NON-CANONICAL LIPOPROTEINS WITH PROGRAMMABLE ASSEMBLY AND ARCHITECTURE
20220154151 · 2022-05-19
Assignee
Inventors
Cpc classification
C12Y203/01097
CHEMISTRY; METALLURGY
C12N9/1029
CHEMISTRY; METALLURGY
C12P7/64
CHEMISTRY; METALLURGY
International classification
Abstract
Artificial lipoproteins bearing non-canonical post-translational modifications that are synthesized by leveraging substrate promiscuity of an acyltransferase. The non-canonical functionality of these lipoprotein results in a distinctive hysteretic assembly that is absent from the canonical lipoproteins and is used to prepare hybrid multiblock materials with precise and programmable patterns of amphiphilicity due to the unique assembly and function of the non-canonical post-translational modifications.
Claims
1. A method of synthesizing a non-naturally occurring lipoprotein, comprising the steps of: coexpressing a lipid modification enzyme with an intrinsically disordered peptide-polymer fused to a peptide substrate of the lipid modification enzyme; and supplementing the expression media with a non-natural fatty acid to form a non-naturally occurring lipoprotein.
2. The method of claim 1, wherein the lipid modification enzyme comprises N-myristoyl transferase.
3. The method of claim 2, wherein the peptide substrate comprises SEQ. ID NO: 1.
4. The method of claim 3, wherein the non-natural fatty acid is a non-natural substrate of N-myristoyl transferase.
5. The method of claim 3, wherein the non-natural fatty acid is an analogue of myristic acid.
6. The method of claim 5, wherein the non-natural fatty acid is 12-azidododecanoic acid.
7. The method of claim 6, wherein the non-naturally occurring lipoprotein includes a canonical post translational modification.
8. The method of claim 6, wherein the non-naturally occurring lipoprotein includes non-canonical post translational modification.
9. The method of claim 6, wherein the intrinsically disordered peptide-polymer comprises SEQ. ID. NO: 2.
10. A non-naturally occurring lipoprotein, comprising an intrinsically disordered peptide-polymer fused to a fatty acid.
11. The lipoprotein of claim 10, wherein the fatty acid is 12-azidododecanoic acid.
12. The lipoprotein of claim 11, wherein the intrinsically disordered peptide-polymer comprises SEQ. ID. NO: 2.
13. The lipoprotein of claim 12, wherein the fatty acid is a non-natural substrate of N-myristoyl transferase.
14. The lipoprotein of claim 12, wherein the fatty acid is an analogue of myristic acid.
15. The lipoprotein of claim 12, wherein the fatty acid is 12-azidododecanoic acid.
16. The lipoprotein of claim 10, wherein the non-naturally occurring lipoprotein includes a canonical post translational modification.
17. The lipoprotein of claim 10, wherein the non-naturally occurring lipoprotein includes non-canonical post translational modification.
18. The lipoprotein of claim 10, wherein the intrinsically disordered peptide-polymer comprises SEQ. ID. NO: 2.
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWING(S)
[0006] The present invention will be more fully understood and appreciated by reading the following Detailed Description in conjunction with the accompanying drawings, in which:
[0007]
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
DETAILED DESCRIPTION OF THE INVENTION
[0029] Referring to the figures, wherein like numeral refer to like parts throughout, there is seen in
[0030] The ability of N-myristoyltransferase (NMT) to accept analogues of myristic acid, such as 12-azidododecanoic acid (ADA), was used. ADA has been used to profile myristoylated proteins, but the potential of w-azido fatty acid to develop recombinant nanomaterials with controlled hierarchical assembly is virtually unexplored. The present invention co-expressed i) S. cerevisiae NMT with ii) an IDPP fused to a peptide substrate of NMT in E. coli, as seen in
[0031] IDPP was derived from the consensus sequence of tropoelastin, (GXGVP).sub.80 containing a mixture of valine and alanine (8:2) in X position. IDPPs derived from elastin exhibit lower critical solubility temperature (LCST) phase behaviour and have been used in numerous biomedical and materials science applications. This LCST phase behavior was used to purify IDPP (negative control), M-IDPP, and ADA-IDPP using inverse transition cycling (ITC) after expression (yield of purified proteins=3-10 mg/L of culture). Mass spectrometry (
[0032] Reverse-phase HPLC was used to quantify the hydrophobicity of each construct by comparing their retention time (t.sub.R). As shown in
[0033] Modification with ADA was investigated to determine whether it modulates the liquid-liquid phase separation of IDPP. The turbidity of solutions of IDPP, ADA-IDPP, and M-IDPP, seen in
[0034] Dynamic light scattering (DLS) and Transmission electron microscopy (TEM) were used to test the hypothesis derived from the turbidimetry. Below T.sub.t, IDPP did not self-assemble, as seen in
[0035] The hydrodynamic size remained unchanged below the T.sub.t of each construct (
[0036] TEM confirmed that after thermal annealing, ADA-IDPP spherical micelles transitioned to form long fibers, as seen in
[0037] Incorporation of non-canonical lipids with reactive moieties into proteins ushers new opportunities in material design. The reactivity of the azide group was envisioned to couple two lipoproteins with a precise pattern of amphiphilicity. ADA-IDPP was reacted with a telechelic alkyne (dipropargyl ether) to produce a lipoprotein with bolaamphiphile architecture (BMT-IDPP.sub.2) in which the hydrophobic lipid is flanked by two thermally responsive protein domains (
[0038] The self-assembly, seen in
[0039] Finally, an in-silico model was developed to explain the differences in the assembly of M- and ADA-IDPP. Since 99.5% of two lipoproteins are identical, atomistic simulations were confined to to the N-terminal amphiphilic region (lipid-recognition sequence peptide). Using all-atom molecular dynamics simulations, the differences in the macromolecular assembly of M-peptide and ADA-peptide were captured. As shown in
[0040] The well-documented substrate-promiscuity of lipidation machinery has been extensively leveraged in the field of chemical biology. The present invention was used to design novel lipoproteins with emergent material properties such as stimuli-responsive shape-shifting nanomorphology. There are several opportunities for the design of dynamic nano-biomaterials in this untapped chemical design space. For example, the programmable morphological change from nanoparticles to fibers can be used to simultaneously release encapsulated cargo and provide a scaffold for cell-adhesion and growth. Non-canonical lipids can also be used as chemical handles for structural elaboration and synthesis of hybrid materials with unique and precise amphiphilic pattern. These hybrid systems can be programmed to assemble into complex 2D and 3D morphologies to form materials with unique optical and mechanical properties.
Example
[0041] Materials
[0042] The pETDuet-1 vector was purchased from EMD Millipore (Billerica, Mass.). The chemically competent Eb5alpha and BL21(DE3) cells, restriction enzymes, ligase, and corresponding buffers, as well as DNA extraction and purification kits, were purchased from New England Biolabs (Ipswich, Mass.). Isopropyl β-D-1-thiogalactopyranoside (IPTG) was purchased from A. G. Scientific (San Diego, Calif.). 12-bromododecanoic acid, apomyoglobin, adrenocorticotropic hormone (ACTH), sinapinic acid, alpha-cyano-4-hydroxycinnamic acid, copper(II) sulfate pentahydrate, (+)-sodium L-ascorbate, dipropargyl ether, propargyl alcohol, and trifluoroacetic acid (TFA) were purchased from Sigma-Aldrich (St. Louis, Mo.). High-performance liquid chromatography-(HPLC) grade acetonitrile, SnakeSkin™ dialysis tubing with 3.5K nominal molecular weight cut off (MWCO), mass spectroscopy grade Pierce™ trypsin protease, Tryptone, Yeast Extract, Sodium chloride, ampicillin, kanamycin, phosphate buffer saline (PBS), myristic acid, DMSO, Polyethylenimine (PEI), and ethanol were purchased from Thermo Fisher Scientific (Rockford, Ill.). Mini-PROTEAN® TGX Stain-Free™ Precast Gels, Precision Plus Protein™ All Blue Pre-stained Protein Standard, and Precision Plus Protein™ Unstained Protein Standards were purchased from Bio-Rad Laboratories, Inc. (Hercules, Calif.). AF488-DBCO was purchased from Fluroprobes (Scottsdale, Ariz.). The carbon-coated grid (CF300-Cu) was purchased from Electron Microscopy Sciences. Deionized water was obtained from a Milli-Q® system (Millipore SAS, France). Simply Blue™ SafeStain was purchased from Novex (Van Allen Way Carlsbad, Calif.). All chemicals were used as received without further purification.
[0043] Sequence of IDPP
[0044] N-myristoyl transferase from Saccharomyces cerevisiae (UniProtKB—P14743) was used in this example. The N-terminal peptide fragment of S. cerevisiae Arf2 (UniProtKB—P19146 (SEQ. ID NO: 1), underlined below, was selected as the recognition sequence because of its high affinity for yeast NMT (Km˜0.08 The high affinity of this peptide toward yeast NMT is advantageous because binding of ADA-CoA to NMT reduces the affinity of a model octapeptide toward NMT:ADA-CoA complex by 7-fold, compared to the natural substrate (M-CoA). The intrinsically disordered peptide-polymer, shown below as fused to the peptide substrate sequence, comprised:
TABLE-US-00001 (SEQ. ID NO: 2) GLYASKLFSNLGVGVPGVGVPGAGVPGVGVPGVGVPGVGVPGVGVPGA GVPGVGVPGVGVPGGKGVGVPGVGVPGAGVPGVGVPGVGVPGVGVPGV GVPGAGVPGVGVPGVGVPGGKGVGVPGVGVPGAGVPGVGVPGVGVPGV GVPGVGVPGAGVPGVGVPGVGVPGGKGVGVPGVGVPGAGVPGVGVPGV GVPGVGVPGVGVPGAGVPGVGVPGVGVPGGKGVGVPGVGVPGAGVPGV GVPGVGVPGVGVPGVGVPGAGVPGVGVPGVGVPGGKGVGVPGVGVPGA GVPGVGVPGVGVPGVGVPGVGVPGAGVPGVGVPGVGVPGGKGVGVPGV GVPGAGVPGVGVPGVGVPGVGVPGVGVPGAGVPGVGVPGVGVPGGKGV GVPGVGVPGAGVPGVGVPGVGVPGVGVPGVGVPGAGVPGVGVPGVGVP GGKGY
Synthesis of 12-azidododecanoic acid (ADA)
[0045] Synthesis of 12-azidododecanoic acid (ADA) was conducted by modifying existing literature procedures. Briefly, 12-bromododecanoic acid (400 mg, 1.43 mmol, 1 equiv.) was mixed with sodium azide (465 mg, 7.15 mmol, 5 equiv.) and DMF (10 mL). The heterogeneous reaction mixture was stirred for 12 h at 60° C. After cooling the reaction mixture, the solvent was evaporated in vacuo at 30° C. The remaining solid was dissolved in 20 mL deionized water and extracted with ethyl acetate (20 ml×3). The organic layer was washed with 0.1 M HCl (20 mL×3). The solvent was removed in vacuo to obtain the product as a white waxy solid. Yield: 87%. .sup.1H-NMR (400 MHz, CDCl.sub.3): δ [ppm]=3.29 (t, 2H, N.sub.3—CH.sub.2), 2.38 (t, 2H, CH.sub.2—COOH), 1.65 (m, 4H), and 1.31 (m, 14H). .sup.13C-NMR (100 MHz, CDCl.sub.3): δ [ppm]=180.30, 51.58, 34.23, 29.44, 29.42, 29.35, 29.19, 29.12, 29.02, 28.84, 26.70, 24.66.
[0046] Protein Expression, Post-Translational Modification, and Purification
[0047] Expression
[0048] Protein expression was conducted in BL21(DE3) strains. A 4 mL of sterile 2×YT medium with a corresponding antibiotic (ampicillin or kanamycin, see Table 1) was inoculated with a single bacterial colony. The culture was then shaken at 37° C. on an orbital shaker at 200 rpm. After overnight growth, this suspension was used to inoculate each 1 L of sterile 2×YT medium. The bacteria were grown in an orbital shaker incubator at 37° C. at 180 rpm. After reaching OD600˜0.8, the culture media was supplemented with the fatty acid, myristic acid, or ADA, at the final concentration of 500 μM. After 15 min, expression was induced by the addition of IPTG to a final concentration of 1 mM. For non-myristoylated constructs, no myristic acid was added, and the protein expression was induced by adding IPTG to the culture at the OD of 0.8. The expression of proteins was then continued for 4 hours.
[0049] Note on optimization of expression condition: Devadas et al. quantified the substrate preference of NMT to accept ADA or M by quantifying the amount of modified peptide substrate (GARASVLS) using an in vitro end-point assay. In this assay, NMT exhibited a comparable preference for transferring ADA or M to this octapeptide. The observed comparable substrate preference involves the contribution of several opposing factors: (1) This assay requires activation of M or ADA to their corresponding acyl-CoA using Pseudomonas acyl-CoA synthetase. This enzyme exhibited a strong preference toward ADA over M and produced 1.5-2 times more ADA-CoA compared to M-CoA in vitro.; (2) NMT binds the peptide substrate only after binding acyl-CoA. In follow-up kinetic studies, NMT is shown to have a comparable affinity for M-CoA or ADA-CoA (Km=˜4-6 μM). However, the binding of ADA-CoA reduced the NMT affinity for its peptide substrate. Km for the peptide was increased to 66 μM, compared to 9 μM for binding of the peptide NMT:Myr-CoA complex; (3) Once the ternary complex (NMT:acyl-CoA:Peptide) was formed, NMT exhibited higher efficiency in transferring the ADA-CoA to N-terminal glycine residue, Vm (ADA)=1.5×Vm (M).
[0050] Based on the kinetic data, NMT has a higher preference for M vs. ADA in vitro, using Vm/Km as a measure of catalytic efficiency. It should be noted that the apparent substrate preference of NMT inside E. coli is influenced by the intracellular pool of ADA-CoA and M-CoA. The concentration of these activated fatty acids is influenced by several (time-dependent) factors: (1) Transport of ADA across the cell envelope (diffusion or by fatty acid transporter, FadL); (2) The preference of E. coli acyl-CoA synthetase (FadD) to accept ADA as a substrate; (3) The intracellular pool of Myr-CoA from the endogenous fatty acid biosynthesis pathway; (4) Possible degradation ((3-oxidation) of ADA-CoA in the fatty acid degradation pathway; (5) Basal expression of NMT an IDPP in cells before induction and addition of ADA.
[0051] Additionally, it could not be ruled out that differences in the polypeptide substrate further change the kinetics of acyl transfer in vivo. The N-terminal sequence of Arf2 fused to a large IDPP was used in the experiment, but Devadas et al. used a short octapeptide derived from Pr55gag polypeptide precursor of human immunodeficiency virus I.
[0052] It was noted that the relative concentration of ADA-IDPP vs. M-IDPP decreases with the induction time. Therefore, a higher concentration of ADA was used in the expression culture and the expression time was reduced.
[0053] Purification
[0054] The cells were harvested by centrifugation at 3745×g at 4° C. for 30 min. The bacterial pellet was resuspended in phosphate buffer saline (PBS, 15 mL per 1 L of expression culture). The cells were then lysed by two rounds of sonication (10 s on, 60 s off, total sonication time of 90 s. Power: 60-80 w). To ensure complete dissipation of the heat generated during sonication cycles, the sample was kept on ice for 10 min after each cycle. Polyethylenimine was then added to the lysed culture (2 mL of 50% w/v solution per 1 L of expression culture) to remove the DNA fragments. The lysed bacterial solution was centrifuged (22,830×g, 4° C., 15 min) to separate the protein from insoluble cell debris and PEI-complexed nucleic acids. IDPP, M-IDPP, and ADA-IDPP were then purified from the endogenous E. coli proteins by leveraging their temperature-triggered liquid-liquid phase separation using inverse transition cycling..sup.5 Each protein was further purified by preparative HPLC to ensure purity (>95%) for the self-assembly studies. Reverse-phase HPLC (RP-HPLC) was performed with a Shimadzu HPLC system (Phenomenex Jupiter® 5 μm C4 300 Å, LC Column 250×10 mm, solvent A: H.sub.2O+0.1% TFA, solvent B: acetonitrile+0.1% TFA). The percentage of the organic solvent in the mobile phase was increased from 0 to 90% over the course of 35 minutes. After HPLC purification, the organic solvent was removed by dialysis against water using SnakeSkin™ Dialysis Tubing (7000 MWCO, Thermo Scientific) overnight, followed by lyophilization. Lyophilized proteins were kept at −20° C. for long-time storage. Purified protein yield per L of culture: IDPP (˜10 mg); M-IDPP (˜8 mg); ADA-IDPP (˜3-5 mg).
Synthetic Modification of ADA-IDPP
Synthesis of Bolaamphiphile (BMT-IDPP2)
[0055] Bolaamphiphile was synthesized by joining two ADA-IDPP chains via bis(methoxy-1,2,3-triazole), BMT, using a telechelic alkyne (dipropargyl ether),
[0056] Given that the LCST of bolaamphiphile (and its concentration dependence) is identical to ADA-IDPP (Table 3), it was not attempted to purify these two proteins from the reaction mixture using traditional inverse transitional cycling, i.e., by adding kosmotropic salts to the mixture to trigger the LCST phase transition isothermally. However, it should be noted that unlike ADA-IDPP, bolaamphiphile undergoes a reversible phase transition at elevated temperatures (
Synthesis of the control hydroxylmethyl-1,2,3-triazole-IDPP (HMT-IDPP)
[0057] A control construct (HMT-IDPP, single-tail amphiphile in which the terminal azide is converted to a triazole moiety) was synthesized using CuAAC by reacting ADA-IDPP (100 μM, 1 equiv) with excess propargyl alcohol (1.0 mM, 10 equiv) using a reaction protocol described for BMT-IDPP2. HMT-IDPP was purified using HPLC, and its purity was confirmed using SDS-PAGE (
[0058] Computational Method
[0059] The molecular structure of M-peptide and ADA-peptide molecules were built in two-steps. First, the three-dimensional structure of the recognition peptide (GLYASKLFSNL) was determined using the I-TASSER webserver. In the second step, the M and ADA lipid tails were added to the glycine residue of the peptide using the CHARMM-GUI webserver. The individual M-peptide and ADA-peptide structures were equilibrated at 300 K using the CHARMM36 all-atom force field available within the CHARMM-GUI workspace.
[0060] The equilibrated structures were used to construct two explicitly solvated systems containing: (i) 15 molecules of M-peptide and (ii) 15 molecules of ADA-peptide. Each system contained 150 mM NaCl solution and TIP3P water molecules in a cubic box with a box length of 10 nm. The systems were energy minimized and equilibrated at T=300 K in the isothermal-isochoric (NVT) and at P=1 bar in isothermal-isobaric (NPT) ensemble constraints in the CHARMM-GUI workflow. The equilibrated output from these runs was used to study self-assembly behavior.
[0061] The self-assembly molecular dynamics simulations were performed using the GROMACS 2019.4 simulation package. The M-peptide and ADA-peptide molecules and ions were modeled using the CHARMM36 all-atom force field. Water was modeled using TIP3P. The NPT production runs were run for 400 ns using 2 fs timestep. The temperature was maintained at 303.15 K using the Nose-Hoover thermostat with τt=1.0 ps. The pressure was maintained at 1 bar using isotropic coupling using Parrinello-Rahman barostat with τP=5 ps and compressibility of 4.5×10-5 bar-1. Periodic boundary conditions were applied in all three dimensions. The nonbonded van der Waals interactions were calculated using a cutoff of 1.2 nm. The long-range electrostatic interactions were studied with particle mesh Ewald (PME) algorithm at a 1.2 nm cutoff. Further, the behavior of the system during the heating cycle was simulated for both systems over 280-360 K temperature range (280, 290, 300, 310, 320, 330, 340, 350, and 360 K) over a total simulation time of 400 ns. Analyses of the results from thermal annealing simulations, including radius of gyration (Rg) and solvent accessible surface area (SASA), were performed using GROMACS built-in utilities. Molecular visualization was performed using VMD software.
[0062] Characterization
[0063] Fourier Transform Infrared Spectroscopy
[0064] Fourier transform infrared spectroscopy (FT-IR) spectra were obtained on a Bruker Tensor 27 spectrophotometer with a MIR source and a DLaTGS detector. Spectra were recorded under ambient conditions at a resolution of 4 cm-1. A total of 64 scans were recorded for each spectrum in addition to the background.
[0065] Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE)
[0066] The purity, molecular weight, and fluorescent labelling of the purified proteins were first assessed using SDS-PAGE (10% cross-linked. TGX Stain-Free™ gels). The gels with fluorescently labelled proteins (see below) were initially visualized using a blue LED transilluminator (□ex=465 nm) followed by visualization under UV-light (□ex=350 nm) using a BioRad Gel Doc EZ imager. The gels were then stained with SimplyBlue™ SafeStain by following the manufacturer protocol and imaged using BioRad Gel Doc EZ imager.
[0067] Fluorescent Labelling
[0068] Strain-promoted alkyne-azide cycloaddition reaction was used to selectively label the proteins bearing bioorthogonal azide group (ADA-IDPP). Alexa Fluro 488 fluorophore conjugated to Dibenzocyclooctyne (AF488-DBCO) was dissolved in DMSO at the final concentration of 1 mg/mL. Protein solution (˜25 μM, 10 μL) of ADA-IDPP or M-IDPP were mixed AF488-DBCO (˜1.05 mM, 4 μL) in an Eppendorf tube. The reaction mixture was kept in the dark at room temperature on a tube rotator overnight. The proteins were then separated from unreacted AF488-DBCO using SDS-PAGE. The labelled protein bands were visualized as described above. Total protein content was assayed by staining the gel with SimplyBlue.
[0069] Analytical HPLC
[0070] Analytical RP-HPLC was performed on a Shimadzu instrument using a Phenomenex Jupiter® 5 μm C4 300 Å, 250×4.6 mm LC Column with a mobile phase consisting of a gradient of acetonitrile in water (Table 2) to analyze IDPP, M-IDPP, and ADA-IDPP,
TABLE-US-00002 TABLE 2 The gradient mobile phase composition of analytical HPLC. Time (min) % B (CH3CN + 0.1% TFA) 0 0 5 0 45 90
[0071] Matrix Assisted Laser Desorption/Ionization Time-of-Flight Mass Spectrometry (MALDI-TOF-MS)
[0072] MALDI-TOF-MS was conducted on Bruker Autoflex III with smart ion source. A saturated solution of sinapinic acid in 30% acetonitrile was used as the matrix. Samples for MALDI-TOF-MS analysis were prepared by mixing 2 μL of the protein solutions (50 μM) with the matrix (8 μL), followed by serial dilution. These solutions were plated onto a sample plate and dried at room temperature. Apomyoglobin (MW=16,952.27 Da) was used as standard.
[0073] Trypsin Digestion of Proteins
[0074] To confirm the regioselectivity of lipid modification, proteins were digested with trypsin, and the peptide fragments were analyzed using MALDI-TOF-MS. Trypsin digestion was conducted according to the manufacturer's protocol. Briefly, 9 μL of protein (50 μM in PBS) was added to 10 μL of 50 mM ammonium bicarbonate buffer (pH=7.8) in an Eppendorf tube. To this mixture, 1 μL trypsin (reconstituted as 1 μg/μL in 50 mM acetic acid) was added, and the reaction mixture was incubated at 37° C. After 3 h, the peptide fragments were analyzed by MALDI-TOF-MS. α-cyano-4-hydroxycinnamic acid was used as a matrix and adrenocorticotropic hormone (Mw=2,464.1989 Da) was used as calibrant for the analysis of the trypsin-digested peptide fragments.
[0075] Turbidimetry Assay
[0076] Temperature-triggered phase separation of IDPP, M-IDPP, and ADA-IDPP were monitored using an Agilent UV-Vis Spectrophotometer (Cary100) equipped with a Peltier temperature controller by measuring the optical density of the solution at 350 nm (where all proteins had negligible extinction coefficients). Proteins were dissolved in PBS in three concentrations (50, 25, and 12.5 μM) and were equilibrated at 20° C. (below the transition temperature of all constructs) for 5 minutes before heating the solution at the rate of 1° C./min. M-IDPP, ADA-IDPP, HMT-IDPP, and BMT-IDPP2 were heated to 45° C., while unmodified IDPP was heated to 60° C. as it had a higher transition temperature. At the end of the heating cycle, the protein solutions were cooled at the rate of 1° C./min to 20° C. while monitoring the optical density at 350 nm. The transition temperatures were calculated by the method of first derivative using the optical density plotted against the temperature. Transition temperatures are defined as the inflection point (the maximum of the first derivative) in the optical density during the heating cycle. These data were fitted to the following model Tt=−m×ln [IDPP]+Tc to derive critical transition temperature (Tc) and the concentration dependence of Tt (m), summarized in Table 3.
TABLE-US-00003 TABLE 3 Critical transition temperature (Tc) and the concentration dependence of Tt derived from turbidity plots. Construct m (90% CI)[a] Tc (90% CI)[b] IDPP 5.3 (2.8-7.9) 65.9 (57.6-74.2) M-IDPP 1.1 (0.4-1.8) 37.1 (34.7-39.6) ADA-IDPP 1.3 (0.4-2.2) 36.4 (33.4-39.4) HMT-IDPP 2.9 (1.5-4.4) 45.6 (41.9-49.4) BMT-IDPP2 1.4 (0-2.8).sup. 35.1 (31.5-38.7)
[0077] Derived values from fitting the Tt data to the following model: Tt=−m×ln ([IDPP])+Tc. [a] ° C./ln (μM/μM). [b] ° C. 90% confidence intervals are calculated from the linear regression analysis using Graphpad prism 8.4.
[0078] Dynamic Light Scattering (DLS)
[0079] DLS experiments were conducted on Zetasizer Nano (Malvern Instruments) with 173° backscatter detector. Protein samples in PBS (50 μM) were filtered through a Millex®-LH Low protein Binding Hydrophilic LCR Membranes (0.45 μm) into the DLS cuvette. The measurements were conducted in triplicates at each temperature. The temperature was increased in 5° C. increments, and the samples were equilibrated at each temperature for 1 min. IDPP was analyzed in the temperature range of 15-60° C. (IDPP), and lipidated IDPP (M-IDPP and ADA-IDPP) were analyzed in the temperature range of 15-45° C. At the end of the heating cycle, the temperature was reduced to 15° C. Scattering correlation function was analyzed using the Zetasizer software using the method of cumulants and CONTIN to calculate the hydrodynamic radii of each construct at each temperature.
[0080] The size of IDPP unimer was estimated using the following equation17, which is a scaling law based on Flory's mean field approach18:
TABLE-US-00004 TABLE 4 Parameters used for estimation of the size of IDPP unimer. Parameter Value (unit) Reference lp Persistence length = ½ Kuhn length (lk)* 1.05 nm 19 b Monomer size* 0.365 nm 19 N 3 × (number of pentapeptide repeat) 240 20 v Flory exponent for the expanded coil state ⅗ 18
[0081] Transmission Electron Microscopy (TEM)
[0082] The TEM imaging was performed on JEOL-2100F operated at 200 kv and images were recorded by Gatan CCD camera. ADA-IDPP solution (10 μL) used in DLS experiment, i.e., after thermal annealing, were deposited onto carbon-coated grid (CF300-Cu, Electron Microscopy Sciences) or glow discharged carbon-coated copper grids for 5 minutes before blotting the excess solution. The grid was then stained with 10 μL of 1% uranyl acetate and the excess stain was blotted after 1 min. The grid was dried at room temperature for 2 hours followed by vacuum drying for 12 hours before imaging. BMT-IDPP2 solution was heated to 37° C. before depositing a 10 μL of the sample onto the TEM grid. Images of M-IDPP and ADA-IDPP (below LCST,
[0083] Pyrene Assay
[0084] A pyrene assay was to determine the critical micellization concentration (CMC) of M-IDPP and ADA-IDPP at 20° C. (below transition temperature). The fluorescence of pyrene was measured using a Cary Eclipse Fluorescence Spectrophotometer at the excitation wavelength=334 nm. The emission signal was recorded between 350-450 nm, at 1 nm intervals with the scan rate of 600 nm/min.
[0085] Statistical Analysis
[0086] Statistical analysis was conducted using GraphPad Prism 8.4. The line representing the phase boundary between single-phase and two-phase regimes for each construct (
[0087] The error bars for all DLS measurements (
[0088] TEM images were analyzed using Fiji to determine the width of fibers. The result is reported as average±standard deviation as well as the frequency distributions. The sample size is reported in parenthesis.