Methods and Compositions for Identification and Quantitation of ENOX2 Transcript Variants as Indications of Cancer Presence in Blood Serum and Other Body Fluids Based on Gold or Silver Nanoparticle Formation

20170322214 · 2017-11-09

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention includes a semi-quantitative method for the detection of ENOX2 transcript variants from one or more anti-ENOX2 antibody-binding spots on a blot comprising the steps of: electrophoretically separating proteins from a concentrated blood, serum, or plasma sample from the subject; transferring the electrophoretically separated proteins to a substrate; separating the one or more ENOX2 transcript variants from the one or more anti-ENOX2 antibody-binding spots; and measuring an ENOX2-catalyzed conversion of an ionic silver or gold to a colloidal silver or gold detected by light scattering from the one or more anti-ENOX2 antibody binding spots on the substrate, wherein each of the one or more spots is indicative of the ENOX2 transcript variant. Also provided is the basis for a point of care test to detect ENOX2 transcript variants based on use of colloidal gold or silver complexes with ENOX2 as a rapid simple test for cancer presence.

    Claims

    1. A semi-quantitative method for the detection of ENOX2 transcript variants from one or more anti-ENOX2 antibody-binding spots comprising the steps of: electrophoretically separating proteins from a concentrated blood, serum, or plasma sample from a subject; transferring the electrophoretically separated proteins to a substrate; separating the one or more ENOX2 transcript variants from the one or more anti-ENOX2 antibody-binding spots; and measuring an ENOX2-catalyzed conversion of an ionic gold or ionic silver to colloidal gold or colloidal silver, respectively, detected by light scattering from the one or more anti-ENOX2 antibody binding spots on the substrate, wherein each of the one or more spots is indicative of an ENOX2 transcript variant.

    2. The method of claim 1, wherein quantitation is achieved by removing ENOX2 antibody reactive spots from the blot with a cork borer and quantitating the amount of ENOX2 using elution and reaction with ionic silver or gold to form silver nanoparticles and their quantitation measured by light scattering when compared to a background sample.

    3. The method of claim 1, wherein a signal above a background confirms the present of the ENOX2 transcript variant.

    4. The method of claim 1, further comprising the step of measuring the ENOX2-catalyzed conversion of ionic silver to colloidal silver is defined further as comprising the steps of: obtaining a core from the one or more anti-ENOX2 antibody-binding spots suspected of comprising at least one ENOX2 transcript variant separated by molecular weight and isoelectric point; incubating the core with silver or gold oxide in solution to form colloidal silver or gold; and developing the colloidal silver; and measuring the amount and/or presence of colloidal silver at 350-650 nm by comparing the light from the core with light from a background core that did not contain an ENOX2 transcript variant.

    5. The method of claim 4, wherein the light scattering is a doublet at 469.3 and 469.7 nm.

    6. The method of claim 1, wherein the tissue of origin of the cancer detected is selected from at least one of bladder, blood cell, lymphomas, leukemias, multiple myelomas and myelomas, breast, cervical, colorectal, esophageal, gastric, hepatocellular, small cell lung, non-small cell lung, melanoma, mesothelioma, ovarian, pancreatic, prostate, renal cell (kidney), sarcoma, squamous cell, testicular germ cell, thyroid follicular, thyroid papillary, or uterine.

    7. The method of claim 1, further comprising the step of detecting and determining a tissue of origin of a human cancer at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 20 years in advance of clinical symptoms.

    8. The method of claim 1, where by the principle of a colloidal gold or silver-based pregnancy test using an antibody to SEQ ID NO. 2 is used as a point of care test to detect ENOX2 presence in blood sera or other body fluids.

    9. The method of claim 1, further comprising measuring colloidal gold.

    10. A semi-quantitative method for the detection of ENOX2 transcript variants from one or more anti-ENOX2 antibody-binding spots comprising the steps of: obtaining a substrate onto which proteins obtained from concentrated blood, serum, or plasma sample from a subject have been transferred electrophoretically; separating the one or more ENOX2 transcript variants from the one or more anti-ENOX2 antibody-binding spots; and measuring an ENOX2-catalyzed conversion of an ionic gold or ionic silver to colloidal gold or colloidal silver, respectively, by light scattering from the one or more anti-ENOX2 antibody binding spots on the substrate, wherein each of the one or more spots is indicative of an ENOX2 transcript variant.

    11. The method of claim 10, wherein quantitation is achieved by removing ENOX2 antibody reactive spots from the blot with a cork borer and quantitating the amount of ENOX2 using elution and reaction with ionic silver or gold to form silver nanoparticles and their quantitation measured by light scattering when compared to a background sample.

    12. The method of claim 10, wherein a signal above a background confirms the present of the ENOX2 transcript variant.

    13. The method of claim 10, further comprising the step of measuring the ENOX2-catalyzed conversion of ionic silver to colloidal silver is defined further as comprising the steps of: obtaining a core from the one or more anti-ENOX2 antibody-binding spots suspected of comprising at least one ENOX2 transcript variant separated by molecular weight and isoelectric point; incubating the core with silver or gold oxide in solution to form colloidal silver or gold; and developing the colloidal silver; and measuring the amount and/or presence of colloidal silver at 350-650 nm by comparing the light from the core with light from a background core that did not contain an ENOX2 transcript variant.

    14. The method of claim 13, wherein the light scattering is a doublet at 469.3 and 469.7 nm.

    15. The method of claim 10, wherein the tissue of origin of the cancer detected is selected from at least one of bladder, blood cell, lymphomas, leukemias, multiple myelomas and myelomas, breast, cervical, colorectal, esophageal, gastric, hepatocellular, small cell lung, non-small cell lung, melanoma, mesothelioma, ovarian, pancreatic, prostate, renal cell (kidney), sarcoma, squamous cell, testicular germ cell, thyroid follicular, thyroid papillary, or uterine.

    16. The method of claim 10, further comprising the step of detecting and determining a tissue of origin of a human cancer at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 20 years in advance of clinical symptoms.

    17. The method of claim 10, where by the principle of a colloidal gold or silver-based pregnancy test using an antibody to SEQ ID NO. 2 is used as a point of care test to detect ENOX2 presence in blood sera or other body fluids.

    18. The method of claim 10, further comprising measuring colloidal gold.

    19. The method of claim 10, wherein the substrate is elected from nitrocellulose, nylon, or polyvinylidene difluoride.

    20. A semi-quantitative method for the detection of ENOX2 transcript variants from one or more anti-ENOX2 antibody-binding spots comprising the steps of: obtaining a substrate onto which proteins obtained from concentrated blood, serum, or plasma sample from a subject have been transferred electrophoretically; separating the one or more ENOX2 transcript variants from the one or more anti-ENOX2 antibody-binding spots; measuring the ENOX2-catalyzed conversion of ionic silver to colloidal silver is defined further as comprising the steps of: obtaining a core from the one or more anti-ENOX2 antibody-binding spots suspected of comprising at least one ENOX2 transcript variant separated by molecular weight and isoelectric point; incubating the core with silver oxide in solution to form colloidal silver; developing the colloidal silver; and measuring the amount and/or presence of colloidal silver at 350-650 nm by comparing the light from the core with light from a background core that did not contain an ENOX2 transcript variant.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0011] For a more complete understanding of the features and advantages of the present invention, reference is now made to the detailed description of the invention along with the accompanying figures and in which:

    [0012] FIG. 1A shows the amino acid sequence of the full length recombinant ENOX2 protein (SEQ ID NO:1). The inter coil region of Exon 5 is highlighted in bold. FIG. 1B shows the amino acid sequence of the Exon 5 inter coil region. Acidic amino acids are highlighted in bold. The Exon5 inter coil region starts at reside 327 and terminates at residue 410, is 85 amino acids long, and has an estimated molecular weight of 10 kDa (SEQ ID NO:2). FIG. 1C shows the amino acid sequence of the EXON 5 inter coil region with acidic amino acids mutated to their amide form highlighted in bold. The mutant peptide is also 85 amino acids long and has an estimated molecular weight of 10 kDa. (SEQ ID NO:3).

    [0013] FIG. 2 is a graph that shows the absorbance spectra of ENOX2 transcript variant from sera of a breast cancer patient showing the double maxima corresponding to the two symmetry axes of the silver nanoparticles centered at 469.3 and 469.7 nm.

    [0014] FIG. 3 is a diagrammatic representation of the proposed organization of silver nanoparticles bound to acidic amino residues of the ENOX2 exon 5 derived peptide containing the E145EMTE sequence common to all ENOX2 transcript variants.

    [0015] FIG. 4 is the amino acid sequence of ENOX2 peptide antigen (SEQ ID NO. 4).

    DETAILED DESCRIPTION OF THE INVENTION

    [0016] While the making and using of various embodiments of the present invention are discussed in detail below, it should be appreciated that the present invention provides many applicable inventive concepts that can be embodied in a wide variety of specific contexts. The specific embodiments discussed herein are merely illustrative of specific ways to make and use the invention and do not delimit the scope of the invention.

    [0017] To facilitate the understanding of this invention, a number of terms are defined below. Terms defined herein have meanings as commonly understood by a person of ordinary skill in the areas relevant to the present invention. Terms such as “a”, “an” and “the” are not intended to refer to only a singular entity, but include the general class of which a specific example may be used for illustration. The terminology herein is used to describe specific embodiments of the invention, but their usage does not delimit the invention, except as outlined in the claims.

    [0018] All malignant cells and tissues express one or more members of a unique family of cell surface ubiquinone (NADH) oxidases with protein disulfide interchange activity (ENOX2 proteins) that are specific to cancer, absent from non-cancer cells and tissues and are shed into the blood. Multiple ENOX2 transcript variants share a common cancer-specific antibody recognition sequence that allows for detection using a common recombinant ENOX2 specific antibody (scFv). Cancer of different cellular or tissues of origin express different ENOX2 transcript variants or combinations of transcript variants that allow for the identification of the cell type and/or tissue of origin based on the patterns of molecular weight and isoelectric points of the transcript variants present in serum or plasma. All 36 transcript variants represented in the data base yielded values ≧7% above background (average 12%) consistent with a structure containing the common Exon 5 that defines ENOX2 and includes the ENOX2 specific antibody and drug-combining site E145EMTE. Also provided is the basis for a point of care test to detect ENOX2 transcript variants based on use of colloidal silver or gold complexes with ENOX2 as a rapid simple test for cancer presence.

    [0019] ENOX2 transcript variants are identified on the basis of their molecular weights and isoelectric point with detection using a ENOX2-specific monoclonal antibody (MAb) (U.S. Pat. No. 7,053,188), using single chain variable region (scFv) fragment which recognizes all cell surface NOX proteins (both age-related, normal cell and neoplasia specific NADH oxidase) or using polyclonal sera raised against ENOX2. The ECTO-NOX proteins are first enriched and concentrated from a biological sample, desirably a serum sample, by binding to nickel-agarose and then eluting. After release of the proteins from the nickel agarose by vortexing, the proteins are separated in the first dimension by isoelectric focusing and in the second dimension by polyacrylamide gel electrophoresis. In one example, the isoelectric focusing step is over a pH range from 3 to 10, and size separation is over a 10% polyacrylamide gel. Most of the cancer-specific ENOX2 isoforms exhibit isoelectric points in a very narrow range between pH 3.9 and 6.3 but differ in molecular weight from 34 to 136 kDa. In a 2D gel system, the cancer-specific isoforms are located in Quadrants I (relatively high molecular weight material) and IV (lower molecular weight material, notably the range of 30 to 30 kDa. IgG heavy chains (Quadrant II and IgG light chains (Quadrant III) cross react with the scFv antibody and along with reference proteins at 53 and 79 to 85 kDa serve as loading controls. The absence of all ENOX2 isoforms indicates the absence of cancer. The presence of an ENOX2 isoform indicates the presence of cancer. The particular molecular weight present in a serum sample or a particular combination of isoforms provides an indication of the cell type or tissue of origin of the cancer. The method not only determines cancer presence, but also the method of the present invention provides diagnostic information concerning the tissue of origin. At present there are no other pan cancer (all forms of human cancer) tests with these particular capabilities. ENOX2 proteins with apparent molecular weights of about 64, 66 and/or 68 kDa. pH 4.5 are associated with breast cancer. ENOX2 protein of 52 kDa, pH 4.3 is associated with small cell lung cancer. ENOX2 proteins of 52 and 80 kDa, pH 4.1 and 4.2 characterize ovarian cancer. ENOX2 isoforms of about 75 kDa, pH 6.3 are associated with prostate cancer. An ENOX2 protein of about 94 kDa, pH 5.4 is associated with cervical cancer. ENOX2 proteins of about 34 and 52 kDa, pH 4.3 and 3.9 are characteristic of colon cancer. An ENOX2 isoform of 54 kDa, pH 5.1 is associated with non-small cell lung cancer. Where a patient is suspected of having cancer, a biological sample, advantageously a serum sample can be prepared, and the 2D gel electrophoresis/immunological analysis of the present invention can be undertaken to provide for spots on the paper, film or substrate onto which the proteins have been blotted for later isolation, e.g., using a coring tool.

    [0020] The approach is based on an early discovery that tetrasilver tetroxide (TST) a potential anti-cancer agent based on clinical trials (U.S. Patent No. 2004/0205827), was targeted specifically to ENOX2 (Morré et. al., 2004. Molecular Biol Cell 15 (Suppl): 250a). The TST complex of two monovalent silver (AgI) and two trivalent silver (AgIII) ions bound with four oxygen atoms (O.sup.−2) combines covalently with ENOX2. Comparing human cervical carcinoma (HeLa) cells and MCF-10A cells, the HeLa cells bound TST to their cell surface whereas the non-cancer MCF-10A cells did not (Morré et. al., 2004. Molecular Biol Cell 15 (Suppl): 250a). More important, TST immobilized onto magnetic beads specifically bound ENOX2 released from HeLa surfaces, cancer sera and recombinant bacterially expressed ENOX2 proteins. A colorimetric method to assess the TST-ENOX2 protein complex based on enhanced silver binding and dissection of recombinant ENOX2 proteins into specific domains expressed in bacteria revealed that the peptide contributed by ENOX2 Exon 5 containing the cancer-specific ENOX2 antibody combining sequence E145EMTE was also the portion of the ENOX2 protein responsible for TST-binding (FIGS. 1A, 1B and 1C).

    [0021] SEQ ID NOS. 1, 2 and 3, respectively:

    TABLE-US-00001 A.   1 MQRDFRWLWV YEIGYAADNS RTLNVDSTAM TLPMSDPTAW ATAMNNLGMA  51 PLGIAGQPIL PDFDPALGMM TGIPPITPMM PGLGIVPPPI PPDMPVVKEI 101 IHCKSCTLFP PNPNLPPPAT RERPPGCKTV FVGGLPENGT EQIIVEVFEQ 151 CGEIIAIRKS KKNFCHIRFA EEYMVDKALY LSGYRIRLGS STDKKDTGRL 201 HVDFAQARDD LYEWECKQRM LAREERHRRR MEEERLRPPS PPPVVHYSDH 251 ECSIVAEKLK DDSKFSEAVQ TLLTWIERGE VNRRSANNFY SMIQSANSHV 301 RRLVNEKAAH EKDMEEAKEK FKQALMGILIQFEQIVAVYHSASKQKAWDH 351 FTKAQRKNIS VWCKQAEEIRNIHNDELMGIRREEEMEMSD DEIEEMTETK 401 ETEESALVSQ AEALKEENDS LRWQLDAYRN EVELLKQEQG KVHREDDPNK 451 EQQLKLLQQA LQGMQQHLLK VQEEYKKKEA ELEKLKDDKL QVEKMLENLK 501 EKESCASRLC ASNQDSEYPL EKTMNSSPIK SEREALLVGI ISTFLHVHPF 551 GASIEYICSY LHRLDNKICT SDVECLMGRL QHTFKQEMTG VGASLEKRWK 601 FCGFEGLKLT B. [327]MGILIQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEIRNIHNDELMGIRREE EMEMSDDEIEEMTETKETEESALVSQ[410] C. [327]MGILIQFQQIVAVYHSASKQKAWNHFTKAQRKNISVWCKQAQQIRNIHNNQLMGIRRQQ QMQMSNNQIQQMTQTKQTQQSALVSQ[410]

    [0022] The TST-binding portion of an ENOX2 Exon 5 contains a sequence of 85 amino acids of which 19 are acidic amino acids (glutamic acid and aspartic acid) and of which 10 occur as acidic pairs or triads. When the acidic amino acids are replaced with their corresponding amides, the peptides no longer bind silver. A similar phenomenon is encountered where polymeric gamma carboxy glutamic acid is employed to bind silver to form nanoparticles used in cancer drug delivery (Manocha and Marguritis, 2008. Crit Rev Biotechnol 37: 795-808).

    [0023] In order to visualize silver nanoparticle formation by ENOX2 proteins, the bound tetrasilver tetroxide was reduced using the antioxidant polyphenol epigallocatechin gallate (EGCg), a specific inhibitor of ENOX2 activity that combines with the E145EMTE drug-binding site of ENOX2. A commercially available (Ted Pella, Redding, Calif.) silver enhancement reagent is then added to increase the size of the nanoparticle and a biphasic red shift in absorbance is seen centered at 469.3 and 469.7 nm measured spectrophotometrically (FIG. 2).

    [0024] Regions of western blots occupied by ENOX2 antibody-reactive proteins were excised by coring, reacted with tetrasilver tetroxide containing EGCg followed by silver enhancement with formation of reduced silver nanoparticles, analyzed spectrophotometrically and compared to a background core from the same western blot. Results are recorded as area under the absorbance curve compared to cores from proteins from blot regions not corresponding to proteins in the database (Table 2).

    [0025] Both nanoparticle diameter and geometry influence the location and number of UV-visible bands. With nanorods, such as these, the double peaks occur as a result of oscillations along each of the two principle axes of symmetry, one along the transverse axis and one along the longitudinal axis (Jiang, et al. 2014. Scientific Reports 4:5323-5330).

    [0026] According to the location of the absorbance maxima (Jiang, et al. 2014. Scientific Reports 4:5323-5330), the ENOX2-generated nanoparticles are ellipsoids 75-85 nm in diameter and are organized in tetrads bound by both coordinate bonds and coulombic forces as diagrammed in FIG. 3, bound to regularly spaced acidic amino acid residues within the Exon 5-derived protein structure common to all ENOX2 transcript variants. These particles are absent (0.7±2.8% above background) based on measurements from 2,525 western blot cores taken from regions not occupied by proteins corresponding to ENOX2 transcript variants (Table 2).

    TABLE-US-00002 TABLE 1 Ranges for Molecular Weight (MW) and Isoelectric Point (Pi) Determined for Sera of Patients Diagnosed with 24 Different Cancers Representing 20 Different Tissues of Origin RANGES Protein 1 Protein 2 Protein 3 MW Pi MW Pi MW Pi Cancers N (kDa) (pH) (kDa) (pH) (kDa) (pH) Bladder 37 63-66 .sup. 4.2-5.6.sup.1 42-48 .sup. 4.1-4.8.sup.1 *Blood Cell (Total) (117)  34-47 3.5-4.6 Breast 682  64-69 4.2-4.9 Cervical 47  90-100 4.2-5.4 Colorectal 125  80-96 4.4-5.4 50-65 4.2-5.3 33-46 3.8-5.2 Esophageal 26 42-47 4.6-5.2 Gastric 26 120-188 4.7-5.5 50-62 4.5-5.6 45-53 2.4-3.6 Hepatocellular 31 58-70 4.5-5.0 34-40 4.1-5.2 Leukemias 36 34-45 3.5-4.5 **Lung, Non-Small Cell 55 53 4.7-5.3 **Lung, Non-Small Cell 270  54-56 4.6-5.3 Lung, Small Cell 27 52-53 4.1-4.6 Lymphomas 56 43-45 3.5-4.5 Melanoma 51 37-41 4.6-5.3 Mesothelioma 27 60-68 3.8-4.1 38-44 3.8-4.6 Myelomas 25 40-45 3.9-4.6 Ovarian 115  72-90 3.7-5.0 37-47 3.7-5.0 Pancreatic 75 48-51 3.9-5.4 Prostate 361  71-88 5.1-6.5 Renal Cell (Kidney) 31 69-73 4.7-5.4 54-61 4.1-5.2 38-43 3.7-4.3 Sarcoma 29 50-55 5.2-5.6 37-45 4.3-4.9 Squamous Cell 51 57-68 5.0-5.4 Testicular Germ Cell 25 61-62 5.0-5.4 40-45 4.4-4.7 Thyroid Follicular 25 48-56 4.7-5.1 37-42 4.5-5.2 Thyroid Papillary 27 56-67 4.5-5.0 37-44 3.2-3.6 ***Uterine (Endometrial) 26 63-66 .sup. 4.2-4.9.sup.2 41-48 .sup. 4.4-5.6.sup.2 ***Uterine (Endometrial) 57 67-71 4.2-5.1 41-48 3.7-5.4 Total 2460  *Blood cell cancers include lymphomas, leukemias and myelomas already represented in the totals. **Non-Small Cell Lung cancers are in two subsets to avoid molecular weight overlap with small cell lung cancer. ***Uterine cancers are in two subsets based on molecular weight to avoid overlap with bladder cancer (see footnotes 1 and 2). .sup.1Isoelectric point pH of Protein 1 ≦ Protein 2. .sup.2Isoelectric point pH of Protein 1 < Protein 2.

    TABLE-US-00003 TABLE 2 Validation of all 36 ONCOblot Transcript Variants Representing 20 Cancer Tissues of Origin as Being Transcript Variants of ENOX2. Absorbance, % Above Background Protein 1 Protein 2 Protein 3 Cancer Tissue of Origin N Mean ± SD Range Mean ± SD Range Mean ± SD Range Bladder 26 12.6 ± 3.6 8-21 14.2 ± 7.2 7-31 Blood Cell* 52 12.6 ± 4.4 8-28 Breast 525 12.3 ± 3.7 7-31 Cervical 36 11.8 ± 4.7 7-25 Colorectal 116 12.5 ± 3.4 8-25 11.9 ± 4.2 7-29 10.9 ± 3.7 7-21 Esophageal 9 10.7 ± 4.0 9-15 Gastric 21 13.8 ± 3.5 9-18 12.2 ± 3.2 8-18 11.1 ± 3.4 3-15 Hepatocellular 18 13.1 ± 3.6 7-19 10.9 ± 4.3 8-17 Lung 92 12.5 ± 4.2 7-26 Melanoma 22 12.8 ± 3.5 8-22 Mesothelioma 11 15.6 ± 3.3 11-20  15.9 ± 5.7 10-25  Ovarian 20 13.2 ± 4.5 8-26 12.0 ± 4.0 3-21 Pancreatic 23 12.4 ± 4.4 8-24 Prostate 165 12.2 ± 3.9 8-32 Renal Cell (Kidney) 19 11.6 ± 3.1 8-16 10.5 ± 2.9 7-17 9.5 ± 1.7 8-14 Sarcoma 13 12.2 ± 3.9 9-18 12.3 ± 4.1 9-19 Squamous Cell 35 12.5 ± 3.5 8-24 Testicular Germ Cell 15 10.0 ± 3.7 8-16 10.3 ± 3.0 8-17 Thyroid Follicular** 12 11.2 ± 3.7 7-17 11.2 ± 2.5 8-17 Thyroid Papillary** 21 11.2 ± 2.7 9-19 13.2 ± 5.6 8-21 Uterine (Endometerial) 96 10.9 ± 2.9 8-19 10.7 ± 4.2 7-20 Total Cancer 1496 Non-Cancer 2525  0.7 ± 2.8 −3.5-6    *Blood cell cancers include lymphomas, leukemias, and myelomas **Two different cancers from a single tissue of origin (thyroid.)

    [0027] For all transcripts variants with molecular weights and isoelectric points corresponding to those listed in the ONCOblot® Tissue of Origin Test Table of Ranges (Table 1), absorbance values ranged from 7 to 30% above background with a mean value of 12% (Table 2).

    [0028] Out of range proteins do not form nanoparticles based 2,525 out of range protein samples. The values averaged 0.7±2.8% above background and did not generate absorbance spectra with maxima at 469.3 and 469.7 nm characteristic of ENOX2 proteins. Values of ≦0.5±2 standard deviations from the mean (6% above background) were considered to be statistically unrelated (99% confidence interval) to ENOX2 or to ENOX2 proteins at levels below the practical limit of detection. The unreactive proteins included serum albumin and immunoglobulin as well as the immune reactive reference proteins pH 4.1 and pH 6.8.

    [0029] For a Point-of-Care Strip Test the basic principle is that of a gold or silver nanoparticle-based pregnancy test. To maximize test specificity, ENOX2 peptide immunogen comprised from about 8 to about 15 contiguous amino acids derived from a region of ENOX2 adjacent to the quinone binding site will be utilized. In a preferred embodiment, the ENOX2 peptide antigen is 359-SVWCKQAEEIRNIHNDE-376 (SEQ ID NO. 4) (Table 4).

    EXAMPLES

    [0030] The disclosure is further described by the following illustrative examples. The examples do not limit the disclosure in any way.

    Example 1

    [0031] Western blots occupied by ENOX2 antibody reactive proteins, as well a background region, were excised by coring. The background region was selected at a pH closely matching the antibody reactive region, but not overlapping any detected protein. Cored samples were stored in 0.5 mL Eppendorf tubes for up to 1 week before further processing.

    [0032] A silver (III) oxide (AgO)/epigallocatechin-3gallate (EGCg) solution was prepared as follows: 6 mg AgO (Sigma-Aldrich, St. Louis, Mo.) was added to a 970 μL aliquot of H.sub.2O and 30 μL of a 10 mM epigallocatechin-3-gallate (EGCg) (Sigma-Aldrich, St. Louis, Mo.) solution was added to 970 μL of EtOH to prepare an intermediate 0.3 mM solution. A portion (30 μL) of the 0.3 mM EGCg solution was added to the AgO solution and vortexed, yielding a saturated solution. The AgO/EGCg solution was then centrifuged for 60 sec at maximum speed to remove excess AgO. The resulting mixture has a slight yellow color. A fraction (90 μL) of the centrifuged AgO/EGCg solution was added to each Eppendorf tube containing a cored sample, and samples were incubated in total darkness for 2-4 hr.

    [0033] A ‘developer’ solution was mixed at the end of the incubation period and used immediately. The developer solution was created by mixing equal parts of an initiator and enhancer solution (Ted Pella, Redding, Calif.) and vortexing.

    [0034] Cored samples reacted with AgO containing EGCg, followed by silver enhancement, resulted formation of reduced silver nanoparticles as determined by spectrophotometrically (Olis, D W 2000 Conversion). Both nanoparticle diameter and geometry influence the location and number of UV-visible bands. With nanorods multiple peaks occur as a result of electronic oscillations along each of the two principle axes of symmetry, one along the longitudinal axis and one along the transverse axis (Jiang, et al. 2014. Scientific Reports 4:5323-5330). The antibody reactive cores were compared to a background core from the same western blot. Results are recorded as area under the absorbance curve, comparing the area of anti-body reactive spots to the paired background spot.

    [0035] In order to visualize silver nanoparticle formation by ENOX2 proteins, the bound tetra silver tetroxide was reduced using the antioxidant polyphenol epigallocatechin gallate (EGCg), a silver enhancement reagent, is then added to increase the size of the nanoparticle and a red shift in absorbance is seen with bimodal maxima centered at 469.3 and 469.7 nm measured spectrophotometrically (FIG. 2).

    Example 2

    [0036] TST immobilized onto magnetic beads specifically binds ENOX2 released from HeLa surfaces, cancer sera and recombinant bacterially expressed ENOX2 proteins. A colorimetric method to assess the TST-ENOX2 protein complex based on enhanced silver binding and dissection of recombinant ENOX2 proteins into domains expressed in bacteria revealed that the peptide contributed by ENOX2 Exon 5 containing the cancer-specific ENOX2 antibody combining sequence E145EMTE was also the portion of the ENOX2 protein responsible for TST-binding (FIG. 1A).

    Example 3

    [0037] The TST-binding portion of an ENOX2 Exon 5 contains a sequence of 85 amino acids of which 19 are acidic amino acids (glutamic and aspartic) and of which 13 occur as acidic pairs or triads. When the acidic amino acids are replaced with their corresponding amides by site-directed malignancies, the peptides no longer bound silver. A similar situation is encountered where polymeric gamma carboxy glutamic acid is employed to bind silver to form nanoparticles used in cancer drug delivery.

    Example 4

    [0038] Electrons in the conduction band of silver nanoparticles exhibit coherent vibrational oscillations when excited by an electric field. The oscillations are driven by a combination of the externally applied electric field and the restorative Coulombic attraction between electrons and atomic nuclei. Four factors determine the frequency of oscillations: the density of electrons, the effective electron mass, and the shape and size of the charge distribution. The ‘dipole plasma resonance’ of the particle is the term used to refer to the collective oscillation of the conduction electrons (Kelly, et al. 2003. Journal of Physical Chemistry 107: 668-677).

    Example 5

    [0039] It has been experimentally demonstrated that both particle diameter and geometry influence the location and number of UV-visible absorbance maxima. The amount of red-shift in absorbance maxima correlates with the particle size (Agnihotri et. al., 2014. RSC Advances 4(8): 3974-3983; Mock et. al., 2002. American Institute of Physics 116: 6755). Additionally, the location of the absorbance peak is influenced by the particle geometry (Mock et. al., 2002. American Institute of Physics 116: 6755). In the case of asymmetrical particles, such as nanorods, multiple absorbance peaks occur owing to oscillations along each of the principle axes of symmetry. For a nanorod, two absorbance peaks occur, one along the longitudinal axis and one along the transverse axis (Jiang, et al. 2014. Scientific Reports 4: 5323-5330).

    Example 6

    [0040] Two closely spaced absorbance maxima in the UV-visible spectra of solubilized serum proteins from cancer patients processed using the observed protocol (FIG. 2). Proteins were separated by means of two-dimensional gel electrophoresis and stained with an antibody specific to the cancer-specific protein ENOX2. Protein bands of corresponding size and isoelectric focusing points were extricated from the nitrocellulose gel and dissolved in aqueous solution. The solution is treated with BPI silver enhancer as well as EGCg. Serum proteins from cancer patients display two absorbance maxima at 469.3 and 469.7 nm (FIG. 2). The absorbance maxima that are attributed to the formation of silver nanoparticles.

    Example 7

    [0041] ENOX2 binds soluble silver (II) ions that are added to the serum sample as silver (II) oxide (Ago) in the spot-check protocol. Silver (II) ions are reduced by EGCg. The reduction potential for silver (II) is 0.80 V while the oxidation potential for EGCg is −0.020 V (Yang et. al., 2001. Chemical and Pharmaceutical Bulletin 49: 747-751). The sum of the redox potentials is positive, implying that the reaction occurs spontaneously. Insoluble silver metal forms as a product of the redox reaction, and aggregates into ellipsoid particles with slightly different longitudinal and transverse lengths (FIG. 3). According to the location of the absorbance maxima the particles are roughly 15.5-116.0 nm in diameter. Findings show that the presence of these particles is either greatly reduced or absent from protein bands that do not contain ENOX2.

    Example 8

    [0042] The presence of silver nanoparticles, detectable by the technique described above, is indicative of the presence of ENOX2 and is therefore a means to confirm the presence of cancerous pathology from the blood serum of suspected cancer patients. ENOX2 is shed into serum and is detectable by ENOX2-specific antibodies as well as characteristic molecular weights and isoelectric focusing points. The presence of ENOX2 is now further confirmed by the presence of silver nanoparticles after treatment with silver enhancer and EGCg, offering an alternative assessment of the cancerous origin of proteins indicated by two-dimensional gel electrophoresis.

    Example 9

    [0043] A point-of-care, test based on silver nanoparticle formation utilized the peptide antibody (SEQ ID NO. 2)(FIG. 4) and the principle of a pregnancy test.

    [0044] It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method, kit, reagent, or composition of the invention, and vice versa. Furthermore, compositions of the invention can be used to achieve methods of the invention.

    [0045] It will be understood that particular embodiments described herein are shown by way of illustration and not as limitations of the invention. The principal features of this invention can be employed in various embodiments without departing from the scope of the invention. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures described herein. Such equivalents are considered to be within the scope of this invention and are covered by the claims.

    [0046] All publications and patent applications mentioned in the specification are indicative of the level of skill of those skilled in the art to which this invention pertains. All publications and patent applications are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.

    [0047] The use of the word “a” or “an” when used in conjunction with the term “comprising” in the claims and/or the specification may mean “one,” but it is also consistent with the meaning of “one or more,” “at least one,” and “one or more than one.” The use of the term “or” in the claims is used to mean “and/or” unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive, although the disclosure supports a definition that refers to only alternatives and “and/or.” Throughout this application, the term “about” is used to indicate that a value includes the inherent variation of error for the device, the method being employed to determine the value, or the variation that exists among the study subjects.

    [0048] As used in this specification and claim(s), the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. In embodiments of any of the compositions and methods provided herein, “comprising” may be replaced with “consisting essentially of” or “consisting of”. As used herein, the phrase “consisting essentially of” requires the specified integer(s) or steps as well as those that do not materially affect the character or function of the claimed invention. As used herein, the term “consisting” is used to indicate the presence of the recited integer (e.g., a feature, an element, a characteristic, a property, a method/process step or a limitation) or group of integers (e.g., feature(s), element(s), characteristic(s), propertie(s), method/process steps or limitation(s)) only.

    [0049] The term “or combinations thereof” as used herein refers to all permutations and combinations of the listed items preceding the term. For example, “A, B, C, or combinations thereof” is intended to include at least one of: A, B, C, AB, AC, BC, or ABC, and if order is important in a particular context, also BA, CA, CB, CBA, BCA, ACB, BAC, or CAB. Continuing with this example, expressly included are combinations that contain repeats of one or more item or term, such as BB, AAA, AB, BBC, AAABCCCC, CBBAAA, CABABB, and so forth. The skilled artisan will understand that typically there is no limit on the number of items or terms in any combination, unless otherwise apparent from the context.

    [0050] As used herein, words of approximation such as, without limitation, “about”, “substantial” or “substantially” refers to a condition that when so modified is understood to not necessarily be absolute or perfect but would be considered close enough to those of ordinary skill in the art to warrant designating the condition as being present. The extent to which the description may vary will depend on how great a change can be instituted and still have one of ordinary skilled in the art recognize the modified feature as still having the required characteristics and capabilities of the unmodified feature. In general, but subject to the preceding discussion, a numerical value herein that is modified by a word of approximation such as “about” may vary from the stated value by at least ±1, 2, 3, 4, 5, 6, 7, 10, 12 or 15%.

    [0051] All of the compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.