especially lipotoxicity by hypoxia. The invention relates more particularly to compositions, especially pharmaceuticals compositions and nutritional supplements or complements comprising such compounds as well as their use to prevent and/or treat lipotoxicity, especially lipotoxicity by hypoxia. The compounds and compositions of the invention can especially be advantageously used to prevent and/or treat a pathology from among pulmonary pathologies, especially cystic fibrosis or a chronic obstructive pulmonary disease.