SONOGENETIC STIMULATION OF CELLS EXPRESSING TRPA1
20230263891 · 2023-08-24
Assignee
Inventors
- Sreekanth CHALASANI (La Jolla, CA, US)
- Yusuf TUFAIL (La Jolla, CA, US)
- Jose Mendoza LOPEZ (La Jolla, CA, US)
- Marc Duque RAMIREZ (La Jolla, CA, US)
- Uri MAGARAM (La Jolla, CA, US)
- Corinne LEE-KUBLI (La Jolla, CA, US)
- Eric Warren EDSINGER (La Jolla, CA, US)
Cpc classification
A61M37/0092
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
C12N2750/14143
CHEMISTRY; METALLURGY
A61K38/177
HUMAN NECESSITIES
A61K48/0083
HUMAN NECESSITIES
A61K48/005
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
A61K41/0028
HUMAN NECESSITIES
International classification
A61K41/00
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
Abstract
Described herein are compositions featuring TRPA1 polypeptides and polynucleotides, methods for expressing such polypeptides and polynucleotides in a cell type of interest, and methods for inducing the activation of the TRPA1 polypeptide in neurons and other cell types using ultrasound.
Claims
1. A method of stimulating a cell, the method comprising contacting a TRPA1 polypeptide-expressing cell with ultrasound, thereby stimulating the cell.
2. The method of claim 1, wherein the TRPA1 polypeptide or functional fragment thereof has at least about 85% identity to a TRPA1 polypeptide having the sequence of NCBI Reference Sequence: XP_016869435.1 (SEQ ID NO: 1) or selected from the group consisting of: TABLE-US-00014 (SEQ ID NO: 4) MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKES LKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYA AAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCA VEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVO GMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTT NNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGS KECMEIILRFGEEHGYSROLHINFMNNGKATPLHL AVONGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAA TQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHR ASLFDHHELADYLISVGADINKIDSEGRSPLILAT ASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQP LHFAASYGRINTCORLLODISDTRLLNEGDLHGMT PLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALH HASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHF AAREGHAKAVALLLSHNADIVLNKQQASFLHLALH NKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPIT EMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYN FKYLQCPLEFTKKTPTQDVIYEPLTALNAMVONNR IELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLG LIPMTILVVNIKPGMAFNSTGIINETSDHSEILDT TNSYLIKTCMILVFLSSIFGYCKEAGQIFQQKRNY FMDISNVLEWIIYTTGIIFVLPLFVEIPAHLOWQC GAIAVYFYWMNFLLYLORFENCGIFIVMLEVILKT LLRSTVVFIFLLLAFGLSFYILLNLQDVGDIAEVQ KHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKST IVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADK SLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKME IISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLR AVKAKTHHLEP; (SEQ ID NO: 5) MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKES LKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYA AAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCA VEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQ GMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTT NNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGS KECMEIILRFGEEHGYSROLHINFMNNGKATPLHL AVONGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAA TQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHR ASLFDHHELADYLISVGADINKIDSEGRSPLILAT ASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQP LHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMT PLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALH HASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHF AAREGHAKAVALLLSHNADIVLNKQQASFLHLALH NKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPIT EMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYN FKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNR IELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLG LIPMTILVVNIKPGMAFNSTGIINETSDHSEILDT TNSYLIKTCMILVFLSSIFGYCKEAGQIFQQKRNY FMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQC GAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKT LLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLS IIQTFSMMLGDINYRESFLHPYLRNELAHPVLSFA QLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLK RIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNK PRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEI LKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETE DDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKT HHLEP; (SEQ ID NO: 6) MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKES LKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYA AAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCA VEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQ GMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTT NNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGS KECMEIILRFGEEHGYSRQLHINFMNNGKATPLHL AVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAA TQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHR ASLFDHHELADYLISVGADINKIDSEGRSPLILAT ASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQP LHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMT PLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALH HASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHF AAREGHAKAVALLLSHNADIVLNKQQASFLHLALH NKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPIT EMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYN FKYLQCPLEFTKKTPTQDVIYEPLTALNAMVONNR IELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLG LIPMTILVVNIKPGMAFNSTGIINETSDHSEILDT TNSYLIKTCMILVFLSSIFGYCKEAGQIFQQKRNY FMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQC GAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKT LLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLS IIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFA QLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLK RIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNK PRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEI LKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETE DDDSHCSFQDRFKKEQMEQRFCYENE; (SEQ ID NO: 7) MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKES LKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFDYGN TPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAP LHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAV IIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQ AAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGK ATPLHLAVONGDLEMIKMCLDNGAQIDPVEKGRCT AIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCH ETMLHRASLFDHHELADYLISVGADINKIDSEGRS PLILATASASWNIVNLLLSKGAQVDIKDNFGRNFL HLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGC TPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSP LHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMT PLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALH HASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHF AAREGHAKAVALLLSHNADIVLNKQQASFLHLALH NKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPIT EMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYN FKYLQCPLEFTKKTPTQDVIYEPLTALNAMVONNR IELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLG LIPMTILVVNIKPGMAFNSTGIINETSDHSEILDT TNSYLIKTCMILVFLSSIFGYCKEAGQIFQQKRNY FMDISNVLEWIIYTTGIIFVLPLFVEIPAHLOWQC GAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKT LLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLS IIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFA QLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLK RIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNK PRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEI LKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETE DDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKT HHLEPFCYENE;
3-11. (canceled)
12. A method of inducing cation influx in a cell, the method comprising: (a) expressing a heterologous TRPA1 polypeptide or fragment thereof in a cell; and (b) applying ultrasound to the cell, thereby inducing cation influx in the cell.
13-17. (canceled)
18. The method of claim 1, wherein the cell is muscle cell, cardiac muscle cell, neuron, motor neuron, sensory neuron, interneuron, or insulin secreting cell.
19. The method of claim 1, wherein the ultrasound frequency is about 0.8 MHz to about 4 MHz.
20. The method of claim 1, wherein the ultrasound frequency is about 6.91 MHz.
21. The method of claim 1, wherein the ultrasound comprises an ultrasonic wave comprising a focal zone of about 1 cubic millimeter to about 1 cubic centimeter.
22. The method of claim 1, wherein the method further comprises contacting the cell with a microbubble prior to applying ultrasound.
23. (canceled)
24. A method of treating a disease or disorder in a subject in need thereof, said method comprising: (i) expressing in a cell of the subject a heterologous nucleic acid molecule encoding a TRPA1 polypeptide or fragment thereof; and (ii) applying ultrasound to the cell, thereby treating the disease or disorder in the subject.
25. The method of claim 24, wherein the disease or disorder is a neurological disease or disorder.
26. The method of claim 25, wherein the neurological disease or disorder is selected from the group consisting of Parkinson Disease, depression, obsessive-compulsive disorder, chronic pain, epilepsy or cervical spinal cord injury.
27. The method of claim 24, wherein the disease or disorder is muscle weakness.
28-31. (canceled)
32. The method of claim 1, wherein the ultrasound stimulates or triggers a response by the TRPA1-expressing cell.
33. (canceled)
34. A non-naturally occurring TRPA1 polypeptide comprising the amino acid sequence of SEQ ID NO: 4, 5, 6, or 7.
35-37. (canceled)
38. A viral vector comprising a polynucleotide encoding a TRPA1 polypeptide or a functional fragment thereof.
39. The viral vector of claim 38, wherein the TRPA1 polypeptide or the functional fragment thereof comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-7, or a functional fragment thereof.
40. (canceled)
41. The viral vector of claim 38, wherein the vector is a lentiviral vector or an adeno-associated viral vector.
42. A cell comprising the TRPA1 polypeptide of claim 34.
43. A cell comprising the viral vector of claim 38.
44-45. (canceled)
46. A composition comprising the viral vector of claim 38.
47. (canceled)
48. A composition comprising the cell of claim 42.
49. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
BRIEF DESCRIPTION OF THE TABLES
[0089] Table 1 below shows a library of 89 clones from various protein families including DEG/ENaC, K2P, TRP, ASIC, Piezo, MscS, MscL and Prestin from multiple different species.
TABLE-US-00008 TABLE 1 Protein Family # Clones # Species Kingdom(s) ASIC 12 6 Animals KCNK 2 1 Animals (human) MSCL 13 4 Bacteria MSL 4 1 Plant PIEZO 8 2 Animals (human, mouse) PKD1 1 1 Animals Prestin 7 5 Animals SCNN 7 6 Animals TRPA1 10 10 Animals TRPC 4 3 Animals TRPM 9 4 Animals TRPN 8 5 Animals (zebrafish, cnidaria, drosophila) TRPV 8 5 Animals (human, brown bat, killer whale) Other 99 21 Animals, Plants, Bacteria Total 191 73
Table 2 below shows the percent identity across all TRPA1 domains based on pair-wise alignment of consensus sequence for tested chordate, mammalian, and non-mammalian clades compared to human. Percent identity of A1-A16 in the table indicates regions that are particularly conserved or divergent between mammals and non-mammalian chordates. Threshold for consensus is bases matching to human reference in 65% of sequences in multiple sequence alignments of each clade.
TABLE-US-00009 TABLE 2 Percent Percent Percent Identity Identity Identity Human × Human × Human × Non- Chordate Mammal Mammal Uniprot Consensus consensus Consensus ID Domain (start-stop) 65% 65% 65% TRPA1 Protein 1 65 79 46 N N-terminus 1-61 25 58 13 A1 Ankyrin 1 62-92 44 46 32 A2 Ankyrin 2 97-126 73 87 58 A3 Ankyrin 3 130-160 50 67 36 A4 Ankyrin 4 164-193 61 71 45 A5 Ankyrin 5 197-226 66 69 52 A6 Ankyrin 6 238-267 69 72 53 A7 Ankyrin 7 271-301 78 84 60 A8 Ankyrin 8 308-337 74 80 66 A9 Ankyrin 9 341-370 82 97 55 A10 Ankyrin 10 374-403 71 90 49 A11 Ankyrin 11 412-441 82 93 52 A12 Ankyrin 12 445-474 92 97 74 A13 Ankyrin 13 481-510 94 100 71 A14 Ankyrin 14 513-542 84 93 57 A15 Ankyrin 15 547-576 74 88 61 A16 Ankyrin 16 579-609 58 80 44 C1 Cytoplasmic Domain 1 1-719 NA NA NA T1 Transmembrane Domain 1 720-740 75 89 47 E1 Extracellular Domain 1 741-764 32 84 8 T2 Transmembrane Domain 2 765-785 59 86 26 C2 Cytoplasmic Domain 2 786-803 73 78 47 T3 Transmembrane Domain 3 804-824 68 73 34 E2 Extracellular Domain 2 825-829 62 62 5 T4 Transmembrane Domain 4 830-850 73 81 54 C3 Cytoplasmic Domain 3 851-873 67 96 53 T5 Transmembrane Domain 5 874-894 68 82 50 E3 Extracellular Domain 3 895-901 73 72 32 P Pore Region 902-922 77 81 54 E4 Extracellular Domain 4 923-934 68 75 36 T6 Transmembrane Domain 6 935-956 61 78 38 C4 Cytoplasmic Domain 4 957-1119 59 74 45
DETAILED DESCRIPTION OF THE DISCLOSURE AND EMBODIMENTS
[0090] Provided herein are compositions featuring TRPA1 polypeptides and polynucleotides, methods for expressing such polypeptides and polynucleotides in a cell type of interest, and methods for inducing the activation of the TRPA1 polypeptide in neurons and other cell types using ultrasound. In an embodiment, activation of the TRPA1 polypeptide in neurons and other cell types sensitizes the cell to ultrasound and can result in modulation or stimulation of cell function or activity. In an embodiment, the TRPA1 polypeptide expressed in neurons and other cell types is a heterologous or non-native protein.
[0091] Features of the aspects and embodiments described herein are based, at least in part, on the identification of human Transient Receptor Potential A1 (hsTRPA1), a channel polypeptide (protein) that confers sensitivity to non-invasive, low frequency ultrasound on millisecond timescales.
[0092] Our understanding of the nervous system has been fundamentally advanced by light- and small molecule-sensitive proteins that can be used to modify neuronal excitability. However, these require either invasive instrumentation or lack temporal control, respectively. Using a functional screen, it was found as described herein that human Transient Receptor Potential A1 (hsTRPA1) increased ultrasound-evoked intracellular calcium levels and membrane electrical events. hsTRPA1 ultrasound sensitivity, but not sensitivity to a chemical agonist, relied upon the N-terminal tip region, an intact actin cytoskeleton, and interactions with cholesterol, implicating these structures in the sonogenetic mechanism. Calcium imaging and electrophysiology were then used to confirm that primary neurons expressing hsTRPA1 potentiate their ultrasound-evoked responses. Finally, it was shown as described herein that inducing hsTRPA1 expression unilaterally in mouse layer V motor cortical neurons led to contralateral limb electromyography responses along with associated ‘twitch’ behaviors in response to ultrasound delivered through intact skull. Moreover, in some embodiments, ultrasound induced c-fos upregulation in hsTRPA1-expressing neurons, corroborating that these cells were selectively targeted. Together, the results described herein demonstrate the efficacy of sonogenetics for non-invasively modulating neurons within the intact mammalian brain, a method that could be extended to other cell types across species.
[0093] Accordingly, provided and featured herein are polynucleotides encoding a TRPA1 polypeptide, expression vectors comprising such polynucleotides, cells expressing a recombinant TRPA1 polypeptide, and methods for stimulating such cells with ultrasound. In an embodiment, the TRPA1 polypeptide is a human polypeptide.
TRP4 and TRPA1
[0094] The present inventors previously showed that exogenous expression of the C. elegans TRP-4 mechanoreceptor enables ultrasound-sensitivity in neurons that are otherwise unresponsive to ultrasound stimulation. Similar ultrasound-sensitivity has also been observed in cells induced to express proteins belonging to the MSC, Piezo, Prestin, TRP, and TREK families in vitro. It was therefore hypothesized that mechanosensitive proteins would confer ultrasound sensitivity to mammalian cells and performed experiments to identify new ion channel family proteins possessing mechanosensitive properties that could confer ultrasound sensitivity to mammalian cells. In an embodiment, such mechanosensitive proteins confer ultrasound sensitivity to mammalian cells at higher frequencies. By way of example and without intending to be limiting, the frequencies used in studies with cells expressing the above-noted proteins was in the range of about 500 kHz-2 MHz, or 10 MHz, which may have limited spatial resolution and or require bulky transducers that restrict the ability to develop wearable devices. As described herein, higher ultrasound frequencies, e.g., greater than 2 MHz, e.g., 5-10 MHz may be used. For example, a frequency of 6.91 MHz is unlikely to induce cavitation, because its mechanical index range in the experiments described herein (0.37-0.95) is below the threshold value for cavitation onset of 1.9 in tissues.
[0095] A featured aspect as described herein was the identification and selection of new and beneficial ion channel polypeptides having mechanosensitive properties, wherein such polypeptides had the ability to confer ultrasound sensitivity to mammalian cells. In an embodiment, ultrasound sensitivity could be conferred to the cells at higher frequencies, e.g., 6.91 MHz, To identify the optimal candidate polypeptide, a functional readout-based assay was used to screen a library of more 191 putative mechanosensitive proteins and their homologs (Table 1). A combination of imaging, pharmacology, electrophysiology, and comparative sequence analysis, as well as behavioral, and histological analyses were used to demonstrate that a mammalian protein, Homo sapiens transient receptor potential A1 (hsTRPA1), conferred ultrasound sensitivity to cells in vitro and in vivo, establishing an advantageous sonogenetic tool, e.g., for use in mammals. In embodiments, an hsTRPA1 channel polypeptide as described herein encompasses an amino acid sequence of SEQ ID NOS: 4-7 or a functional fragment thereof.
Ultrasound
[0096] Ultrasound is well suited for stimulating neuron populations as it focuses easily through intact thin bone and deep tissue (K. Hynynen and F. A. Jolesz, Ultrasound Med Biol 24 (2), 275 (1998)) to volumes of just a few cubic millimeters (G. T. Clement and K. Hynynen, Phys Med Biol 47 (8), 1219 (2002)). The non-invasive nature of ultrasound stimulation is particularly significant for manipulating vertebrate neurons including those in humans, as it eliminates the need for surgery to insert light fibers (required for some current optogenetic methods). Also, the small focal volume of the ultrasound wave compares well with light that is scattered by multiple layers of brain tissue (S. I. Al-Juboori, et al., PLoS ONE 8 (7), e67626 (2013)). Moreover, ultrasound has been previously used to manipulate deep nerve structures in human hands and reduce chronic pain (W. D. O'Brien, Jr., Prog Biophys Mol Biol 93 (1-3), 212 (2007); L. R. Gavrilov et al., Prog Brain Res 43, 279 (1976)). The aspects and embodiments described herein provide for novel non-invasive compositions for the expression of TRPA1 in cells, and methods to stimulate cells expressing TRPA1 using low-intensity ultrasound stimulation.
Cellular Compositions Comprising Recombinant TRPA1
[0097] Provided and featured herein are cells comprising a recombinant nucleic acid molecule encoding a TRPA1 polypeptide. In one embodiment, a cardiac muscle cell comprising a TRPA1 polynucleotide under the control of a promoter suitable for expression in a cardiac cell (e.g., NCX1 promoter) is provided. In another embodiment, a muscle cell comprising a TRPA1 polynucleotide under the control of a promoter suitable for expression in a muscle cell (e.g., myoD promoter) is provided. In another embodiment, an insulin secreting cell (e.g., beta islet cell) comprising a TRPA1 polynucleotide under the control of a promoter suitable for expression in an insulin-secreting cell (e.g., Pdx1 promoter) is provided. In another embodiment, an adipocyte comprising a TRPA1 polynucleotide under the control of a promoter suitable for expression in an adipocyte (e.g., iaP2) is provided. Other embodiments provide a neuron or neuronal cell comprising a TRPA1 polynucleotide under the control of a promoter suitable for expression in a neuron (e.g., nestin, Tuj 1 promoter), in a motor neuron (e.g., H2b promoter), in an interneuron (e.g., Islet 1 promoter), in a sensory neuron (e.g., OMP promoter, T1R, T2R promoter, rhodopsin promoter, Trp channel promoter). The above-note promoters are provided by way of example and are not intended to be limiting. Such cells may be cells in vitro or in vivo.
Expression of Recombinant TRPA1
[0098] In one approach, a cell of interest (e.g., a neuron, such as a motor neuron, sensory neuron, neuron of the central nervous system, e.g., an interneuron, or neuronal cell line) is molecularly engineered to express a TRPA1 polynucleotide whose expression renders the cell responsive to ultrasound stimulation. Ultrasound stimulation of such cells induces cation influx. Such cells express an heterologous or non-native TRPA1 polypeptide. In an embodiment, the expressed heterologous or non-native TRPA1 polypeptide is a human TRPA1 polypeptide (hsTRPA1) as described herein. In embodiments, the TRPA1 polypeptide comprises an amino acid sequence as set forth in any one of SEQ ID NOS: 1-3 or 4-7, or a functional fragment thereof.
[0099] TRPA1 may be constitutively expressed or its expression may be regulated by an inducible promoter or other control mechanism where conditions necessitate highly controlled regulation or timing of the expression of a TRPA1 protein. For example, heterologous DNA encoding a TRPA1 gene to be expressed is inserted in one or more pre-selected DNA sequences. This can be accomplished by homologous recombination or by viral integration into the host cell genome. The desired gene sequence can also be incorporated into a cell, particularly into its nucleus, using a plasmid expression vector and a nuclear localization sequence. Methods for directing polynucleotides to the nucleus have been described in the art. The genetic material can be introduced using promoters that will allow for the gene of interest to be positively or negatively induced using certain chemicals/drugs, to be eliminated following administration of a given drug/chemical, or can be tagged to allow induction by chemicals, or expression in specific cell compartments.
[0100] Calcium phosphate transfection can be used to introduce plasmid DNA containing a target gene or polynucleotide into cells and is a standard method of DNA transfer to those of skill in the art. DEAE-dextran transfection, which is also known to those of skill in the art, may be preferred over calcium phosphate transfection where transient transfection is desired, as it is often more efficient. Since the cells of the aspects and embodiments described herein are isolated cells, microinjection can be particularly effective for transferring genetic material into the cells. This method is advantageous because it provides delivery of the desired genetic material directly to the nucleus, avoiding both cytoplasmic and lysosomal degradation of the injected polynucleotide. Cells can also be genetically modified using electroporation.
[0101] Liposomal delivery of DNA or RNA to genetically modify the cells can be performed using cationic liposomes, which form a stable complex with the polynucleotide. For stabilization of the liposome complex, dioleoyl phosphatidylethanolamine (DOPE) or dioleoyl phosphatidylcholine (DOPA) can be added. Commercially available reagents for liposomal transfer include Lipofectin (Life Technologies). Lipofectin, for example, is a mixture of the cationic lipid N-[1-(2, 3-dioleyloxy)propyl]-N—N—N-trimethyl ammonia chloride and DOPE. Liposomes can carry larger pieces of DNA, can generally protect the polynucleotide from degradation, and can be targeted to specific cells or tissues. Cationic lipid-mediated gene transfer efficiency can be enhanced by incorporating purified viral or cellular envelope components, such as the purified G glycoprotein of the vesicular stomatitis virus envelope (VSV-G). Gene transfer techniques which have been shown effective for delivery of DNA into primary and established mammalian cell lines using lipopolyamine-coated DNA can be used to introduce target DNA into the de-differentiated cells or reprogrammed cells described herein.
[0102] Naked plasmid DNA can be injected directly into a tissue comprising cells of interest. Microprojectile gene transfer can also be used to transfer genes into cells either in vitro or in vivo. The basic procedure for microprojectile gene transfer was described by J. Wolff in Gene Therapeutics (1994), page 195. Similarly, microparticle injection techniques have been described previously, and methods are known to those of skill in the art. Signal peptides can be also attached to plasmid DNA to direct the DNA to the nucleus for more efficient expression.
[0103] Viral vectors are used to genetically alter cells of the aspects and embodiments described herein, as well as their progeny. Viral vectors are used, as are the physical methods previously described, to deliver one or more polynucleotide sequences encoding TRPA1, for example, into the cells. Viral vectors and methods for using them to deliver DNA to cells are well known to those of skill in the art. Examples of viral vectors that can be used to genetically alter the cells as described herein include, but are not limited to, adenoviral vectors, adeno-associated viral vectors (AAV), such as AAV9, retroviral vectors (including lentiviral vectors), alpha-viral vectors (e. g., Sindbis vectors), and herpes virus vectors.
Targeted Cell Types
[0104] TRPA1 can be expressed in virtually any eukaryotic or prokaryotic cell or cell line of interest. In one embodiment, the cell is a bacterial cell or other pathogenic cell type. In another embodiment, the cell is a mammalian cell, such as an adipocyte, muscle cell, cardiac muscle cell, insulin secreting cell (e.g., beta islet cell), or a neuronal or nerve cell (neuron). e.g., motor neuron, sensory neuron, neuron of the central nervous system, interneurons, primary neuron, and neuronal cell line. In an embodiment, the cell is a primary cell. In an embodiment, the cell is in vitro, ex vivo, in situ, or in vivo.
Methods of Stimulating a Neural Cell
[0105] The methods provided herein are, inter alia, useful for the stimulation (activation) of cells. In particular, ultrasound stimulation induces cation influx, thereby altering cell activity. Expression of TRPA1 in a pathogen cell (bacteria) and subsequent ultrasound stimulation induces cation influx and bacterial cell killing. Ultrasound stimulation of a muscle cell expressing TRPA1 results in muscle contraction. This can be used to enhance muscle contraction or functionality in subjects in need thereof, including subjects suffering from muscle weakness, paralysis, or muscle wasting. Altering the intensity of the ultrasound modulates the extent of muscle activity.
[0106] The term “neural cell” as provided herein refers to a cell of the brain or nervous system. Non-limiting examples of neural cells include neurons, glia cells, astrocytes, oligodendrocytes and microglia cells. Where a neural cell is stimulated, a function or activity (e.g., excitability) of the neural cell is modulated by modulating, for example, the expression or activity of a given gene or protein (e.g., TRPA1) within said neural cell. The change in expression or activity may be 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more in comparison to a control (e.g., unstimulated cell). In certain instances, expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or higher than the expression or activity in the absence of stimulation. In certain instances, expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or lower than the expression or activity in the absence of stimulation. The neural cell may be stimulated by applying an ultrasonic wave to the neural cell.
[0107] The term “applying” as provided herein is used in accordance with its plain ordinary meaning and includes the meaning of the terms contacting, introducing and exposing. An “ultrasonic wave” as provided herein is an oscillating sound pressure wave having a frequency greater than the upper limit of the human hearing range. Ultrasound (ultrasonic wave) is thus not separated from ‘normal’ (audible) sound by differences in physical properties, only by the fact that humans cannot hear it. Although this limit varies from person to person, it is approximately 20 kilohertz (20,000 hertz) in healthy, young adults. Ultrasound (ultrasonic wave) devices operate with frequencies from 20 kHz up to several gigahertz. The methods provided herein use the energy of an ultrasonic wave to stimulate a neural cell expressing an exogenous mechanotransduction protein. A mechanotransduction protein as provided herein refers to a cellular protein capable of converting a mechanical stimulus (e.g., sound, pressure, movement) into chemical activity. Cellular responses to mechanotransduction are variable and give rise to a variety of changes and sensations. In embodiments, the mechanotransduction protein is a mechanically gated ion channel, which makes it possible for sound, pressure, or movement to cause a change in the excitability of a cell (e.g., a sensory neuron). The stimulation of a mechanotransduction protein may cause mechanically sensitive ion channels to open and produce a transduction current that changes the membrane potential of a cell.
[0108] In one aspect, a method of stimulating a cell is provided. The method includes (i) transfecting a cell with a recombinant vector including a nucleic acid sequence encoding an exogenous mechanotransduction polypeptide, thereby forming a transfected cell. (ii) To the transfected cell an ultrasonic wave is applied, thereby stimulating a cell. In embodiments, the mechanotransduction polypeptide is TRPA1 or a functional portion or homolog thereof. In embodiments, the ultrasonic wave has a frequency of about 0.8 MHz to about 4 MHz. In embodiments, the ultrasonic wave has a frequency of about 1 MHz to about 3 MHz. In embodiments, the ultrasonic wave has a focal zone of about 1 cubic millimeter to about 1 cubic centimeter.
[0109] In embodiments, the method further includes before the applying of step (ii) contacting the transfected neural cell with an ultrasound contrast agent. In embodiments, the ultrasound contrast agent is a microbubble. In embodiments, the microbubble has a diameter of about 1 μm to about 6 μm. In embodiments, the neural cell forms part of an organism. In embodiments, the organism is a bacterial cell or mammalian cell (e.g., human, murine, bovine, feline, canine).
Methods of Treatment
[0110] In another aspect, a method of treating a neurological disease in a subject in need thereof is provided. The method includes (i) administering to a subject a therapeutically effective amount of a recombinant nucleic acid encoding an exogenous mechanotransduction polypeptide (e.g., TRPA1). In step (ii) an ultrasonic wave is applied to the subject, resulting in a change in TRPA1 conductance, i.e., cation influx. In one embodiment, the methods treat a cardiac disease by enhancing cardiac muscle activity or neurological disease by altering neural activity in the subject. In embodiments, the neurological disease is Parkinson Disease, depression, obsessive-compulsive disorder, chronic pain, epilepsy or cervical spinal cord injury. In embodiments, the neurological disease is retinal degeneration or atrial fibrillation. In embodiments, the mechanotransduction polypeptide is a TRPA1 polypeptide comprising an amino acid sequence as set forth in any one of SEQ ID NOS: 1-3 or SEQ ID NOS: 4-7 herein, or a functional fragment or portion thereof, e.g., an N-terminal fragment or portion. In an embodiment, the TRPA1 polypeptide is an hsTRPA1 polypeptide.
[0111] In embodiments, the mechanotransduction polypeptide is TRPA1 or a functional portion or homolog thereof. In embodiments, the mechanotransduction polypeptide is human TRPA1 or a functional portion or homolog thereof. In embodiments, the mechanotransduction polypeptide is human TRPA1 Clone 63 as described herein, or a functional portion or homolog thereof. In embodiments, the mechanotransduction polypeptide is a variant (mutant) TRPA1 polypeptide, or a functional portion or homolog thereof. In embodiments, the mechanotransduction polypeptide is a variant (mutant) of human TRPA1 Clone 63 as described herein, or a functional portion or homolog thereof. In embodiments, the mechanotransduction polypeptide is a human TRPA1 variant Mutant 7 as described herein, or a functional portion or homolog thereof. In embodiments, the mechanotransduction polypeptide is a human TRPA1 variant Mutant 9 as described herein, or a functional portion or homolog thereof. In embodiments, the mechanotransduction polypeptide is a human TRPA1 variant Mutant 18 as described herein, or a functional portion or homolog thereof. In an embodiment of the foregoing, the TRPA1, such as human TRPA1, or a functional portion or homolog thereof, recombinantly or molecularly expressed in a cell is a heterologous, non-native, non-naturally occurring, or exogenous polypeptide. In embodiments, the method further includes before the applying of step (ii) administering to the subject an ultrasound contrast agent. In embodiments, the ultrasound contrast agent is a microbubble. In embodiments, the microbubble has a diameter of about 1 μm to about 6 μm, and is injected into the body (e.g., the brain) where it enhances ultrasound stimulation.
Pharmaceutical Compositions
[0112] The agents as described herein, e.g., TRPA1 polypeptides, polynucleotides encoding the TRPA1 polypeptides, and vectors, cells, and the like, comprising the foregoing, can be incorporated into a variety of formulations for therapeutic use (e.g., by administration) or in the manufacture of a medicament (e.g., for treating or preventing disease or disorder, such as a neurological disease or disorder) by combining the agents with appropriate pharmaceutically acceptable carriers, vehicles, or diluents, and may be formulated into preparations in solid, semi-solid, liquid or gaseous forms. Examples of such formulations include, without limitation, tablets, capsules, powders, granules, ointments, solutions, suppositories, injections, inhalants, gels, nanoparticles, microspheres, and aerosols.
[0113] Pharmaceutical compositions can include, depending on the formulation desired, pharmaceutically-acceptable, non-toxic carriers or diluents, which are vehicles commonly used to formulate pharmaceutical compositions for animal or human administration. The diluent is selected so as not to affect the biological activity of the combination. Examples of such diluents include, without limitation, distilled water, buffered water, physiological saline, PBS, Ringer's solution, dextrose solution, and Hank's solution. A pharmaceutical composition or formulation of the present disclosure can further include other carriers, adjuvants, or non-toxic, nontherapeutic, nonimmunogenic stabilizers, excipients and the like. The compositions can also include additional substances to approximate physiological conditions, such as pH adjusting and buffering agents. toxicity adjusting agents, wetting agents and detergents.
[0114] Further examples of formulations that are suitable for various types of administration can be found in Remington's Pharmaceutical Sciences, Mace Publishing Company, Philadelphia, Pa., 17th ed. (1985). For a brief review of methods for drug delivery, see, Langer, Science 249: 1527-1533 (1990).
[0115] Formulations suitable for parenteral administration include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents. stabilizers, and preservatives.
[0116] Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions can be formulated according to the known art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation can be a sterile injectable solution, suspension, or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that can be employed are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or di-glycerides. In addition, fatty acids such as oleic acid are used in the preparation of injectables. The injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
[0117] The components used to formulate the pharmaceutical compositions are preferably of high purity and are substantially free of potentially harmful contaminants (e.g., at least National Food (NF) grade, generally at least analytical grade, and more typically at least pharmaceutical grade). Moreover, compositions intended for in vivo use are usually sterile. To the extent that a given compound must be synthesized prior to use, the resulting product is typically substantially free of any potentially toxic agents, particularly any endotoxins, which may be present during the synthesis or purification process. Compositions for parental administration are also sterile, substantially isotonic and made under GMP conditions.
[0118] Pharmaceutical compositions can be prepared by any method known in the art of pharmacology. In general, such preparatory methods include the steps of bringing the agent (e.g., TRPA1, such as hsTRPA1) polypeptide, polynucleotide, or vector) described herein (i.e., the “active ingredient”) into association with a carrier or excipient, and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping, and/or packaging the product into a desired single- or multi-dose unit. Pharmaceutical compositions can be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. A “unit dose” is a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.
[0119] Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition described herein will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered. The composition may comprise between 0.1% and 100% (w/w) active ingredient.
[0120] Although the descriptions of pharmaceutical compositions provided herein are principally directed to pharmaceutical compositions which are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with ordinary experimentation.
[0121] The agents and compositions provided herein can be administered by any route, including enteral (e.g., oral), parenteral, intravenous (into the CNS), intracerebroventricular, intramuscular, intra-arterial, intramedullary, intrathecal, subcutaneous, intracranial, ocular/intraocular, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, and/or drops), mucosal, nasal, bucal, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation. Specifically contemplated routes are intravenous administration (e.g., systemic intravenous injection), regional administration via blood and/or lymph supply, and/or direct administration to an affected site. In general, the most appropriate route of administration will depend upon a variety of factors including the nature of the agent and/or the condition of the subject (e.g., whether the subject is able to tolerate a given route of administration). In certain embodiments, the agent or pharmaceutical composition described herein is suitable for topical administration to the eye of a subject.
Kits
[0122] In one aspect, a kit for producing mechanosensitivity or sensitivity to ultrasound so as to modify the function or activity of a cell, a cell in a subject, or in a subject, e.g., ex vivo, in vitro, or in vivo, are provided. For example, the kit can be used to introduce into a subject or into a cell heterologous (non-native) TRPA1 polypeptide as described herein, e.g., hsTRPA1, so as to modulate or stimulate the activity of the cell following exposure to ultrasound. In an embodiment, the TRPA1 polypeptide is an exogenous human polypeptide. In an embodiment, the human TRPA1 polypeptide is the Clone 63 polypeptide as described herein. In embodiments, the TRPA1 polypeptide is a variant polypeptide, e.g., the mutant 18, 9, or 7 polypeptides as described herein. In embodiments, the kit comprises a vector, for example, without limitation, a viral vector, containing a polynucleotide encoding the TRPA1 polypeptide as described herein for introduction, e.g., by infection, injection, transfection, or transduction, into a cell, cell line, or a subject, wherein the TRPA1 polypeptide is expressed as a heterologous (non-native) channel protein in the cell or the subject. If desired, the kit may include a polynucleotide encoding a TRPA1 polypeptide or a TRPA1 polypeptide as described herein. In an embodiment, the kit may include a reporter or detection molecule (e.g., a detectably labeled molecule) to assess the expression of the TRPA1-encoding polynucleotide or the TRPA1 polypeptide in a cell or subject.
[0123] The kit may include instructions for the assay, reagents, testing equipment (test tubes, reaction vessels, needles, syringes, etc.), standards for calibrating the assay, and/or equipment provided or used to conduct the assay. The instructions provided in a kit according to the invention may be directed to suitable operational parameters in the form of a label or a separate insert.
[0124] The practice of the present invention employs, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are well within the purview of the skilled artisan. Such techniques are explained fully in the literature, such as, “Molecular Cloning: A Laboratory Manual”, second edition (Sambrook, 1989); “Oligonucleotide Synthesis” (Gait, 1984); “Animal Cell Culture” (Freshney, 1987); “Methods in Enzymology;” “Handbook of Experimental Immunology” (Weir, 1996); “Gene Transfer Vectors for Mammalian Cells” (Miller and Calos, 1987); “Current Protocols in Molecular Biology” (Ausubel, 1987); “PCR: The Polymerase Chain Reaction”, (Mullis, 1994); “Current Protocols in Immunology” (Coligan, 1991). These techniques are applicable to the production of the polynucleotides and polypeptides as described herein, and, as such, may be considered in making and practicing the various aspects and embodiments as described. Particularly useful techniques for particular embodiments will be discussed in the sections that follow.
[0125] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the products, compositions, cells, vectors, therapeutic methods and the like as described herein, and are not intended to limit the scope of the aspects and embodiments described.
EXAMPLES
Example 1: Human Transient Receptor Potential A1 (hsTRPA1) Identified as a Sonogenetic Candidate
[0126] To facilitate rapid screening of ultrasound-triggered cellular responses, an optical imaging setup was aligned with a custom designed transducer. In particular, a single-crystal 6.91 MHz lithium niobate transducer (
[0127] We transiently transfected each candidate protein along with a fluorescent reporter (dTomato—dTom) into Human Embryonic Kidney 293T (HEK) cells expressing a genetically encoded calcium indicator (GCaMP6f) and monitored calcium changes upon ultrasound stimulation. (
[0128] Next, experiments were conducted to confirm that ultrasound responsiveness was due to direct activation of hsTRPA1. hsTRPA1 was first visualized using immunohistochemistry. It was found that hsTRPA1 protein was indeed expressed only in dTom+ cells and trafficked to the HEK cell membranes (
[0129] Next, electrophysiological methods were used to monitor changes in the membrane conductance of excitable HEK cells expressing hsTRPA1 or dTom-only control. To increase the recording efficiency, a cell-attached configuration (
Example 2: Putative Mechanisms Underlying Ultrasound Sensitivity of TRPA1
[0130] Multiple studies have shown that TRPA1 is a widely conserved calcium permeable, non-selective cation channel that is involved in detecting a wide-range of exogenous stimuli, including electrophilic compounds that interact with the nucleophilic amino acids in the channel, small peptides that partition in the plasma membrane, cold, heat, and others, although sensitivity to different stimuli varies across species. Despite this broad sensitivity and a resolved crystal structure, the underlying mechanisms of TRPA1 activation are only recently being discovered. For example, a scorpion toxin peptide (WaTx) has been shown to activate TRPA1 by penetrating the lipid bilayer to access the same amino acids bound by electrophiles, thereby stabilizing the channel in an active state and prolonging channel opening (King, J. V. L. et al., Cell, 178, 1362-1374. e1316 (2019)). In contrast, electrophilic irritants have been shown to activate the TRPA1 channel using a two-step cysteine modification that widens the selectivity filter to enhance calcium permeability and open the cytoplasmic gate. These studies suggest that the TRPA1 channel might interact with the cytoskeleton and components of the membrane bilayers, including cholesterol, to transduce signals into a cell.
[0131] Structurally, TRPA1 comprises an intracellular N-terminal tip domain, 16 ankyrin repeats, 6 transmembrane domains and an intracellular C-terminal domain (
[0132] Sequence analysis of hsTRPA1 and its homologs (9 additional homologs) revealed that the 61 amino acid N-terminal tip region is highly conserved in mammalian compared to non-mammalian chordate species (58% vs 13% identity, respectively), particularly the first 22 amino acids (87% vs 17% identity, respectively
[0133] In contrast to the N-terminal tip region, the ankyrin repeat regions are highly conserved across both mammals (82% identity) and non-mammalian species (54% identity), with the exception of ankyrin 1, which is least conserved across mammals (46% identity; Table S2 and
[0134] The N-terminal ankyrin repeats have also been hypothesized to interact with cytoskeletal elements and act as a gating spring in response to mechanical stimuli. For example, ankyrin repeat regions from Drosophila NOMPC (TRPN) are thought to be important in mechanosensation due to their interactions with microtubules. Therefore, experiments were performed as described herein to assess the involvement of cytoskeletal elements in ultrasound sensitivity of hsTRPA1. It was found that treating hsTRPA1-expressing HEK cells with the actin depolymerizing agents cytochalasin D and latrunculin A reduced the ultrasound responses of these cells compared to vehicle or an actin stabilizing agent, jasplakinolide (
[0135] Mouse TRPA1 has also been hypothesized to localize to lipid rafts through a mechanism governed by a Cholesterol Recognition/interaction Amino acid Consensus sequence (CRAC) domain within the transmembrane helix 2 (TM2) of TRPA1. Interestingly, as described herein, a CRAC motif (L/V-(X)(1-5)-Y-(X)(1-5)-R/K, where X are non-polar residues) was identified in transmembrane helix 2 of TRPA1 that was highly similar in all mammalian homologs tested, but was absent in reptiles and heavily modified in fish (
Example 3: Primary Neurons Expressing hsTRPA1 are Ultrasound-Sensitive
[0136] To test whether hsTRPA1 can also render neurons sensitive to ultrasound stimuli, embryonic day 18 (E18) mouse primary cortical neurons were infected with adeno-associated viral (AAV) vectors expressing either CRE-dependent hsTRPA1 or CRE-only control along with a genetically encoded calcium indicator, GCaMP6f (
[0137] Next, studies were conducted to confirm whether ultrasound-mediated effects in control and hsTRPA1-expressing neurons were due to the TRPA1 channel. Treating hsTRPA1 expressing neurons with a TRPA1 antagonist, HC-030331, significantly attenuated their responses to ultrasound without affecting the ultrasound-evoked activity in control neurons (
[0138] Experiments using electrophysiological methods were next performed to confirm the role of hsTRPA1 in mediating ultrasound-evoked neuronal responses. Stable membrane resistances and reliable measurements were obtained during ultrasound stimulation trials using the whole-cell patch clamp configuration (
[0139] In addition, responsiveness to ultrasound was assessed in current clamp mode to evaluate action potential generation. Ultrasound stimulation triggered action potentials in neurons expressing hsTRPA1 (
Example 4: hsTRPA1 Confers Ultrasound Sensitivity In Vivo
[0140] Studies were conducted as described herein to determine whether hsTRPA1 can be used as a sonogenetic tool for temporally-selective activation of neurons in vivo. To this end, CRE-dependent AAV was used to restrict the expression of hsTRPA1 to layer V motor cortical neurons in Npr-3 CRE transgenic mice (Daigle, T. L. et al., Cell 174, 465-480 e422, doi:10.1016/j.cell.2018.06.035 (2018)), (
[0141] After 2-4 weeks following intracranial injection, ultrasound-evoked electromyography (EMG) responses were monitored in the bilateral biceps brachii and biceps femorii muscles. Ultrasound evoked few EMG responses and no visible movements in any of the limbs of the GFP-control mice (
[0142] As described herein, both in vitro and in vivo neural circuits could be reliably activated using sonogenetics. To assess safety in-vivo, two metrics of safety, namely, the effect of cortical TRPA1 expression on a motor learning task and the effect of sustained ultrasound delivery on integrity of the blood-brain barrier, were assessed. It was found that both hsTRPA1- and GFP-expressing animals had comparable ability to learn the rotarod task (
[0143] The studies and results described herein demonstrate that hsTRPA1 is a candidate sonogenetic protein that confers ultrasound sensitivity to mammalian HEK cells and rodent neurons in vitro and in vivo. Using an unbiased screen, hsTRPA1-expressing HEK cells were found to show ultrasound-evoked calcium influx and membrane currents. Moreover, critical components of hsTRPA1 ultrasound sensitivity were revealed, including the N-terminal tip region and interactions with the actin cytoskeleton and cholesterol. It was also shown that hsTRPA1 potentiated ultrasound-evoked calcium transients and enabled ultrasound-evoked action potentials in rodent primary neurons. The studies described herein provide the first report of ultrasound-induced action potentials using patch clamp at clinically relevant frequencies, lower than 25 MHz. In addition, hsTRPA1 was used to selectively activate neurons within an intact mouse skull using single pulses of ultrasound ranging from 1-100 msecs. These ultrasound parameters are below the range associated with cavitation effects. Accordingly, no damage to the blood-brain barrier was observed, even with intermittent ultrasound delivered over 60 minutes. Moreover, overexpressing hsTRPA1 did not cause behavioural changes on rotarod assays, confirming the viability of this candidate for sonogenetics use across species. The results obtained in the studies described herein are in contrast to a previous study showing that mouse TRPA1 functions in astrocytes and use a Best1 dependent pathway to release glutamate depolarizing neighboring neurons upon ultrasound (Oh, S. J. et al., Curr Biol 29, 3386-3401 e3388, doi:10.1016/j.cub.2019.08.021 (2019). The model of Oh et al. requires TRPA1 and Best1 expression in astrocytes, which is highly controversial. In addition, the results described herein confirm that TRPA1 is undetectable in the brain and that ultrasound can non-invasively activate neurons that express exogenous hsTRPA1 in vitro and in vivo, thus indicating the viability of the methods as described herein.
[0144] Ultrasound has been shown to have neuromodulatory effects in mice, non-human primates, and even human subjects, although the underlying mechanisms remain poorly understood. Overexpressing the mechanosensory receptor TRP-4 (a TRP-N homolog) in C. elegans neurons was previously shown to render them sensitive to short pulses of ultrasound, identifying the first putative sonogenetic candidate. Multiple groups have since identified additional ultrasound-sensitive candidates, including MscL, Prestin, Piezo, TREK, MEC-4, TRPC1, TRPP2 and TRPM4 using in vitro assays. Of these, a mutated form of MscL showed activity in vivo (Qiu, Z. et al., Cell reports 32, 108033, doi:https://doi.org/10.1016/j.celrep.2020.108033 (2020)). Notwithstanding, there exist both value and a need to identify new sonogenetic candidates to extend the toolset for use in mammals and humans, and to develop channels that respond to different ranges of frequency and pressure. As described herein, hsTRPA1 and its mammalian homologs were identified as top hits for high frequency sonogenetic candidates in an unbiased screen from a curated library of mechanosensory proteins, emphasizing the unique nature of this protein.
[0145] Previous studies have shown that ankyrin repeats form a super helical coil that could act as a spring mechanism for mechanosensitive gating in NOMPC/TRPN1 (Sotomayor, M. et al., Structure 13, 669-682, doi:10.1016/j.str.2005.03.001 (2005)). As described and demonstrated herein, the TRPA1 N-terminal tip domain, particularly the first 25 amino acids, may be critical for ultrasound sensitivity and is highly similar in mammalian TRPA1 variants that showed sensitivity to ultrasound, but varies across non-mammalian chordate TRPA1 homologs that were not ultrasound sensitive. Furthermore, a chimera composed of the amTRPA1 N-terminal tip on hsTRPA1 also lacks responses to ultrasound, providing support that this region is important for tuning ultrasound sensitivity in mammalian TRPA1 variants. It has been reported that variations in the N-terminal tip of TRPA1 affect its temperature sensitivity, suggesting that this region of TRPA1 can regulate channel function (Kang, K. et al., Nature, 481, 76-80, doi:10.1038/nature10715 (2011)). As also shown herein, an intact actin cytoskeleton is required for hsTRPA1 ultrasound responses. Consistently, it has been reported that the actin cytoskeleton can either directly interact with mechanosensitive channels or interact with the plasma membrane to modify mechanosensation.
[0146] Based on the studies and results described herein, and without wishing to be bound by theory, the hsTRPA1 N-terminal tip region may interact with the actin cytoskeleton to transduce ultrasound-induced membrane perturbations into changes in intracellular calcium. Analysis of TRPA1 sequences across homologs described herein further suggested that a CRAC domain that is thought to mediate interactions with cholesterol is heavily modified or missing from the second transmembrane domain of ultrasound-insensitive variants. Indeed, interaction with the lipid bilayer was found to be critical for ultrasound sensitivity of hsTRPA1, as treating hsTRPA1-expressing cells with MCD, which removes cholesterol, attenuated their responses to ultrasound, but not to a chemical agonist. Furthermore, mutation of the central tyrosine that is critical for cholesterol interaction of the CRAC domain likewise impaired ultrasound-sensitivity, but not responses to AITC. These results as described herein are consistent with reports of others showing that TRPA1 activation requires membrane lipid interactions.
[0147] Previous studies have shown that naïve neurons can respond to ultrasound, both in vitro and in vivo. Similarly, as described herein, it was found that the ultrasound parameters used in the studies described herein can also use can also trigger increased currents and intracellular calcium in naïve neurons in vitro. However, these responses are significantly smaller than those observed in hsTRPA1-expressing neurons, and ultrasound-evoked action potentials were rarely detected at the frequency and pressures tested. Additionally, responses in control neurons in vitro may be an artefact of the 2-dimensional cultures, interactions with the substrate, or interactions with the patch pipette in electrophysiology. Experiments using more physiologically relevant systems, such as brain slices and 3-dimensional neuronal cultures, can be conducted to determine the extent of the endogenous neuronal response to ultrasound at 6.91 MHz. Moreover, as described herein, it was found that ultrasound responses in control neurons were unlikely to be TRPA1-mediated, as these are not reduced upon treatment with TRPA1 antagonists, and because neurons cultured from TRPA1−/− mice also responded to ultrasound. Accordingly, endogenous TRPA1 was not detected in E18 brain tissue. Together, these results suggest that intrinsic neuronal responses to the ultrasound parameters described herein are unlikely to involve TRPA1 in neurons. Instead, a recent study found that knocking down TRPP1, TRPP2, Piezo, TRPC1 and TRPM4 each partially reduced ultrasound-evoked neuronal responses (Yoo, S., et al., bioRxiv (2020). As also demonstrated herein, blocking voltage-gated sodium channels eliminated neuronal ultrasound-evoked calcium responses. Therefore, intrinsic ultrasound neuromodulation may involve a number of mechanosensitive channels whose activity is further amplified by voltage-gated sodium channels. As described herein, hsTRPA1-expressing neurons were shown to maintain partial ultrasound sensitivity in the presence of a sodium-channel blocker, confirming that hsTRPA1-mediated ultrasound sensitivity is at least partially independent from the mechanism contributing to ultrasound activation in control neurons.
[0148] Finally, the studies and results described herein demonstrate that hsTRPA1 can be used to selectively activate a specific cell population in vivo with ultrasound pulses (1-100 msecs) from a 6.91 MHz transducer. The results described herein suggest that ultrasound might not act as a simple stretch force on the membrane and indicate that channels that likewise sense other perturbations, including lipid bilayer changes, may be good candidates for sonogenetics. Moreover, the identification of specific interactions (namely, actin and membrane cholesterol) and the N-terminal tip domain in hsTRPA1 as described herein allow for rapidly engineering this channel for enhanced ultrasound sensitivity and ion permeability. Advantageously, based on the studies and results described herein, hsTRPA1 and its variants could be used to non-invasively control neurons and other cell types across species.
Example 5: TRPA1 (Clone 63) Expression Renders Neurons Responsive to Ultrasound Stimulation
[0149] Ultrasound is non-invasive and can cause a small amount of mechanical deformation in the focal zone. As described supra, non-native (non-naturally occurring) mechanosensitive channel proteins that respond to ultrasound-triggered mechanical deformation were identified, thus allowing for manipulation of specific cells involving the use of ultrasound. Clone 63 represents a channel protein that is not found in nature, is responsive to ultrasound stimulation, and is effective sonogenetically both in cell culture (in vitro) and in animals (in vivo).
[0150] To generate ultrasound responsive channel proteins, an expression screen was performed in HEK 293 cells (HEK cells). Individual candidate proteins were expressed in the HEK cells along with a calcium sensor and their sensitivity to ultrasound was assessed. If the candidate protein was ultrasound-sensitive, the cells would respond to ultrasound upon ultrasound stimulation. The screen included about 200 mechanosensitive proteins.
[0151] The human transient receptor potential A (hsTRPA1) channel protein was identified as an ultrasound sensitive channel protein (
[0152] TRPA channels from different species were assayed for their responsiveness to ultrasound stimulation/activation, and it was found that the human TRPA1 mechanosensitive protein (e.g., Clone 63), which was expressed on the cell membrane, was the most responsive to ultrasound stimulation. (
Example 6: Human TRPA1 (Clone 63) and Variant Channel Proteins
[0153] Clone-63 is a human TRPA1 channel protein that is expressed in human cells, namely, on the cell membrane. Variant (mutant) proteins were generated and tested them in the ultrasound activation assay (
[0154] The amino acid sequence of the human TRPA1 channel protein Clone 63 (non-mutated/WT) is presented below:
TABLE-US-00010 WT Clone 63 (SEQ ID NO: 4) MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKES LKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYA AAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCA VEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQ GMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTT NNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGS KECMEIILRFGEEHGYSRQLHINFMNNGKATPLHL AVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAA TQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHR ASLFDHHELADYLISVGADINKIDSEGRSPLILAT ASASWNIVNLLLSKGAQVDIKDFNVSIHSKSKDKK SPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHG MTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTA LHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTAL HFAAREGHAKAVALLLSHNADIVLNKQQASFLHLA LHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCP ITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIE YNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQN NRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYC LGLIPMTILVVNIKPGMAFNSTGIINETSDHSEIL DTTNSYLIKTCMILVFLSSIFGYCKEAGQIFQQKR NYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLOW QCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVIL KTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPL LSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLS FAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHAS LKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYP NKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEM EILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISE TEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKA KTHHLEP
[0155] In an embodiment, an amino acid sequence having at least 85%, at least 88%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of Clone 63 above is encompassed.
[0156] The amino acid sequence of a variant human TRPA1 channel protein (Mutant 18) is presented below:
TABLE-US-00011 Clone 63-Mutant 18 (SEQ ID NO: 5) MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKES LKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYA AAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCA VEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQ GMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTT NNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGS KECMEIILRFGEEHGYSRQLHINFMNNGKATPLHL AVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAA TQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHR ASLFDHHELADYLISVGADINKIDSEGRSPLILAT ASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQ PYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAAS YGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAA KNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGG YTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGH AKAVALLLSHNADIVLNKQQASFLHLALHNKRKEV VLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYL PECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQC PLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNH PVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTI LVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLI KTCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISN VLEWIIYTTGIIFVLPLFVEIPAHLOWQCGAIAVY FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTV VFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFS MMLGDINYRESFLHPYLRNELAHPVLSFAQLVSFT IFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQV ELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGM LFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYR LKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHC SFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
[0157] In the above amino acid sequence of Clone 63-Mutant 18, position 924 is a histidine (H) residue (bold underline in the above sequence), while this position in the hsTRPA1 WT Clone 63 amino acid sequence is a glutamate (E) residue. (
[0158] The amino acid sequence of a variant human TRPA1 channel protein (Mutant 9) is presented below:
TABLE-US-00012 Clone 63-Mutant 9 (SEQ ID NO: 6) MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKES LKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYA AAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCA VEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQ GMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTT NNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGS KECMEIILRFGEEHGYSRQLHINFMNNGKATPLHL AVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAA TQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHR ASLFDHHELADYLISVGADINKIDSEGRSPLILAT ASASWNIVNLLLSKGAQVDIKDFNVSIHSKSKDKK SPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHG MTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTA LHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTAL HFAAREGHAKAVALLLSHNADIVLNKQQASFLHLA LHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCP ITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIE YNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQN NRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYC LGLIPMTILVVNIKPGMAFNSTGIINETSDHSEIL DTTNSYLIKTCMILVFLSSIFGYCKEAGQIFQQKR NYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLOW QCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVIL KTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPL LSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLS FAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHAS LKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYP NKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEM EILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISE TEDDDSHCSFQDRFKKEQMEQRFCYENE
[0159] In the above amino acid sequence of Clone 63-Mutant 9, the terminal 6 amino acid residues of the polypeptide (in bold underline), differ from the amino acid residues of the hsTRPA1 WT Clone 63 amino acid sequence (
[0160] The amino acid sequence of a variant human TRPA1 channel protein (Mutant 7) is presented below:
TABLE-US-00013 Clone 63-Mutant 7 (SEQ ID NO: 7) MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKES LKVVFEGSAYGLONFNKQKKLKRCDDMDTFF---- --DYGNTPLHCAVEKNQIESVKFLLSRGANPNLRN FNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGE NGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWG CFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHIN FMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPV EKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVN TTDGCHETMLHRASLFDHHELADYLISVGADINKI DSEGRSPLILATASASWNIVNLLLSKGAQVDIKDN FGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMD EDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKS KDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEG DLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHN GWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDG NTALHFAAREGHAKAVALLLSHNADIVLNKQQASF LHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPG NKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRD YYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNA MVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNL GSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDH SEILDTTNSYLIKTCMILVFLSSIFGYCKEAGQIF QQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPA HLOWQCGAIAVYFYWMNFLLYLQRFENCGIFIVML EVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPF SSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAH PVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQ KHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKST IVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADK SLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKME IISETEDDDSHCSFQDREKKEQMEQRNSRWNTVLR AVKAKTHHLEPFCYENE
[0161] In the above amino acid sequence of Clone 63-Mutant 7, the amino acid residues between amino acids 67 and 95 of the mutant polypeptide are deleted compared with the amino acid residues in this region of the hsTRPA1 WT Clone 63 amino acid sequence (
[0162] The wildtype (WT) hsTRPA1 Clone 63 TRPA1 channel polypeptide and the Mutant 18 (also called SonoChannel-1 herein) hsTRPA1 channel polypeptide were recombinantly expressed in excitable HEK cells. The electrophysiological responses of the membrane-expressed proteins versus control (e.g., vector expressing green fluorescent protein (GFP) control) were monitored using a patch clamp assay (20 pA, 250 ms), (
[0163] The ability of the Mutant 18 (SonoChannel-1) TRPA1 polypeptide to function in vivo was assessed. AAV containing polynucleotides encoding either WT Clone 63 polypeptide or mutant 18 (SonoChannel-1) was injected into the right forelimb motor cortex to allow for expression of the non-native channel proteins in motor cortical neurons that drive movement in right forelimb. Ultrasound was delivered through the skill over the right forelimb motor cortex. Ultrasound stimulation was expected to affect electrical responses in the right forelimb muscles (
Example 7: Materials and Methods
[0164] Materials and methods used in the above-described Examples are set forth herein below.
Animal husbandry. Studies were performed using a total of 50 adult mice including both males and females. Animals were group housed in an American Association for the Accreditation of Laboratory Animal Care approved vivarium on a 12-hour light/dark cycle, and all protocols were approved by the Institutional Animal Care and Use Committee of the Salk Institute for Biological Studies. Food and water were provided ad libitum, and nesting material was provided as enrichment. Colonies of C57Bl6/J (JAX #000664); Npr3-cre (Daigle, T. L. et al., Cell 174, 465-480 e422, doi:10.1016/j.cell.2018.06.035 (2018)), (JAX #031333); and TRPA1 knockout (Kwan, K. Y. et al., Neuron 50, 277-289, doi:10.1016/j.neuron.2006.03.042 (2006)), (JAX #006401) mice were maintained for experiments.
HEK cell culture and transfection. HEK cells expressing human αvβ3 integrin were cultured in DMEM supplemented with 10% FBS and 20 mM glutamine in a 5% CO.sub.2 incubator. A stable calcium reporter line was generated with a GCaMP6f lentivirus (Cellomics Technology PLV-10181-50) followed by FACS sorting. For screening experiments and characterization of each candidate channel, GCaMP6f-expressing HEK cells were seeded on 12-well cell culture plates with 18 mm glass coverslips coated with PDL (10 μg/μl; Sigma-Aldrich P6407) for 1-2 hours. Coverslips were washed with Milli-Q water and cells were seeded at a density of 250000 cells/well. 24 hours after plating, cells were transfected with Lipofectamine LTX Reagent (ThermoFisher 15338100) according to the manufacturer's protocol, using 500 ng DNA of the clone of interest for each well. Cells were kept at 37° C. for an additional 24 hours before imaging on the ultrasound stimulation setup.
Mouse primary embryonic neuron culture. For WT primary neuron culture, timed pregnant C57Bl/6 female mice were ordered for E18 cortical dissociation (Charles River: 027). For TRPA1 knockout neuron culture, female TRPA1−/− (JAX #006401) dams were injected with luteinizing hormone releasing hormone (Sigma-Aldrich, L8008) 5 days before being paired with −/− males overnight. Pregnant dams were sacrificed and the E18 embryos were collected for cortical dissociation.
Mouse primary neuronal cultures were prepared from cortices isolated from embryonic day 18 (E18) mice, following the protocol described in Hilgenberg, L. G. & Smith, M. A. Preparation of dissociated mouse cortical neuron cultures. J Vis Exp, 562, doi:10.3791/562 (2007). Neurons were plated in 12-well culture plates with 18 mm PDL-coated coverslips (Neuvitro Corporation GG-18-PDL) at a concentration of 600-900 k cells/well. Neurons were then incubated at 37° C., 5% CO.sub.2, with half media changes every 2-3 days with Neurobasal (ThermoFisher #21103049 supplemented with Primocin (InvivoGen #ant-pm-1), B-27 (ThermoFisher #17504044) and GlutaMAX (ThermoFisher #35050061). For calcium imaging experiments, cells were infected with AAV9-hSyn-GCaMP6f (Addgene #100837-AAV9) at day in vitro 3 (DIV3) and half media change was performed the next day.
[0165] Neurons infected with GCaMP6f as stated above were infected with AAV9-hSyn-Cre (Addgene #105553-AAV9) and AAV9-hSyn-TRPA1-myc-DIO (Salk GT3 core) at DIV4 and half media change was performed the next day. Cultures were incubated at 37° C., 5% CO.sub.2 until DIV10-12 and then imaged using the same equipment as for HEK cell experiments.
Rat primary neuron culture. Rat primary neuronal cultures were prepared from rat pup tissue at embryonic (E) day 18 (E18) containing combined cortex, hippocampus and ventricular zone. The tissue was obtained from BrainBits (Catalogue #: SDEHCV) in Hibernate-E medium and used the same day for dissociation following the company's protocol. Briefly, tissue was incubated in a solution of Papain (BrainBits PAP) at 2 mg/mL for 30 min at 37° C. and dissociated in Hibernate-E for one minute using one sterile 9″ silanized Pasteur pipette with a fire polished tip. The cell dispersion solution was centrifuged at 1100 rpm for 1 minute, and the pellet was resuspended with 1 mL NbActiv1 (BrainBits NbActiv1 500 mL). Cell concentration was determined using a hemocytometer, and neurons were plated in 12-well culture plates with 18-mm PDL-coated coverslips (Neuvitro Corporation GG-18-PDL) at a concentration of 1.3 million cells/well. Neurons were then incubated at 37° C., 5% CO.sub.2, performing half media changes every 3-4 days with fresh NbActiv1 supplemented with PRIMOCIN™ (InvivoGen ant-pm-1). Neurons infected with GCaMP6f as stated above were infected with AAV9-hSyn-Cre (Addgene #105553-AAV9) and AAV9-hSyn-TRPA1-myc-DIO (Salk GT3 core) at DIV4, and half media changes were performed the next day. Cultures were incubated at 37° C., 5% CO.sub.2 until DIV10-12 and were used in electrophysiology experiments.
Ultrasound transducer: A set of custom-made single crystalline 127.68 Y-rotated X-propagating lithium niobate transducers operating in the thickness mode were used, as described in Collignon, S. et al., Advanced Functional Materials 28, 1704359 (2018). The fundamental frequency was measured to be 6.91 MHz using non-contact laser Doppler vibrometry (Polytec, Waldbronn, Germany), The devices were diced to 12 mm×12 mm and built into the in vitro test setup. The transducers were coated with a conductive layer of Au with a thickness of 1 μm with 20 nm of Ti acting as an adhesion layer. A DC sputtering (Denton 635 DC Sputtering system) process was used to coat 4″ wafers in an inert gas environment with a 2.3 m Torr pressure and rotation speed of 13 rpm, at a deposition rate of 1.5 A/s for Ti and 7A/s for Au. Devices were diced to size using an automated dicing saw (DISCO 3220) and the resonance frequency was verified using non-contact laser Doppler vibrometry
Imaging rig for ultrasound stimulation. For the 2D setup used, an existing upright epi-fluorescent Zeiss microscope was upgraded to perform a monolayer two-dimensional screen. For this application. the custom-made 12×12 mm lithium niobite (LiNbO.sub.3) transducer placed in a heated stage fixture underneath the cell chamber was used. Stimulus frequency and duration was controlled by a waveform generator (Keysight 33600A Series), and pressure was controlled through a 300-W amplifier (VTC2057574, Vox Technologies, Richardson, Tex.). Simultaneous calcium imaging was performed using a 40× water dipping objective at 16.6 frames per second with an Orca Flash 4.0 camera and a GFP filter.
Candidate channel screen. A library of candidate channels was generated, which was initially based on a literature survey of naturally occurring ion channels and other membrane proteins were suggested to display mechanosensitive or ultrasound sensitive properties. From this initial list, related channels and variants from different species were selected, resulting in a final set of 191 proteins (Table 1 supra). Each channel was cloned into a custom bicistronic pcDNA3.1(+) vector using a porcine teschovirus-1 2A self-cleaving peptide (p2A) sequence, expressing the channel and the fluorescent protein dTomato under a human cytomegalovirus (CMV) promoter. All plasmids were generated by Genscript Biotech (New Jersey, United States).
In vitro pharmacology. For inhibition of TRPA1, cells were incubated with the antagonist HC030031, (Oh, S. J. et al., Curr Biol 29, 3386-3401 e3388, doi:10.1016/j.cub.2019.08.021 (2019)), (4004 in DMSO; Cayman Chemicals #11923) for 45 minutes before stimulation. For activation of TRPA1, N-Methylmaleimide (NMM), (Oh, S. J. et al., Curr Biol 29, 3386-3401 e3388, doi:10.1016/j.cub.2019.08.021 (2019)), (10004 in DMSO Sigma-Aldrich #389412) or allyl isothiocyanate (AITC), (Raisinghani, M. et al., Am J Physiol Cell Physiol 301, C587-600, oi:10.1152/ajpcell.00465.2010 (2011)), (3004 in DMSO; Sigma-Aldrich #377430) was used. For activation of Piezol, yoda-1, (Syeda, R. et al., eLife 4, doi:10.7554/eLife.07369 (2015)), (1004 in DMSO; Tocris #5586), was used. For activation of TRPV1 capsaicin (Chu, Y., et al., Sci Rep 10, 8038, doi:10.1038/s41598-020-64584-2 (2020)), (3 μM in DMSO; Sigma-Aldrich #M2028), was used. The final concentration of DMSO in the external solution was 0.1% or lower for all groups; which was also used as vehicle control. For cytoskeleton experiments, nocodazole (5 μM; Tocris, #1228), jasplakinolide (20004; ThermoFisher #J7473), paclitaxel (600 nM; Sigma-Aldrich #T7191), cytochalasin D (504; Cayman Chemicals, #11330) or latrunculin A (1 μM; Cayman Chemicals, #10630) in 0.1% DMSO were added to the culture medium 45 minutes prior to imaging. For pharmacology in primary neurons, the TRPV1 antagonist, A784168, (Cui, M. et al., J Neurosci 26, 9385-9393, doi:10.1523/JNEUROSCI.1246-06.2006 (2006)), (2004; Tocris, #4319, 45 minute incubation) in 0.1% DMSO, BAPTA, (Hofer, A. M., J Cell Sci 118, 855-862, doi:10.1242/jcs.01705 (2005)), (3004; Invitrogen, #B1204, 45 minute incubation) directly dissolved in culture medium, and TTX, (Lee, C. H. and Ruben, P. C., Channels (Austin) 2, 407-412, doi:10.4161/chan.2.6.7429 (2008)), (1804; tetrodotoxin citrate; Tocris #1069, 5 minute incubation, where TTX-R channels were also inhibited) were used.
Sequence collection and annotation: Ten TRPA1 peptide sequences were obtained from the National Center for Biotechnology Information (NCBI) RefSeq database for human (Homo sapiens; NCBI Taxonomy 9606; RefSeq XP_016869435.1), mouse (Mus musculus; NCBI Taxonomy 10090; RefSeq NM_177781), beaver (Castor canadensis; NCBI Taxonomy 51338; RefSeq XP_020010675.1), alpaca (Vicugna pacos; NCBI Taxonomy 30538; RefSeq XP_006202494.1), donkey (Equus asinus; NCBI Taxonomy 9793; RefSeq XP_014709261.1), bat (Eptesicus fuscus; NCBI Taxonomy 29078; RefSeq XP_008148609.1), alligator (Alligator mississippiensis; NCBI Taxonomy 8496; RefSeq XP_006277080.1), snake (Notechis scutatus; NCBI Taxonomy 8663; RefSeq XP_026545023.1), molly (Poecilia formosa; NCBI Taxonomy 48698; RefSeq XP_007554661.1), and zebrafish (Danio rerio; NCBI Taxonomy 7955; RefSeq NP_001007066.1). The human TRPA1 sequence was also obtained from the UniProtKB database and aligned against the human TRPA1 RefSeq sequence to confirm that the sequences were identical. Uniprot coordinates of major domains and features for human TRPA1 were used to annotate the sequence in Geneious Prime (version 2020.1.2).
Phylogenetic analysis. A multiple sequence alignment of all ten TRPA1 sequences was generated using Geneious Prime MAFFT (version 7.450), (Katoh, K. and Standley, D. M., Molecular biology and evolution 30, 772-780 (2013)), with a BLOSOM 62 scoring matrix, gap open penalty of 1.53, and offset value of 0.123. A phylogenetic gene tree based on the MAFFT alignment was generated using Geneious Prime RAxML (version 8.2.11) (Stamatakis, A., Bioinformatics 30, 1312-1313 (2014)), with a GAMMA BLOSOM 62 protein model, bootstrapping using rapid hill-climbing with seed 1, starting with a complete random tree, and using the maximum likelihood search convergence criterion. The maximum likelihood tree was assessed and annotated in FigTree (version 1.4.4).
Consensus sequence and percent identity. Consensus sequences for the ten tested chordate, mammalian, and non-mammal alignments, each having hsTRPA1 as reference, were generated in Geneious Prime. The threshold for consensus was set to 65%, as this ensured contribution from both mammalian and non-mammal sequences for chordate, from rodents, ungulates, and bats for mammalian, and from reptiles and fishes for non-mammal alignments. Alignment and consensus sequences were annotated in Geneious Prime to highlight either agreement or disagreement of a given amino acid relative to human TRPA1. Percent identity of consensus sequence to human was calculated to quantify the degree of sequence conservation or divergence in the chordate, mammalian, non-mammalian species.
CRAC-CARC motif annotation. CRAC ([LV]X(1,5)YX(1,5)[RK]) and CARC ([RK]X(1,5)[YF]X(1,5)[LV]) motifs, as defined in (Fantini, J. and Barrantes, F. J., Front Physiol 4, 31, doi:10.3389/fphys.2013.00031 (2013) were annotated per TRPA1 sequence using the Geneious Prime EMBOSS 6.5.7 fuzzpro tool (Rice, P. et al., Trends Genet 16, 276-277, doi:10.1016/s0168-9525(00)02024-2 (2000)).
Constructs of ankyrin TRPA1 mutants. To generate mutant constructs, a PCR based approach was used. Bicistronic constructs co-expressing deletion mutants and dTom were synthesized by Genscript Biotech (New Jersey, United States). For ΔANK1, amino acids (aa) 67-95 (Ref seq. UniProtKB-O75762) were deleted, corresponding to nucleotide deletions 2641-2727 (Ref seq. XM_017013946.1). For the rest of constructs the aa and nucleotide deletions were as follows: ΔN-tip: aa deletions 1-61, nucleotide deletions 1-182; ΔN-tip (1-25), aa deletions 1-25, nucleotide deletions 1-75; CRAC mutant, swapping Tyr (Y)785 to Ser (S), nucleotides 2353-2355 (TAC) to TCG; alligator N-tip, swapping aa 1-66 from hsTRPA1 to first 66 residues from amTRPA1; zebrafish N-tip, swapping aa 1-59 from hsTRPA1 to first 59 residues from drTRPA1.
In vitro electrophysiology. A stable line of HEK cells expressing Nav1.3 and Kir2.1 (Ex-HEK, ATCC CRL-3269) were cultured on 18 mm round coverslips at a seeding density of ˜300 k cells/well in a tissue-culture treated 12-well plate. Cells were transiently transfected with a custom plasmid (Genscript) expressing hsTRPA1 and dTom fluorescent reporter as for screening experiments, 18-24 h post seeding. Cells underwent a media change, were allowed to recover, and then were used for recordings 18-24 h after transfection. Coverslips were transferred to a custom machined acrylic stage containing a bath of external solution (NaCl (140 mM), KCl (4 mM), MgCl.sub.2 (2 mM), Glucose (5 mM) and HEPES (10 mM)) with an osmolarity of ˜290 mOsm. Patch pipettes were pulled on a Sutter puller model P-97 programmed to give 4-6 MΩ tips from filamented borosilicate glass (o.d. 1.5 mm, i.d. 0.86 mm). The internal solution was CsF or KF based and obtained from Nan]i[on (#08 3008, #08 3007). An Olympus 40× water dipping lens with 0.8 NA was used in combination with a (QImaging OptiMOS) cMOS camera to visualize cells with Köhler or fluorescent illumination. dTom signal was used to confirm hsTRPA1 expression in HEK cells. Electrical signals were acquired using Axon Instruments Multiclamp 700B amplifier and digitized with Digidata using pClamp acquisition and control software. Gap free recordings were conducted (typically holding the membrane potential at −70 mV) while delivering 100 ms pulses of ultrasound. The ultrasound delivery rig used for patch clamp experiments was the same as that used for imaging experiments. Briefly, waveforms were programmed using an arbitrary function generator (Keysight Technologies) connected via BNC to an amplifier (VTC2057574, Vox Technologies). Military communications grade BNC cables (Federal Custom Cable) were used to ensure impedance matching in the experimental systems and to reduce electrical interference. The amplifier was connected to a custom-made lithium niobate transducer as described herein mounted on a dove-tail sliding arm, and coupled to the bottom of the recording chamber with ultrasound gel. The center of the transducer was left uncoated with gold in order to permit bright-field light to reach the sample, allowing for the alignment of optics and obtaining even illumination for DIC imaging. Recordings were carried out in response to peak negative pressures ranging from 0.2-0.25 MPa, as access resistance could not be maintained when high pressures were delivered. Cell attached Ex-HEK-GCaMP cells-maintained membrane resistances between 0.5 and 3 GΩ. Patch-clamp experiments conducted on primary dissociated cortical neurons followed a modified protocol. Briefly, neurons were allowed to mature for 11-14 days in vitro prior to recording. Compared to HEK cells, neuron somatic morphology was better suited for whole-cell recording configuration. Both voltage-clamp (VC) and current clamp (CC) recordings were conducted. Upon successful whole-cell access, baseline gap-free recordings in CC or VC trials were obtained. Ultrasound stimulation parameters followed the same protocol as was used for the HEK cell recordings. For primary cortical neuron experiments, access resistance during successful whole-cell recordings was maintained between 10 to 25 MΩ.
Viruses. pAAV.Syn.DIO.hsTRPA1-myc plasmid was custom made by GenScript. synP.DIO.EGFP.WPRE.hGH was a gift from Ian Wickersham (Addgene viral prep #100043-AAV9). pAAV.Syn.GCaMP6f.WPRE.SV40, (Chen, T. W. et al., Nature 499, 295-300, doi:10.1038/nature12354 (2013)), was a gift from Douglas Kim & GENIE Project (Addgene viral prep #100837-AAV9; http://n2t.net/addgene:100837; RRID:Addgene_100837). pENN.AAV.hSyn.Cre.WPRE.hGH was a gift from James M. Wilson (Addgene viral prep #105553-AAV9; http://n2t.net/addgene:105553; RRID:Addgene 105553). AAV9-hSyn-DIO-hsTRPA1-myc (GT3 Core at Salk Institute of Biological Studies) was injected at either 4E13 along with 1E12 AAV9-hSyn-DIO-GFP (Addgene #100043-AAV9) diluted in Hank's Balanced Salt Solution for injection. Adult male and female Npr3-cre mice (19-30 g) received 400 nL unilateral injections to the right motor cortex at AP 0.0 ML −1.0, AP+0.5 ML −1.0, AP+0.5 ML−1.5 at DV 0.5 (Ueno, M. et al., Cell reports 23, 1286-1300 e1287, doi:10.1016/j.celrep.2018.03.137 (2018)). Briefly, small holes were drilled (0.45 mm drill bit) into the skull over those coordinates, and virus was delivered through a pulled glass pipette at 2 nL/sec by a Nanoject iii (Drummond Scientific Company). Successful viral delivery was confirmed post-mortem via immunohistochemistry for GFP and/or the myc-tag.
Ca2+ imaging analysis. All image analysis was performed using custom scripts written as ImageJ Macros. Cells in the dTom channel were segmented and cell fluorescence over time in the GCaMP channel was measured and stored in csv files. Briefly, the script uses a gaussian filter on the dTomato channel and background subtraction, followed by auto thresholding and watershed segmentation. The plugin ‘Analyze particles’ was then used to extract counts. Calcium data were analyzed using custom Python scripts. Calcium signal was normalized as ΔF/F using a 6 s baseline for each ROI, and a peak detection algorithm with a fixed threshold of 0.25 was used to identify responsive cells after ultrasound stimulation, similar to the approach used by Oh, S. J. et al., Curr Biol 29, 3386-3401 e3388, doi:10.1016/j.cub.2019.08.021 (2019). For the screen, the number of cells showing a response to ultrasound was calculated as the total percent of responsive cells after 3 consecutive 90 second recordings on the same coverslip. The percent of transfected cells was calculated as the number of dTom positive cells/total number of cells per field of view imaged. To compare ultrasound response between clones, a generalized mixed model was used, fitting “response” as a Bernoulli response, “clone” as a fixed factor, and “cell” as a random effect. Pairwise comparisons were later performed using odds ratios and Tukey method, correcting for multiple comparisons.
[0166] Peak amplitude was calculated for each trace as the maximum GCaMP6f ΔF/F value during 60 s after ultrasound stimulation or pharmacological treatment for HEK cells, and 5 s for mouse primary neurons. For the AITC response curve in neurons, mean GCaMP6f ΔF/F up to 1.5 min after adding AITC to the medium was used instead of peak amplitude response. For latency and duration analysis in primary neurons, latency of calcium responses was measured as the time to reach 63% of the peak amplitude after stimulation, while width was calculated as the distance between 63% rise and 63% decay.
Immunocytochemistry. Cells were fixed with 4% paraformaldehyde (PFA) at room temperature for 15 minutes and subsequently were permeabilized using 0.25% Triton X-100 PBS with 5% horse serum. After incubation in blocking solution for 1 hour at room temperature, cells were incubated overnight at 4° C. with different primary antibodies: for HEK cells, a mouse monoclonal anti-TRPA1 antibody (1:1000, Santa Cruz Biotech #376495) was used, while a polyclonal anti-myc antibody (1:1000; Cell Signalling Tech #2272S) was used to detect the tagged channel in primary neuron cultures. Secondary antibody staining was performed at room temperature for 2 hours, followed by DAPI for 30 min. For myc, TSA amplification was performed to increase the signal. Co-localization to the cell membrane was determined via co-transfection and co-immunolabeling with EGFP-CAAX, (Madugula, V. and Lu, L., J Cell Sci 129, 3922-3934, doi:10.1242/jcs.194019 (2016)), which was a gift from Lei Lu (Addgene plasmid #86056; http://n2t.net/addgene:86056; RRID:Addgene_86056). For cytoskeleton immunolabeling experiments, fixed cells were incubated with anti-alpha-tubulin antibody (Sigma, #CBL270-I, 1:1000) or phalloidin-488 (ThermoFisher, #A12379, 1:500).
Rotarod. Mouse locomotor behaviour was evaluated on a Rotor-Rod (SD Instruments). Mice underwent a single day of training at a constant speed of 3 RPM to acclimate to the Rotor-Rod. The next day, mice were placed on a rod that started at 0 RPM and gradually increased to 30 RPM over a 5-minute period. The latency to fall off the rod was collected. Each mouse underwent 4 trials daily with a 20-minute inter-trial interval in which mice were returned to their cages. The latency to fall off was averaged across the three best trials. This procedure was repeated across 5 days. The experimenter was blinded as to the identity of groups.
Electromyography (EMG) experiments. EMG experiments were conducted between 2-4 weeks after viral injection. EMG data were collected under ketamine (100 mg/kg) and xylazine (10 mg/kg) anaesthesia from the right and left biceps brachii and right and left biceps femoris through fine wire electrodes (A-M Systems 790700) connected to a PowerLab and BioAmp (AD Instruments). Data were collected at 40 k/sec, bandpass filtered from 300 Hz to 1 kHz. Correct electrode placement was confirmed by positive EMG signal in response to pinch. The skin over the skull was opened, and the 6.91 MHz lithium niobate ultrasound transducer was coupled to the skull using ultrasound gel (Parker Aquasonic 100). Ultrasound stimuli (1, 10, 100 msecs durations) were administered at no less than 10 second intervals at intensities ranging from 0.35-1.05 MPa, intracortical pressure. Visual movement of the right fore or hindlimb in response to stimulation was noted, and EMG responses were analyzed for latency and duration. Due to the relatively large stimulus artefact from the ultrasound pulse, responses occurring during the ultrasound stimulus could not be reliably quantified. Therefore, only responses occurring after cessation of the stimulus were considered in the analyses described herein. The experimenter was blinded as to the group during both collection and analysis of the data.
US pressure and temperature measurements. Ultrasound pressure and temperature measurements were collected through ultrasound gel at the same position from the face of the lithium niobate transducer and within the brain tissue through the skull using a Precision Acoustics Fibre-Optic Hydrophone connected to a Tektronix TBS 1052B Oscilloscope and ThinkPad Ultrabook. To enable stereotaxic insertion into the brain, the Fibre-Optic Hydrophone probe was carefully threaded through a glass capillary, allowing the tip to remain exposed. Cortical measurements were taken in ex-vivo cranial tissue in which the jaw and palate were removed to expose the base of the brain. Using the center of the hypothalamus as coordinates 0,0,0, the hydrophone was inserted at AP +1.2, ML 1.0 and lowered to a depth of −5.6 to approximate the location of the layer V motor cortex. The transducer was coupled to the skull via ultrasound gel, and temperature and pressure measurements were collected.
Immunohistochemistry and c-fos quantification. At the conclusion of the study, mice were perfused with 0.9% saline followed by 4% paraformaldehyde (PFA) through a peristaltic pump. Brain tissue was immediately collected and incubated in 4% PFA overnight before being changed to 30% sucrose. Tissue was then sectioned at 35 μM into tissue collection solution (glycerine, ethylene glycol, NaH.sub.2PO.sub.4, Na.sub.2HPO.sub.4) and stored at 4° C. For brain immunohistochemistry, brain sections from every ˜350 μM were immunolabeled for myc (1:500; Cell Signalling 2272S), c-fos (1:500; Encor RCPA-cfos), NeuN (1:1500; Synaptic Systems 226004), GFP (1:1000; AVES GFP-1010) and DAPI (1:1000). Tyramide amplification was used to enhance the myc and c-fos signals. Briefly, tissue was incubated for 30 min in H.sub.2O.sub.2, blocked for 1 hr in PBST plus 5% horse serum, and then incubated overnight with primary antibodies. The next day, tissue was incubated for 3 hours at room temperature with biotinylated donkey anti-rabbit antibody (1:500, Jackson Immunoresearch 711-065-152), and then washed, incubated with ABC (Vector Labs PK-4000) for 30 min, washed, incubated with tyramide, washed and incubated with streptavidin conjugated antibody along with secondary antibodies (Thermo Fisher Scientific and Jackson Immunoresearch) directed to other antigens of interest for 3 hrs at room temperature or overnight at 4° C. Tissue was then mounted onto glass slides and cover slipped with Prolong Gold Antifade mounting medium (Thermo Fisher Scientific). Imaging for quantification of c-fos and myc expression was conducted at 10× on a Zeiss Axio Imager.M2 connected to an OrcaFlash 4.0 C11440 camera. High quality images depicting myc and fos co-localization with GFP were taken on a Zeiss Airyscan 880 microscope. Imaging of whole brain sections was performed at 10× on an Olympus VS-120 Virtual Slide Scanning Microscope.
[0167] Quantification of c-fos and GFP positive neurons was conducted in FIJI (Schindelin, J. et al., Nat Methods 9, 676-682, doi:10.1038/nmeth.2019 (2012)),using manual cell counting. c-fos puncta were excluded if they did not colocalize with DAPI. Myc+ GFP+ neurons were also quantified using manual cell counting in FIJI. Only GFP+ cell bodies that were completely filled with myc immunolabeling were considered to be myc+. The experimenter was blinded as to the experimental condition during quantification.
BaseScope. Adult TRPA1 knockout (JAX #006401) and wild-type C57Bl6/J (JAX #000664) were perfused with 0.9% saline. A WT C57/B16 E18 mouse embryo was also collected from a cohort of embryos slated for dissociation for use in in vitro experiments. Brains and lumbar dorsal root ganglia (DRG) were extracted and immediately frozen in OCT. Fresh frozen sections (10 μm) were direct mounted and slides were stored at −80° C. overnight. A custom BaseScope probe (BA-Mm-Trpa1-3zz-st, ACD-Bio Probe Design #: NPR-0003309) targeting 2602-2738 of mouse TRPA1 (NM_177781.5. GTGATTTTT AAAACATTGC TGAGATCGAC CGGAGTGTTT ATCTTCCTCC TACTGGCTTT TGGCCTCAGC TTTTATGTTC TCCTGAATTT CCAAGATGCC TTCAGCACCC CATTGCTTTC CTTAATCCAG ACATTCAG) (SEQ ID NO: 8) was used. This region was chosen because it is deleted in the TRPA1 knockout mouse. Tissues were also probed with positive (Ppib, ACD #701071) and negative control (DapB, ACD #701011) probes, which gave the expected results in all experiments. DRG tissue was used as positive control for the TRPA1 probe, as small-diameter DRG neurons are known to express TRPA1. DRGs and cortices from TRPA1 knockout mice were used as a negative control for the TRPA1 probe.
Blood brain barrier (BBB) experiments. Mice received retro-orbital injections of 10 kDa fluorescein isothiocyanate-dextran (Sigma FD10S) at 150 mg/mL in saline. Positive control mice immediately received a cortical stab wound with a 27 g needle through a small hole drilled at AP 0, ML −1, DV −0.5. Ultrasound-treated mice had their scalp opened, and the ultrasound transducer was coupled over the left cortex with ultrasound gel. The transducer delivered 100 ms stimuli at 0.88 MPa every 10 seconds for 1 hour. Sham-treated mice underwent the same procedure, except that the transducer was not turned on. A cohort of mice that did not receive dextran injection or ultrasound was also collected for use as a negative control, and all values were normalized to this cohort. (n=4-5 per group, evenly split between male and female). Mice were perfused 70 minutes after cortical injection or start of the ultrasound treatment. One ultrasound-treated mouse had to be omitted from the data set due to inadequate perfusion. Brain sections were sectioned at 35 μM and processed as floating sections. After blocking, sections were incubated with 647 donkey anti-mouse IgG and DAPI. Images were collected on an Olympus Virtual Slide Scanner (VS-120), using the same settings across all groups. Fluorescein isothiocyanate-dextran 488 and 647-mouse IgG were quantified as mean intensity in left and right cortex from each sample using FIJI. All values were normalized to fluorescent values obtained from samples that received neither dextran nor ultrasound.
Quantification and statistical analyses. Statistical analyses were performed in GraphPad Prism and R. All statistical tests in the described studies herein were two-tailed. Single-variable comparisons were made with Mann-Whitney test. Group comparisons were made using either analysis of variance (ANOVA) followed by Tukey-Kramer post-hoc analysis or non-parametric Kruskal-Wallis test followed by Dunn's post-hoc analysis. The ROUT method in GraphPad Prism with a q=0.2% was used to identify and exclude outliers. Statistics used to analyze calcium imaging data are described in Methods. No statistical methods were used to predetermine sample sizes for single experiments. The code used to analyze calcium imaging data are available at https://github.com/shreklab/Duque-Lee-Kubli-Tufail2020.git.