METHOD FOR THE PRODUCTION OF AMINO SUGAR CONTAINING PRODUCTS

Abstract

A method or producing amino sugar (containing) products using metabolically engineered microorganisms is disclosed, wherein the conversion of UDP-N-acetylglucosamine to cell envelope precursors and molecules is reduced by altering the activity of enzymes involved in the synthesis of cell envelope precursors and molecules.

Claims

1-16. (canceled)

17. A method of producing at least one specialty product selected from the group consisting of: UDP-N-acetylglucosamine (UDP-GlcNAc), a UDP-GlcNAc-derived saccharide, a UDP-GlcNAc-derived nucleoside, a UDP-GlcNAc-derived glycolipid, a UDP-GlcNAc-derived glycoside, a UDP-GlcNAc-derived glycoprotein, a UDP-GlcNAc-derived glycosylphosphate, a UDP-GlcNAc-derived glycosylsulphate, a saccharide derived from a UDP-GlcNAc-derived nucleoside, a nucleoside or glycolipid derived from a UDP-GlcNAc-derived nucleoside, a glycoside derived from a UDP-GlcNAc-derived nucleoside, a glycoprotein derived from a UDP-GlcNAc-derived nucleoside, a glycosylphosphate derived from a UDP-GlcNAc-derived nucleoside, and a glycosylsulphate derived from a UDP-GlcNAc-derived nucleoside, wherein the method comprises: a) decreasing synthesis or activity of at least one essential enzyme involved in peptidoglycan biosynthesis, pseudopeptidoglycan biosynthesis, UDP-N-acetylmuramoyl-pentapeptide biosynthesis, lipid IVA biosynthesis, or chitin biosynthesis in a suitable microorganism without reducing the microorganism's cell growth, b) cultivating the microorganism wherein endogenous UDP-GlcNAc is the building block of both production of specialty carbohydrates and biomass formation, and c) extracting and purifying the selected specialty product(s).

18. The method according to claim 17, wherein decreasing the synthesis or activity of at least one essential enzyme involved in the endogenous conversion of UDP-GlcNAc to at least one cell envelope precursor or component is undertaken by genetic modification of the microorganism or by adding an inhibitor of the enzyme to the microorganism.

19. The method according to claim 18, wherein genetically modifying the microorganism comprises rendering at least one gene or its cognate RNA less able or completely unable to produce a functional enzyme.

20. The method according to claim 18, wherein the inhibitor of the essential enzyme is selected from the group consisting of fosfomycin, bacitracin, cycloserine, vancomycin, teicoplanin, ramoplanin, an avenaciolide, a peptide inhibitor pyrazolopyrimidine, tulipaline B, cnicin, benzothioxalone, nitrovinylfuran, a β-lactam, a penicillin, a penem, a carbapenems, cephems, a cephalosporin, a cephamycin, a monobactam, a β-lactamase inhibitor, cefsulodin, ampicillin, carbenicillin, tyrothricin, and teixobactin.

21. The method according to claim 17, wherein the essential enzyme is selected from the group consisting of UDP-N-acetylglucosamine 1-carboxyvinyltransferase, UDP-N-acetylenolpyruvoylglucosamine reductase, UDP-N-acetylmuramate-L-alanine ligase, glutamate racemase, UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopimelate ligase, phospho-N-acetylmuramoyl-pentapeptide-transferase, N-acetylglucosaminyl transferase, UDP-3-O-acyl-N-acetylglucosamine deacetylase, UDP-N-acetylglucosamine acyltransferase, tetraacyldisaccharide 4′-kinase, lipid A disaccharide synthase, UDP-2,3 -diacylglucosamine diphosphatase, UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase, and (polymer) chitin synthase.

22. The method according to claim 17, further comprising: introducing into the microorganism at least one gene encoding a carbohydrate synthase, a glycosyl transferase, or an epimerase.

23. The method according to claim 22, wherein the carbohydrate synthase, the glycosyl transferase or the epimerase is selected from the group consisting of UDP-N-acetylglucosamine 2-epimerase, UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase, UDP-N-acetylglucosamine 2-epimerase, UDP-N-acetyl-D-glucosamine dehydrogenase, UDP-N-acetylglucosamine 4-epimerase, β-polysaccharide synthases, chitin synthase, N-acetylglucosaminyltransferase, β-1,4-N-acetylglucosaminyltransferase, Nodulation protein C (“NodC”), NodC-like enzyme, chitooligosaccharide synthase, N-acyltransferase nodulation protein, hyaluronan synthase, glycosyl transferase family 2, N-acylmannosamine kinase, sialic acid synthase, N-acylneuraminate-9-phosphatase, N-acetylneuraminate synthase, N-acylneuraminate/3-deoxy-D-glycero-D-galacto-nononate cytidylyltransferase, hyaluronic acid synthase, β-1,3 -galactosyl-N-acetylhexosamine phosphorylase, β-1,3-N-acetylglucosaminyltransferase, sialyltransferase, 2,3-sialyltransferase, 2,6-sialyltransferase, 2,8-sialyltransferase, N-acetylmannosamine transferase, N-acetylmannosaminyltransferase N-acetylgalactosamine transferase, N-acetylgalactosaminyltransferase and β-1,3-galactosyltransferase.

24. The method according to claim 17, further comprising: rendering at least one gene less-functional or non-functional into the microorganism wherein the gene encodes an enzyme with hydrolase or epimerase activity.

25. The method according to claim 24, wherein the hydrolase, or the lyase is selected from the group consisting of β-D-galactoside galactohydrolase, β-D-galactosidase, lactase, N-acetyl-P-neuraminate lyase, N-acetylneuraminate lyase, N-acetylneuraminic acid aldolase, acetylneuraminate lyase, sialic aldolase, sialic acid aldolase, sialate lyase, N-acetylneuraminic aldolase, neuraminic aldolase, N-acetylneuraminate aldolase, neuraminic acid aldolase, N-acetylneuraminic acid aldolase, neuraminate aldolase, N-acetylneuraminic lyase, N-acetylneuraminic acid lyase, NPL, NALase, NANA lyase, acetylneuraminate pyruvate-lyase, N-acetylneuraminate pyruvate-lyase, chitinase, endochitinase. exo-chitinase, chitinase A, (1->4)-2-acetamido-2-deoxy-beta-D-glucan diacetylchitobiohydrolase, β-N-acetylgalactosaminidase, N-acetyl-β-galactosaminidase, N-acetyl-β-D-galactosaminidase; β-acetylgalactosaminidase; β-D-N-acetylgalactosaminidase, N-acetylgalactosaminidase, β-N-acetyl-D-galactosaminide N-acetylgalactosaminohydrolase, β-N-acetylhexosaminidase, hexosaminidase; β-acetylaminodeoxyhexosidase, N-acetyl-β-D-hexosaminidase, N-acetyl-β-D-hexosaminidase, β-hexosaminidase, β-acetylhexosaminidinase, β-D-N-acetylhexosaminidase, β-N-acetyl-D-hexosaminidase, β-N-acetylglucosaminidase, hexosaminidase A, N-acetylhexosaminidase, β-D-hexosaminidase, and N-acetyl mannosidase, mannosidase.

26. The method according to claim 17, further comprising: introducing into the microorganism at least one gene encoding for at least one enzyme involved in the UDP-GlcNAc synthesis.

27. The method according to claim 26, wherein the enzyme involved in the UDP-GlcNAc synthesis is selected from the group consisting of glutamine-fructose-6-phosphate aminotransferase, phosphoglucosamine, glucosamine-1-phosphate acetyltransferaseN-acetylglucosamine-1-phosphate uridyltransferase, N-acetylglucosamine-6-phosphate deacetylase, bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase, UDP-N-acetylglucosamine pyrophosphorylase, a glucosamine-phosphate N-acetyltransferase, a phosphoacetylglucosamine mutase, and a UDP-N-acetylglucosamine diphosphorylase, UDP-N-acetylglucosamine/UDP-N-acetylgalactosamine diphosphorylase.

28. The method according to claim 17, wherein the microorganism is a bacterium, archaea, or a yeast.

29. The method according to claim 28, wherein the bacterium is of the genus Escherichia, Lactobacillus, Corynebacterium, or Bacillus.

30. The method according to claim 28, wherein the yeast is of the genus Saccharomyces or Pichia.

31. The method according to claim 28, wherein the archaea is of the genus Sulfolobus or. Methanobacter

32. The method according to claim 17, wherein the specialty product is selected from the group consisting of: UDP-N-acetylglucosamine, chitin, chitosan, chitooligosaccharide, glycosylated chitooligosaccharide, acylated chitooligosaccharide, sulfated chitooligosaccharide, neomycin, butirosin, an —O-GlcNAcylated molecule, N-acetylglucosamine, heparin, heparin sulfate, heparosan, chondroitin, lacto-N-biose, lacto-N-triose, lacto-N-tetraose, lacto-N-neotetraose, N-acetylmannosamine, N-acetylneuramic acid, a -Neu5Acylated molecule, UDP-N-acetylmannosamine, a -ManAcylated molecule, UDP-N-acetylgalactosamine, a -GalNAcylated molecule, CMP-N-acetylneuraminic acid, 3′-sialyllactose, 6′-sialyllactose, sialyl Lewis X, Sialyl Lewis A, polysialic acid, gangloside, hyaluronic acid, disialyllacto-n-tetraose, 3′-sialyl-3-fucosyllactose, sialyllacto-N-tetraoses 6′-sialyllactosamine, 3′-sialyllactose, 2′,3-difucosyllactose, 3′-sialyllactose, 6′-sialyllactose, 3′-sialyl-3-fucosyllactose, sialylated lacto-N-triose, sialylated lacto-N-tetraose, sialylated lacto-N-neotetraose, lacto-N-fucopentaose I, lacto-N-fucopentaose II, lacto-N-fucopentaose III, lacto-N-fucopentaose V, sialyl-lacto-N-tetraose a, sialyl-lacto-N-tetraose b, sialyl-lacto-N-tetraose b, fucosyl-sialyllacto-N-neotetraose a, fucosyl-sialyllacto-N-neotetraose b, fucosyl-sialyllacto-N-neotetraose c, lacto-N-difucohexaose I, lacto-N-difucohexaose II, lacto-N-difucohexaose III, disialyllacto-N-tetraose, fucosyl-disialyllacto-N-tetraose I, disialyl-fucosyllacto-N-tetraose II, monofucosyllactose, monosialyllactose, sialyl-lacto-N-pentaose I, sialyl-lacto-N-pentaose II, sialyl-lacto-N-fucopentaose I, sialyl-lacto-N-fucopentaose II, difucosyllacto-N-hexaose, trifucosyllacto-N-hexaose, difucosyl-p-lacto-N-neohexaose, difucosyl-p-lacto-N-hexaose, difucosyllacto-N-hexaose, monofucosyllacto-N-hexaose II, lacto-N-hexaose, lacto-N-neohexaose, fucosyl-sialyllacto-N-neohexaose, and sialylated molecules as amino sugar-containing product.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0020] FIG. 1. Overview of the derivatives of UDP-GlcNAc. With GlcNAc═ N-acetylglucosamine; paCO S═ partially acetylated chito-oligosaccharides; GalNAc═ N-acetylgalactosamine; ManNAc═ N-acetylmannosamine; Neu5Ac═ N-acetylneuraminic acid, lipo-COS═ acylated chitooligosaccharides, sulfoCOS═ sulfated chitooligosaccharides, glycoCOS═ glycosylated chitooligosaccharides.

[0021] FIG. 2. Peptiodglycan biosynthesis pathway obtained from ECOCYC (Keseler et al., 2013). EC number for each reaction step and corresponding gene in Escherichia coli is given left from the arrow.

[0022] FIGS. 3A-3E. Detailed plasmid maps of constructed vectors. Bars indicate special regions (an origin of replication, a specific promoter (e.g., P14), terminator (e.g., rrnB T1), or something else (e.g., FRT site)). Arrows depict specific coding sequences. TCC stands for translational coupling cassette.

[0023] FIG. 4. TLC results of fosfomycin inhibition experiment with E. coli s3KO+ pCOS. Legend: A. minimal medium (MM)+glucose; B. E. coli sWT grown on MM+glucose; C. chitooligosaccharides (COS)-mixture (15% fully acetylated chitotetramers (A4), 85% fully acetylated chitopentamers (A5)) (10 g/l); D. 0 mM fosfomycin; E. 0.1 mM fosfomycin; F. 0.25 mM fodfomycin; G. 1 mM fosfomycin; H. N-acetylglucosamine (GlcNAc). Bars are a measure for the intensity of the COS spots determined with ImageJ.

[0024] FIG. 5. The genetic situation of the wild-type Escherichia coli MG1655. Four predicted promoter (and operator) sites that drive the ibaG-murA operon (Weaver et al., 2014) and the pathway towards the UDP-GlcNAc pool are depicted. The gray arrow represents the branch point where heterologous pathways for complex carbohydrates may be installed.

[0025] FIG. 6. The genetic situation after knocking in the targeted fragment generated from p_P22RBS-cITCmurA. The expression of cl represses the expression of mKATE2, converting the expression of murA into a measurable signal.

[0026] FIG. 7. The genetic situation after knocking in the targeted fragments generated from p PRND-cITCmurA showing how expression randomization was effectuated and how it generated strain library sRND.

[0027] FIG. 8. The high-throughput MTP-based fluorescence screening of strain library sRND. Low expression of the cl repressor (and thus low murA expression), correlates with a high fluorescent signal, and vice versa.

[0028] FIG. 9. Specific fluorescence and specific corrected maximal growth rate measurements for the seven selected mutant strain library (sRND). Bar plots show the average specific fluorescence per strain. Box plots indicate the distribution of the specific corrected maximal growth rate per strain. sWT, sWT+(E. coli sWT carrying pindicator) and sP22 are also depicted as control.

[0029] FIG. 10. qPCR data for murA of E. coli sRND1-7 and sWT. For each strain the mid-exponential average calibrated normalized relative quantity (CNRQ) of MurA mRNA and standard deviations of 3 biological and 2 technical replicates are depicted.

[0030] FIG. 11. Validation of the fluorescent high-throughput screening technique. mRNA levels of the E. coli sRND strains highly correlate with the specific fluorescence (R.sup.2=0.9960)

[0031] FIG. 12. The average cellular UDP-GlcNAc pools of mid-exponentially grown E. coli sRND1-7 and sWT, and standard deviations of 2 (3*) biological replicates are depicted. Cellular concentrations were assessed assuming an intracellular volume of 1 fL and 8*10.sup.8 cells per OD600.

[0032] FIG. 13. Production of chitopentaose in E. coli sCOS1-5, relatively compared to the wild type production titre in sWTCOS. Error bars depict the propagated error.

[0033] FIG. 14. Production of Neu5Ac in E. coli sSA1-5, relatively compared to the wild type production titre in sWTSA. Error bars depict the propagated error.

[0034] FIG. 15. Production of COS in E. coli sCOS2 +pHBP, sWTCOS +pHBP, sCOS2 and sWTCOS grown in minimal medium with glucose and varies inducer concentrations: aTc/IPTG [mM/mM] of 5/0.01, 5/0.05, 10/0.01 and 10/0.05. Error bars depict the propagated error.

DETAILED DESCRIPTION

[0035] This disclosure describes metabolically engineered organisms, especially microorganisms, that are capable of producing amino sugar-containing products, especially UDP-N-acetylglucosamine (UDP-GlcNAc), UDP-GlcNAc-derived saccharides, UDP-GlcNAc-derived nucleosides, UDP-GlcNAc-derived glycolipids, UDP-GlcNAc-derived glycosides, UDP-GlcNAc-derived glycoproteins, UDP-GlcNAc-derived glycosylphosphates, UDP-GlcNAc-derived glycosylsulphates, saccharides derived from UDP-GlcNAc-derived nucleosides, glycolipids derived from UDP-GlcNAc-derived nucleosides, glycosides derived from UDP-GlcNac-derived nucleosides, glycoproteins derived from UDP-GlcNAc-derived nucleosides, glycosylphosphates derived from UDP-GlcNAc-derived nucleosides, glycosylsulphates derived from UDP-GlcNAc-derived nucleosides, with a guaranteed high yield and a high productivity.

[0036] The term “metabolically engineering” refers to the practice of optimizing genetic and regulatory processes within the organism to increase the organism's production of a certain desired amino sugar-containing product. To this end, any well-known technique that may be used to (genetically) modify an organism's metabolism and, hence, phenotype, may be used as is described in (Verpoorte et al., 1999; Yadav et al., 2013; De Mey et al., 2007; Tyo, Alper, and Stephanopoulos 2007; Gaj, Sirk, and Barbas 2014; De Bruyn, Van Brempt, et al., 2015; Farmer and Liao 2000; Biggs et al., 2014; Stephanopoulos 2012; Trantas et al., 2015; Pirie et al., 2013; Patil, Akesson, and Nielsen 2004; Alper and Stephanopoulos 2007; Bhan, Xu, and Koffas 2013; Moon et al., 2012; Biggs et al., 2016; Ajikumar et al., 2010; Geert Peters et al., 2015; and Coussement et al., 2014).

[0037] The microorganisms of this disclosure are metabolically engineered so that the flux of UDP-GlcNAc to the biomass component “cell envelope precursors and molecules” is reduced while the microorganisms retain their capacities to grow. This is achieved by altering the enzyme activity and/or activities catalyzing essential reactions converting UDP-GlcNAc to cell envelope precursors and molecules.

[0038] Using the engineered organisms of this disclosure, product formation through the conversion of UDP-GlcNAc to an amino sugar-containing product is not impaired by excessive withdrawal of this precursor for the formation of cell envelope precursors and molecules, i.e., biomass production instead of product formation. More specific, the essential reactions converting UDP-GlcNAc to cell envelope precursors and molecules are reduced enabling increased UDP-GlcNAc availability for the formation of an amino sugar-containing product. This reduction of essential reactions involved in the formation of cell envelope precursors and molecules is not accompanied with decreased cell fitness, e.g., cell growth, which normally occurs when cognate essential genes are rendered less-functional or non-functional.

[0039] This means that the former drawback of having to produce biomass before the actual production of the product may start, is eliminated. This methodology results in high production rates, without the inherent problems that come with multi-enzymes systems and two phase fermentation systems.

[0040] The present disclosure relates to a method of producing at least one amino sugar-containing product chosen from the group consisting of especially UDP-N-acetylglucosamine (UDP-GlcNAc), UDP-GlcNAc-derived saccharides, UDP-GlcNAc-derived nucleosides, UDP-GlcNAc-derived glycolipids, UDP-GlcNAc-derived glycosides, UDP-GlcNAc-derived glycoproteins, UDP-GlcNAc-derived glycosylphosphates, UDP-GlcNAc-derived glycosyl sulphates, saccharides derived from UDP-GlcNAc-derived nucleosides, glycolipids derived from UDP-GlcNAc-derived nucleosides, glycosides derived from UDP-G1cNac-derived nucleosides, glycoproteins derived from UDP-GlcNAc-derived nucleosides, glycosylphosphates derived from UDP-GlcNAc-derived nucleosides, glycosylsulphates derived from UDP-G1cNAc-derived nucleosides, comprising: [0041] a) obtaining a suitable microorganism, [0042] b) decreasing the synthesis or activity of at least one essential enzyme involved in the peptidoglycan biosynthesis, the pseudopeptidoglycan biosynthesis, the UDP-N-acetylmuramoyl-pentapeptide biosynthesis, the lipid IV.sub.A biosynthesis, or the chitin biosynthesis without reducing cell growth of the microorganism, [0043] c) cultivating the microorganism wherein endogenous UDP-G1cNac is the building block of (or fuels) both the production of specialty carbohydrates and biomass formation, and, [0044] d) extracting and purifying the specialty product.

[0045] More specifically, the present disclosure relates to a method as indicated above wherein “decreasing the endogenous conversion of UDP-GlcNAc to at least one cell envelope precursor or component” is undertaken by genetically modifying the organism or by adding an inhibitor of the enzymes of the peptidoglycan biosynthesis, pseudopeptidoglycan biosynthesis, UDP-N-acetylmuramoyl-pentapeptide biosynthesis, lipid IV.sub.A biosynthesis, or chitin biosynthesis.

[0046] The term “amino sugar” relates to a sugar molecule in which a hydroxyl group has been replaced with an amine group such as, but not limited to, GlcNac, ManNAc, GalNAc and Neu5Ac. Derivatives of amine-containing sugars, such as, but not limited to, GlcNac, ManNAc, GalNAc and Neu5Ac, whose nitrogens are part of more complex functional groups rather than formally being amines, are also considered amino sugars.

[0047] The term “saccharide” relates to monosaccharides such as, but not limited to, aldoses, ketoses, pentoses, methylpentoses, hexoses, polyols with or without either carbonyl, carboxyl, amino groups or in which a hydroxyl group is replaced by, but not limited to a hydrogen, amino, thiol, phosphate and/or similar group or a derivative of these groups. The term “saccharide” also relates to di-, oligo-, and polysaccharide that are made up of one or more monosaccharides as described above, linked to each other by a glycosidic bond.

[0048] The term “nucleoside” relates to each monosaccharide that is substituted with a nucleotide, which is, for instance, but not limited to, UDP, GDP, ADP, TDP, CMP, or dTDP.

[0049] The term “glycoside” relates to a saccharide that forms a glycosidic bond with other chemical compounds, such as, but not limited to sterols, phenols, fatty acids, phosphatidylinositols, vitamine C, cartenoides and artimisinine.

[0050] The term “glycolipid” relates to a saccharide that forms a glycosidic bond with a fatty acid or lipid.

[0051] The term “glycoprotein” relates to a saccharide that forms a glycosidic bond with a protein.

[0052] The term “glycosylphosphate” relates to a phosphorylated saccharide.

[0053] The term “glycosylsulphate” relates to a sulfated saccharide.

[0054] More specifically, the present disclosure relates to amino sugar-containing products consisting at least of a homo or hetero-oligosaccharide having one of the following degrees of polymerization: one, two, three, four, five, six, seven, eight, nine or ten.

[0055] The term “cell envelope” refers to a complex multilayered structure that serves to protect these organisms from their environment.

[0056] The term “cell envelope precursors and molecules” refers to all cell envelope components (i.e., proteins, phosphatidylserine, phosphatidylethanolamine, cardiolipin, phosphatidylglycerol, putrescine, spermidine, wall teichoic acid, lipoteichoic acid, (pseudo)peptidoglycan, glycogen, lipopolysaccharide, and/or chitin) and their precursors, i.e., intermediates of the cell wall biosynthesis comprising the peptidoglycan biosynthesis and maturation, peptidoglycan cross-bridge biosynthesis, teichoic acids biosynthesis, UDP-N-acetylmuamoyl-pentapeptide biosynthesis, lipid IV.sub.A biosynthesis, pseudopeptidoglycan biosynthesis and chitin biosynthesis pathway.

[0057] More specifically, this disclosure relates to a metabolically engineered organism as indicated above wherein “genetically modifying” meant essential genes rendered less-functional or non-functional.

[0058] The terms “essential genes” refer to genes of an organism that are critical for its survival, i.e., required to thrive in a given environment. Rendering these genes less-functional or non-functional will result in, e.g., less growth or no growth, respectively.

[0059] The terms “genes that are rendered less-functional or non-functional” refer to well-known technologies for a skilled person (such as siRNA, RNAi, miRNA, asRNA, mutating genes, knocking-out genes, transposon mutagenesis, CRISPR, CRIPRi, promoter engineering, RBS engineering, enzyme engineering, etc.) that are used to change the genes or cognate RNA in such a way that they are less-able (i.e., statistically significantly less-able compared to a functional wild-type enzyme) or completely unable (such as knocked-out gene or inactive enzyme) to produce functional final products, i.e., enzyme (Larson et al., 2013; Perez-Pinera, Kocak, and Vockley 2013; Copeland, Politz, and Pfleger 2014; Maeder et al., 2013; Politz, Copeland, and Pfleger 2013; Farzadfard, Perli, and Lu 2013; Cong et al., 2013; Cheng et al., 2013; Didovyk and Tsimring 2016; Qi et al., 2013; Qi and Arkin 2014; Geert Peters et al., 2015; Tsuda 1998; Cherepanov and Wackernagel 1995; Nevoigt et al., 2006; Palmeros et al., 2000; Bryant et al., 2014; Mutalik et al., 2013; Hoang et al., 1998; Schweizer 2003; Brophy et al., 2016; Kristensen et al., 1995; Hebert, Valdes, and Bentley 2008; Rasmussen, Sperling-Petersen, and Mortensen 2007; Sauer 1987; Agrawal et al., 2003; Datsenko and Wanner 2000; Avihoo et al., 2007; Williams, Luke, and Hodgson 2009; Balbas et al., 1996; Balbas and Gosset 2001; Van Hove et al., 2016; Pitzer et al., 2016; Van Hove et al., 2017; Alper et al., 2005; Alper and Stephanopoulos 2007; Cox, Surette, and Elowitz 2007; Salis 2011; Pirie et al., 2013; Coussement et al., 2014, 2017).

[0060] The terms “gene(s) that is/are rendered less-functional or non-functional” refers to a reduction of the activity of the corresponding gene product(s) with 0.1%, 1%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% to 100%. A gene may be rendered non-functional, i.e., reduced activity of the corresponding gene products with 100%, if there are multiple copies of the gene or isoenzymes present all catalyzing the same chemical reaction.

[0061] The term “(gene) knockout” thus refers to a gene that is rendered non-functional.

[0062] The term “without limiting cell fitness” refers to cells displaying equal or higher cell fitness compared to a cell in which the synthesis or activity of at least one enzyme involved in the endogenous conversion of UDP-GlcNAc to at least one cell envelope precursor or component is not decreased. In other words, wherein the cell fitness is not statistically lower compared to a cell in which the synthesis or activity of at least one enzyme involved in the endogenous conversion of UDP-GlcNAc to at least one cell envelope precursor or component is not decreased. Only when the p-value is <0.01, <0.02, <0.03, <0.04 to <0.05 the hypothesis is rejected that the cell fitness is not lower compared to a cell in which the synthesis or activity of at least one enzyme involved in the endogenous conversion of UDP-GlcNAc to at least one cell envelope precursor or component is not decreased.

[0063] The term “cell fitness” refers to the ability of a cell to thrive in a given environment, an ability determined by a number of parameters, such as cellular growth, product profile and genetic stability.

[0064] The term “cellular growth” refers to the accumulation of mass by a cell and is typically described by the maximal growth rate, maximal biomass yield and lag phase (Birch 1999).

[0065] The term “genetic stability” refers to a zero or low frequency of mutations within the genome or plasmids of a cellular lineage. These mutations may include changes in nucleic acid sequences, chromosomal/plasmid rearrangements or aneuploidy.

[0066] The term “product profile” refers to the pattern and amounts of product synthesized by the cell.

[0067] Even more specifically, the inhibitors of the enzymes of the (pseudo)peptidoglycan biosynthesis or UDP-N-acetylmuramoyl-pentapeptide biosynthesis, lipid IV.sub.A biosynthesis, or chitin biosynthesis are selected from but not limited to the group consisting of fosfomycin, bacitracin, cycloserine, vancomycin, teicoplanin, ramoplanin, an avenaciolide, a peptide inhibitor pyrazolopyrimidine, tulipaline B, cnicin, benzothioxalone, nitrovinylfuran, β-lactams, penicillins, penems, carbapenems, cephems, cephalosporins, cephamycins, monobactams, β-lactamase inhibitors, cefsulodin, ampicillin, carbenicillin, tyrothricin, teixobactin.

[0068] Additionally, the enzymes involved in the (pseudo)peptidoglycan biosynthesis, UDP-N-acetylmuramoyl-pentapeptide biosynthesis, lipid IV.sub.A biosynthesis, or chitin biosynthesis are selected from but not limited to the group consisting of a UDP-N-acetylglucosamine 1-carboxyvinyltransferase, a UDP-N-acetylenolpyruvoylglucosamine reductase, a UDP-N-acetylmuramate-L-alanine ligase, glutamate racemase, UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopimelate ligase, phospho-N-acetylmuramoyl-pentapeptide-transferase, N-acetylglucosaminyl transferase, UDP-3-O-acyl-N-acetylglucosamine deacetylase, UDP-N-acetylglucosamine acyltransferase, tetraacyldisaccharide 4′-kinase, lipid A disaccharide synthase, UDP-2,3-diacylglucosamine diphosphatase, UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase, or (polymer) chitin synthase.

[0069] Additionally, the enzymes involved in the (pseudo)peptidoglycan biosynthesis, UDP-N-acetylmuramoyl-pentapeptide biosynthesis, lipid IV.sub.A biosynthesis, or chitin biosynthesis is encoded by a gene selected from but not limited to the group consisting of murAA, murAB, inel, murZ, murA, murA1, murA2, murA 1, murA 2, murA-1, murA-2, murA3, murA5, murA22, murA.1, murA.2, murA2-1, murAA_1, murAA_2, Cgl0352, Cgl2558, sle_17140, sle_43250, nurZ, murB, murB1, murB2, murB-1, murB-2, murB_1, murB_2, Cgl0353, murB_[H], XOO2101, sle_29960, murC, murC1, murC2, murC-1, murC-2, murC_1, murC_2, XOO3603, murC_[H], sle_16170, murC_dd1A, murC-dd1A, murC_dd1, mp1, mudD, murE_1, murD, murD1, murD2, murD_1, murD_2, murD_[H], murE, murE1, murE2, murE3, murE-1, murE-2, murE.1, murE.2, murE_1, murE_2, murE_[H], mure, XOO3608, ylbD, sle_50520, murT, mur, murF_1, murC, murC2, murD2, murF, murF1, murF2, murF_1, murF_2, murf, mraY, XOO3607, STY0144, Cgl2162, sle_50530, alr, murfF, murfEF murf_[H], murE, murE_1, murC_dd1A, murC-dd1A, murC, murC_ddl, mudD, murB, murF/mraY, rfe, XOO3606, murX, MRAY, murX mraY, murY, mraY1, mraY2, mraY-1, mraY-2, mraY 1, mraY 2, sle 50540, Rfe,/murG, murG1, murG2, murG3, murG_1, murG_2, murG_3, murG_[H], sle 50570, murM, murM.1, murM.2, murMl, murM2, femB, fibA, murM fibA, femX, murN, murN1, femA, femB fibB, femX, fmhB, femA, femA_1, femA_2, femB, femB-2, murI, murI1, murI2, murI3, murI5, murI_1, murI_2, racE, racE1, racE2, yrpC, glr, sle_60800, 1pxA, 1pxK, ycaH, 1pxB, pgsB, 1pxH, ybbF, 1pxD, omsA, firA, hipA, ssc, 1pxC, asmB, envA, chs2, kkv, Chs1, Chs2, CS-2, CHS, CHS1, CHS2 CHS3, CHS8, CHS2.2, CHS5, CHS6, or CHS7.

[0070] Additionally, the expression of the genes is altered so that the mid-exponential average calibrated normalized relative quantity (CNRQ) varies from -3.50×10.sup.−1 to 2.00×10.sup.−1 log(CNRQ). This corresponds with a variance in relative expression from 35% to 95% of the endogenous expression of the genes. The latter variation in expression is obtained by, but not limited to, the use of a constitutive promoter to control transcription and a 5′-UTR to control translation selected from but not limited to the group consisting of:

TABLE-US-00001 (SEQ ID NO: 1) 5′- ATTTATAAATTTCTTGACACAGCATCGGAACTACCCTATAATGT GTACATAAACACAAGCTCAACATATACTAGACAAAGTCAGGC, (SEQ ID NO: 2) 5′- ATTTATAAATTTCTTGACAACTAACACTACAGAGATTATAATGT GTACATAAACACAAGCTCAACATATACTAGACAAAGTCAGGC, (SEQ ID NO: 3) 5′- ATTTATAAATTTCTTGACATTTTGGAATAGATGTGATATAATGT GTACATAAACACAAGCTCAACCTATACTAGAGAAGTCAGGC, (SEQ ID NO: 4) 5′- ATTTATAAATTTCTTGACATATAGTAGATATCACCATATAATGT GTACATAAACACAAGCTCATCCTATACTAGAGGAAGTCAGGC,  and (SEQ ID NO: 5) 5′- ATTTATAAATTTCTTGACAGGACGTCGCCAGCGCGCTATAATGT GTACATAAACACAAGCTCATCCTATACTAGAGGAAGTCAGGC.

[0071] The present disclosure further relates to an organism as indicated above wherein the organism is further genetically modified so that at least one other gene than any of the altered genes of the organism is introduced and wherein the other gene encodes for a carbohydrate synthase, glycosyl transferase and/or epimerase, so that the organism is capable to convert UDP-GLcNAc to a saccharide, nucleoside, glycoside, glycolipid, glycoprotein, glycosylphosphate and/or glycosylsulphate.

[0072] More specifically, the present disclosure relates to a metabolically engineered organism as indicated above, wherein the UDP-GlcNAc derived nucleoside are selected from but not limited to the group consisting of UDP-GalNAc, UDP-ManNAc, and CMP-N-acetylneuraminic acid (CMP-Neu5Ac).

[0073] More specifically, the present disclosure relates to a metabolically engineered organism as indicated above wherein the “carbohydrate synthase, glycosyltransferase and/or epimerase” is selected from but not limited to the group consisting of UDP-N-acetylglucosamine 2-epimerase, UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase, UDP-N-acetylglucosamine 2-epimerase, UDP-N-acetyl-D-glucosamine 6-dehydrogenase, UDP-N-acetylglucosamine 4-epimerase, β-polysaccharide synthases, chitin synthase, N-acetylglucosaminyltransferase, β-1,4-N-acetyl.sub.glucosaminyltransferase, Nodulation protein C (NodC), NodC-like enzyme, chitooligosaccharide synthase, N-acyltransferase nodulation protein, hyaluronan synthase, glycosyl transferase family 2, N-acylmannosamine kinase, sialic acid synthase, N-acylneuraminate-9-phosphatase, N-acetylneuraminate synthase, N-acylneuraminate/3 -deoxy-D-glycero-D-galacto-nononate cytidylyltransferase, hyaluronic acid synthase, β-1,3 -galactosyl-N-acetylhexosamine phosphorylase, β-1,3-N-acetylglucosaminyltransferase, sialyltransferase, 2,3-sialyltransferase, 2,6-sialyltransferase, 2,8-sialyltransferase, N-acetylmannosamine transferase, N-acetylmannosaminyltransferase N-acetylgalactosamine transferase, N-acetylgalactosaminyltransferase and 0-1,3-galactosyltransferase.

[0074] Additionally, the enzymes with carbohydrate synthase, glycosyltransferase and/or epimerase activity is encoded by a gene selected from the group gne, siaA, wecB, rffE, wbpA, udg, tuaD, wecC, vipAl, capL, wblA, wbpP, vipB, tviC, wbgU, strE, galE, wbtF, ispL, CHS, NodC, chs, nodBC, nodCB, nanE, nanK, nanEK, nanS, nanP, neuA, neuB, neuC, manA, GNE, gnal, sir1975, hasA, lnpA, lgtA and wbgO.

[0075] More specifically, the present disclosure relates to a metabolically engineered organism as indicated above wherein the “carbohydrate synthase, glycosyltransferase and/or epimerase” is selected from but not limited to the group consisting of UDP-N-acetylglucosamine 2-epimerase, UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase, UDP-N-acetylglucosamine 2-epimerase, UDP-N-acetyl-D-glucosamine 6-dehydrogenase, UDP-N-acetylglucosamine 4-epimerase, β-polysaccharide synthases, chitin synthase, N-acetylglucosaminyltransferase, β-1,4-N-acetylglucosaminyltransferase, Nodulation protein C (NodC), NodC-like enzyme, chitooligosaccharide synthase, N-acyltransferase nodulation protein, glycosyl transferase family 2, N-acylmannosamine kinase, sialic acid synthase, N-acylneuraminate-9-phosphatase, N-acetylneuraminate synthase, N-acylneuraminate/3-deoxy-D-glycero-D-galacto-nononate cytidylyltransferase, β-1,3 -galactosyl-N-acetylhexosamine phosphorylase, β-1,3-N-acetylglucosaminyltransferase, sialyltransferase, 2,3-sialyltransferase, 2,6-sialyltransferase, 2,8-sialyltransferase, N-acetylmannosamine transferase, N-acetylmannosaminyltransferase N-acetylgalactosamine transferase, N-acetylgalactosaminyltransferase and β-1,3-galactosyltransferase.

[0076] Additionally, the enzymes with carbohydrate synthase, glycosyltransferase and/or epimerase activity is encoded by a gene selected from the group gne, siaA, wecB, rffE, wbpA, udg, tuaD, wecC, vipAl, capL, wblA, wbpP, vipB, tviC, wbgU, strE, galE, wbtF, ispL, CHS, NodC, chs, nodBC, nodCB, nanE, nanK, nanEK, nanS, nanP, neuA, neuB, neuC, manA, GNE, gnal, sir1975, lnpA, lgtA and wbgO.

[0077] More specifically, the present disclosure relates to a metabolically engineered organism as indicated above wherein the enzymes with carbohydrate synthase, glycosyltransferase and/or epimerase activity are highly selective towards a single donor sugar or sugar-nucleotide to generate the product (De Bruyn, Maertens, et al., 2015). Additionally, the enzyme has a sugar donor specificity or sugar-nucleotide donor specificity of 70%, 75%, 80%, 85%, 90%, 95% to 100%

[0078] An example of the latter metabolically engineered organism is an organism wherein the endogenous UDP-N-acetylglucosamine 1-carboxyvinyltransferase expression is decreased with 5% to 65% by altering the endogenous promoter and 5′-UTR sequence with (but not solely) SEQ ID NOS:1-5, and wherein a gene encoding for a N-acetylglucosamine transferase possibly (but not solely) originating from Pseudomonas sp., Frankia symbiont, Ensifer sp., Streptomyces sp., or rhizobia such as Rhizobium sp., Azorhizobium sp., Mesorhizobium sp., Sinorhizobium sp., Bradyrhizobium sp., Neorhizobium sp., Rhizobiales sp., Paraburkholderia sp., Methylobacterium sp., and Cupriavidus sp. is expressed having an amino acid sequence given by (but not solely) SEQ ID NOS:6-8, or, a fragment thereof having a chitooligosaccharide synthase activity, or, a variant thereof having a sequence identity of at least 75% and having a chitooligosaccharide synthase activity to produce chitooligosaccharides (COS).

[0079] Another example of the latter metabolically engineered organism is an organism wherein the endogenous UDP-N-acetylglucosamine 1-carboxyvinyltransferase expression is decreased with 5% to 65% by altering the endogenous promoter and 5′-UTR sequence with (but not solely) SEQ ID NOS:1-5, and wherein a gene encoding for a UDP-N-acetylglucosamine 2-epimerase and N-acetylneuraminic acid synthase, respectively, possibly (but not solely) originating from Campylobacter jejuni and having an amino acid sequence given by (but not solely) SEQ ID NOS:9 and 10, respectively, or, a fragment thereof having a UDP-N-acetylglucosamine 2-epimerase or N-acetylneuraminic acid synthase activity, respectively, or, a variant thereof having a sequence identity of at least 75% and having a UDP-N-acetylglucosamine 2-epimerase or N-acetylneuraminic acid synthase activity, respectively, to produce N-acetylneuraminic acid (Neu5Ac).

[0080] The present disclosure further relates to an organism as indicated above wherein the organism is further genetically modified so that at least one other gene than any of the altered genes of the organism is rendered less-functional or non-functional and wherein the other gene encodes for an enzyme with hydrolase or lyase activity.

[0081] More specifically, the present disclosure relates to a metabolically engineered organism as indicated above wherein the “hydrolase or lyase” is selected from but not limited to the group consisting of β-D-galactoside galactohydrolase, β-D-galactosidase, lactase, N-acetyl-β-neuraminate lyase, N-acetylneuraminate lyase, N-acetylneuraminic acid aldolase, acetylneuraminate lyase, sialic aldolase, sialic acid aldolase, sialate lyase, N-acetylneuraminic aldolase, neuraminic aldolase, N-acetylneuraminate aldolase, neuraminic acid aldolase, N-acetylneuraminic acid aldolase, neuraminate aldolase, N-acetylneuraminic lyase, N-acetylneuraminic acid lyase, NPL, NALase, NANA lyase, acetylneuraminate pyruvate-lyase, N-acetylneuraminate pyruvate-lyase, chitinase, endochitinase, exo-chitinase, chitinase A, (1->4)-2-acetamido-2-deoxy-beta-D-glucan diacetylchitobiohydrolase, β-N-acetylgalactosaminidase, N-acetyl-β-galactosaminidase; N-acetyl-β-D-galactosaminidase; β-acetylgalactosaminidase; β-D-N-acetylgalactosaminidase; N-acetylgalactosaminidase, β-N-acetyl-D-galactosaminide N-acetylgalactosaminohydrolase, β-N-acetylhexosaminidase, hexosaminidase; β-acetylaminodeoxyhexosidase; N-acetyl-β-D-hexosaminidase; N-acetyl-β-hexosaminidase; β-hexosaminidase; β-acetylhexosaminidinase; β-D-N-acetylhexosaminidase; β-N-acetyl-D-hexosaminidase; β-N-acetylglucosaminidase; hexosaminidase A; N-acetylhexosaminidase; β-D-hexosaminidase, N-acetyl mannosidase, and mannosidase.

[0082] Additionally, the enzymes with activity is encoded by a gene selected from but not limited to the group consisting of lacZ, lacZI, lacZ1, lacZ2, lacZ3, lacZ-1, lacZ-2, lacZ_1, lacZ_2, lacZ_3, lacZ_4, lacZ_5, lacZ_6, lacZ_7, lacZ_8, lacZ_9, lacZ_10, lacZ_11, lacZ_12, lacZ_13, lacZ_14, lacZ_15, lacZ_16, lacZ_17, lacZ_18, lacZ_19, lacZ_20, lacZ_25, lacZ_26, lacZ_28, lacA, LacA2, lacL, lacH, lacM, lacS, LAC4, bga, bgaA, bga2A, bga35A, bgaB, bgaC, bgaE, bgaH, bgaL, bgaM, bgaS, bgaT, bga_1, bga_2, bga1, bga2, bga3, bga4, bga5, bga6, bga7, bga8, bga10, bga11, bga12, bga13, bga14, bga15, bga16, bga17, bga18, bga19, bga20, bgal-1, BGAL17, BGAL2, bbgII, GLB1, GLB1L ,G1b1, glb1, glb11, glb11.L, glb1.L, glb2, Ect3, ebgA, ebgA_3, ebgA_6, Gal, ganA, ganAl, ganA2, ganB, gh2-3, galO, bglY, MgLAC2, MgLAC4, pbg, yesZ, gh2C, nanA, nanA1, nanA2, nanA3, nanA_1, nanA_2, dapA, dapA1, dapA_3, NPL, Npl, npl, npl.L, npl.S, nanH, chiA, chiB, CHIC, NgaP, HEXA, HEXB, HEXDC, and CELF6.

[0083] An example of the latter metabolically engineered organism is an organism wherein the endogenous UDP-N-acetylglucosamine 1-carboxyvinyltransferase expression is decreased with 5% to 65% by altering the endogenous promoter and 5′-UTR sequence with (but not solely) SEQ ID NOS:1-5, and wherein a gene encoding for a N-acetylglucosamine transferase possibly (but not solely) originating from Pseudomonas sp., Frankia symbiont, Ensifer sp., Streptomyces sp., or rhizobia such as Rhizobium sp., Azorhizobium sp., Mesorhizobium sp., Sinorhizobium sp., Bradyrhizobium sp., Neorhizobium sp., Rhizobiales sp., Paraburkholderia sp., Methylobacterium sp., and Cupriavidus sp. is expressed having an amino acid sequence given by (but not solely) SEQ ID NOS:6-8 or a fragment thereof having a chitooligosaccharide synthase activity, or, a variant thereof having a sequence identity of at least 75% and having a chitooligosaccharide synthase activity to produce chitooligosaccharides (COS). Additionally, in the organism, a gene encoding for a chitinase activity given by (but not solely) SEQ ID NOS:11 and 12 is deleted.

[0084] Another example of the latter metabolically engineered organism is an organism wherein the endogenous UDP-N-acetylglucosamine 1-carboxyvinyltransferase expression is decreased with 5% to 65% by altering the endogenous promoter and 5′-UTR sequence with (but not solely) SEQ ID NOS:1-5, and wherein a gene encoding for a UDP-N-acetylglucosamine 2-epimerase and N-acetylneuraminic acid synthase, respectively, possibly (but not solely) originating from Campylobacter jejuni and having an amino acid sequence given by (but not solely) SEQ ID NOS:9 and 10, respectively, or, a fragment thereof having a UDP-N-acetylglucosamine 2-epimerase and N-acetylneuraminic acid synthase activity, respectively, or, a variant thereof having a sequence identity of at least 75% and having a UDP-N-acetylglucosamine 2-epimerase or N-acetylneuraminic acid synthase activity, respectively, to produce N-acetylneuraminic acid (Neu5Ac). Additionally, in the organism, a gene encoding for a β-D-galactoside galactohydrolase activity given by (but not solely) SEQ ID NO:13, and/or a gene encoding for a N-acetylneuraminate lyase activity given by (but not solely) SEQ ID NO:14 is deleted.

[0085] The disclosure further relates to an organism as indicated above wherein the organism is further genetically modified so that at least one other gene than any of the altered genes of the organism is introduced and wherein the other gene encodes for enzymes involved in the UDP-GlcNAc synthesis.

[0086] More specifically, the disclosure relates to a metabolically engineered organism as indicated above wherein the “enzymes involved in the UDP-GlcNAc synthesis” is selected from but not limited to the group consisting of glutamine-fructose-6-phosphate aminotransferase, phosphoglucosamine, glucosamine-1-phosphate acetyltransferase/N-acetylglucosamine-1-phosphate uridyltransferase, N-acetylglucosamine-6-phosphate deacetylase, bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase, UDP-N-acetylglucosamine pyrophosphorylase, a glucosamine-phosphate N-acetyltransferase, a phosphoacetylglucosamine mutase, and a UDP-N-acetylglucosamine diphosphorylase, UDP-N-acetylglucosamine/UDP-N-acetylgalactosamine diphosphorylase.

[0087] Additionally, the enzymes with activity is encoded by a gene selected from but not limited to the group consisting of glmS, glmS1, glmS2, glmS3, glmS4, glmS-1, glmS-2, glmS_1, glmS_2, glmS_3, glmS_4, GLMS, GLMS1, glmS_[H], ybcM, Cgl2271, sle 25030, sle_29260, sle_44510, glmD, glmS/GFPT, frlB, agaS, nagB, nagBII, nagB-II, nagB1, nagB2, nodM, gfpt1, gfpt2, GFPT1, GFPT2, Gfpt1, Gfpt2, gfpt2.L, gfpt1.S, Gfat1, Gfat2, gfat-1, gfat-2, GFAT, gfa1, GFA1, GfaA, GFA_1, GFA_2, ATF1, Dsim_GD18034, Dsim_GD19703, Dsim_GD28973, Lj1 g3v2838100.1, Lj1 g3v2838100.2, Lj1 g3v2838100.3, PORTDRAFT 249106, OS12 g0131100, NCASOA05750, NDAIOK02700, TPHAOG03180, TBLAOH01620, TBLA0I00790, TDELOA02530, KAFROD03180, NEUTE1DRAFT 149837, AO090003001475, AO090003000003, An03 g05940, An18 g06820, AGABIlDRAFT 115602, AGABI2DRAFT 194113, 248.t00008, PC000162.03.0, 21.m02906, Tb07.10C21.470, XOO0678, XOO3696, 53959, TVG0861800, glmM, glmM1, glmM2, glmM_1, glmM_2, glmM_3, glmM-1, glmM-2, glmM [H], glmM(femD), glmM#femD, femD, msrA, mrsA, mrsa, mrsA1, mrsA_2, MrsA, MRSA, X003077, ECS4055, sle 29290, PH1210, ureC, cpsG, cpsG2, cpsG_1, ybbT, manB, manB1, manB2, manB3, pmml, pmm_1, pmmB, pmmC, pgm-1, pgm-2, glmU, glmU1, glmU2, glmU3, glmU_1, glmU_2, glmU_3, glmU-2, glmu1, g1mu3, glmU_[H], GlmU, gluM, gcaD, rfbA, rfbA-4, gcd1, hddC_4, graD2, graD3, graD4, graD6, graD-2, rffH1, rffH2, PH1925, ag1F, uap, UAP1, UAP1L1, Uap1, Uap111, uapl, uap111, uap1.L, uapl.S, uap111.L, QRI1, mmy, Dsim_GD22574, C36A4.4, GlcNAc1pUT1, GlcNAc1pUT2, Lj4 g3v0243980.1, POPTRDRAFT 712364, 0E119C05.25, 0s08 g0206900, pco144375b, NCASOB05930, NDAI0B03240, TPHA0003700, TBLA0B07300, TDELOG02780, KAFROK02470, NEUTE1DRAFT 70531, A0090038000595, An12 g00480, PAAG 06885, AGABI1DRAFT 110647, AGABI2DRAFT 189451, 30.t00023, 138.t00017, PC000356.03.0, 19.m02866, symbB.v1.2.001128.t1, symbB.v1.2.002197.t1, symbB.v1.2.006730.t1, galU, CPj0856, GNA1, gnal, gna-1, Cbr-gna-1, GNPNAT1, gnpnatl, gnpnatl.L, Gnpnatl, GNAT3, NAT2, DsimGD21459, Lj1 g3v4717300.1, Lj1 g3v4753330.1, Lj1 g3v4753340.1, POPTRDRAFT 669373, sJ_08156, Os02 g0717700, Os09 g0488000, NCAS0003940, NDAIOG03270, TPHAOD00540, TBLA0D02580, TDEL0000840, KAFR0003360, NEUTE1DRAFT_92433, A0090120000132, An12 g07840, AGABI1DRAFT_61620, AGABI2DRAFT_229877, 405.t00007, 34.t00022, symbB.v1.2.034394.t1, PGM3, Pgm3, pgm3.L, pgm3, nst, Dsim_GD12708, F21D5.1, DRT101, Lj2 g3v1986460.1, AGM1, PCM1, PAGM1, Os07 g0195400, NCASOF00200, NDAIOK02890, TPHAOM00210, TBLA0G00980, TDEL0G04600, KAFR0L00340, NEUTE1DRAFT_118413, AO090001000429, An18 g05170, SNOG_08065, AGABI1DRAFT 117388, AGABI2DRAFT_214180, PC301892.00.0, symbB.v1.2.021638.t1, and Tb08.25L8.80.

[0088] An example of the latter metabolically engineered organism is an organism wherein the endogenous UDP-N-acetylglucosamine 1-carboxyvinyltransferase expression is decreased with 5% to 65% by altering the endogenous promoter and 5′-UTR sequence with (but not solely) SEQ ID NOS:1-5, and wherein a gene encoding for a N-acetylglucosamine transferase possibly (but not solely) originating from Pseudomonas sp., Frankia symbiont, Ensifer sp., Streptomyces sp., or rhizobia such as Rhizobium sp., Azorhizobium sp., Mesorhizobium sp., Sinorhizobium sp., Bradyrhizobium sp., Neorhizobium sp., Rhizobiales sp., Paraburkholderia sp., Methylobacterium sp., and Cupriavidus sp. is expressed having an amino acid sequence given by (but not solely) SEQ ID NOS:6-8 or, a fragment thereof having a chitooligosaccharide synthase activity, or, a variant thereof having a sequence identity of at least 75% and having a chitooligosaccharide synthase activity to produce chitooligosaccharides (COS). Furthermore, in the organism, a gene encoding for phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase, respectively, possibly (but not solely) originating from Escherichia coli and Corynebacterium glutamicum is expressed having an amino acid sequence given by (but not solely) SEQ ID NOS:15 and 16 and SEQ ID NOS:17-19, respectively, or, a fragment thereof having phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase activity, respectively, or, a variant thereof having a sequence identity of at least 75% and having a phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase activity, respectively.

[0089] Another example of the latter metabolically engineered organism is an organism wherein the endogenous UDP-N-acetylglucosamine 1-carboxyvinyltransferase expression is decreased with 5% to 65% by altering the endogenous promoter and 5′-UTR sequence with (but not solely) SEQ ID NOS:1-5, and wherein a gene encoding for a N-acetylglucosamine transferase possibly (but not solely) originating from Pseudomonas sp., Frankia symbiont, Ensifer sp., Streptomyces sp., or rhizobia such as Rhizobium sp., Azorhizobium sp., Mesorhizobium sp., Sinorhizobium sp., Bradyrhizobium sp., Neorhizobium sp., Rhizobiales sp., Paraburkholderia sp., Methylobacterium sp., and Cupriavidus sp. is expressed having an amino acid sequence given by (but not solely) SEQ ID NOS:6-8 or a fragment thereof having a chitooligosaccharide synthase activity, or, a variant thereof having a sequence identity of at least 75% and having a chitooligosaccharide synthase activity to produce chitooligosaccharides (COS). Furthermore, in the organism, a gene encoding for phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase, respectively, possibly (but not solely) originating from Escherichia coli and Corynebacterium glutamicum is expressed having an amino acid sequence given by (but not solely) SEQ ID NOS:16 and 16 and SEQ ID NOS:17-19, respectively, or, a fragment thereof having phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase activity, respectively, or, a variant thereof having a sequence identity of at least 75% and having a phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine- 1-phosphate N-acetyltransferase activity, respectively. Additionally, in the organism, a gene encoding for a chitinase activity given by (but not solely) SEQ ID NOS:11 and 12 is deleted.

[0090] Another example of the latter metabolically engineered organism is an organism wherein the endogenous UDP-N-acetylglucosamine 1-carboxyvinyltransferase expression is decreased with 5% to 65% by altering the endogenous promoter and 5′-UTR sequence with (but not solely) SEQ ID NOS:1-5, and wherein a gene encoding for a UDP-N-acetylglucosamine 2-epimerase and N-acetylneuraminic acid synthase, respectively, possibly (but not solely) originating from Campylobacter jejuni and having an amino acid sequence given by (but not solely) SEQ ID NOS:9 and 10, respectively, or, a fragment thereof having a UDP-N-acetylglucosamine 2-epimerase and N-acetylneuraminic acid synthase activity, respectively, or, a variant thereof having a sequence identity of at least 75% and having a UDP-N-acetylglucosamine 2-epimerase or N-acetylneuraminic acid synthase activity, respectively, to produce N-acetylneuraminic acid (Neu5Ac). Furthermore, in the organism, a gene encoding for phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine- 1-phosphate N-acetyltransferase, respectively, possibly (but not solely) originating from Escherichia coli and Corynebacterium glutamicum is expressed having an amino acid sequence given by (but not solely) SEQ ID NOS:15 and 16 and SEQ ID NOS:17-19, respectively, or, a fragment thereof having phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase activity, respectively, or, a variant thereof having a sequence identity of at least 75% and having a phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase activity, respectively.

[0091] Another example of the latter metabolically engineered organism is an organism wherein the endogenous UDP-N-acetylglucosamine 1-carboxyvinyltransferase expression is decreased with 5% to 65% by altering the endogenous promoter and 5′-UTR sequence with (but not solely) SEQ ID NOS:1-5, and wherein a gene encoding for a UDP-N-acetylglucosamine 2-epimerase and N-acetylneuraminic acid synthase, respectively, possibly (but not solely) originating from Campylobacter jejuni and having an amino acid sequence given by (but not solely) SEQ ID NOS:9 and 10, respectively, or, a fragment thereof having a UDP-N-acetylglucosamine 2-epimerase and N-acetylneuraminic acid synthase activity, respectively, or, a variant thereof having a sequence identity of at least 75% and having a UDP-N-acetylglucosamine 2-epimerase or N-acetylneuraminic acid synthase activity, respectively, to produce N-acetylneuraminic acid (Neu5Ac). Furthermore, in the organism, a gene encoding for phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase, respectively, possibly (but not solely) originating from Escherichia coli and Corynebacterium glutamicum is expressed having an amino acid sequence given by (but not solely) SEQ ID NOS:15 and 16 and SEQ ID NOS:17-19, respectively, or, a fragment thereof having phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase activity, respectively, or, a variant thereof having a sequence identity of at least 75% and having a phosphoglucosamine mutase and bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase activity, respectively. Additionally, in the organism, a gene encoding for a β-D-galactoside galactohydrolase activity given by (but not solely) SEQ ID NO:13, and/or a gene encoding for a N-acetylneuraminate lyase activity given by (but not solely) SEQ ID NO:14 is deleted.

[0092] The term “organism” as indicated above refers to a microorganism chosen from the list consisting of a bacterium, a yeast, fungus cell or archaea, or, refers to a plant or animal cell. The latter bacterium preferably belongs to the species Escherichia coli, Lactobacillus sp., Corynebacterium sp. or Bacillus sp. The latter yeast preferably belongs to the species Saccharomyces cerevisiae or Pichia sp. The latter archaea preferably belong to the species Sulfolobus sp. or Methanobacter sp.

[0093] The latter engineered organisms may be used to produce, for example, but not limited to, UDP-N-acetylglucosamine, chitin, chitosan, chitooligosaccharide, glycosylated chitooligosaccharide, acylated chitooligosaccharide , sulfated chitooligosaccharide, neomycin, butirosin, an —O-GlcNAcylated molecule, N-acetylglucosamine, heparin, heparin sulfate, heparosan, chondroitin, lacto-N-biose, lacto-N-triose, lacto-N-tetraose, lacto-N-neotetraose, N-acetylmannosamine, N-acetylneuramic acid, a -Neu5Acylated molecule, UDP-N-acetylmannosamine, a -ManAcylated molecule, UDP-N-acetylgalactosamine, a -GalNAcylated molecule, CMP-N-acetylneuraminic acid, 3′-sialyllactose, 6′-sialyllactose, sialyl Lewis X, Sialyl Lewis A, polysialic acid, gangloside, hyaluronic acid, disialyllacto-n-tetraose, 3′-sialyl-3 -fucosyllactose, sialyllacto-N-tetraoses 6′-sialyllactosamine, 3′-sialyllactose, 2′,3-difucosyllactose, 3′-sialyllactose, 6′-sialyllactose, 3′-sialyl-3 -fucosyllactose, sialylated lacto-N-triose, sialylated lacto-N-tetraose, sialylated lacto-N-neotetraose, lacto-N-fucopentaose I, lacto-N-fucopentaose II, lacto-N-fucopentaose III, lacto-N-fucopentaose V, sialyl-lacto-N-tetraose a, sialyl-lacto-N-tetraose b, sialyl-lacto-N-tetraose c, fucosyl-sialyllacto-N-neotetraose a, fucosyl-sialyllacto-N-neotetraose b, fucosyl-sialyllacto-N-neotetraose c, lacto-N-difucohexaose I, lacto-N-difucohexaose II, lacto-N-difucohexaose III, disialyllacto-N-tetraose, fucosyl-disialyllacto-N-tetraose I, disialyl-fucosyllacto-N-tetraose II, monofucosyllactose, monosialyllactose, sialyl-lacto-N-pentaose I, sialyl-lacto-N-pentaose II, sialyl-lacto-N-fucopentaose I, sialyl-lacto-N-fucopentaose II, difucosyllacto-N-hexaose, trifucosyllacto-N-hexaose, difucosyl-p-lacto-N-neohexaose, difucosyl-p-lacto-N-hexaose, difucosyllacto-N-hexaose, monofucosyllacto-N-hexaose II, lacto-N-hexaose, lacto-N-neohexaose, fucosyl-sialyllacto-N-neohexaose, sialylated molecules as amino sugar-containing product.

[0094] It is clear that any methodology known in the art to cultivate micro-organisms, and, to extract and purify specialty products from the cultivation may be employed in the present disclosure.

[0095] The following specific sequences, as indicated above, are part of the present disclosure:

TABLE-US-00002 SEQ ID NO: Sequence 1 Promoter-5′-UTR 1 sequence 5′- atttataaatttcttgacacagcatcggaactaccctataatgtgtacataaacacaagctcaacatatactagaca aagtcaggc 2 Promoter-5′-UTR 2 sequence 5′- atttataaatttcttgacaactaacactacagagattataatgtgtacataaacacaagctcaacatatactagaca aagtcaggc 3 Promoter-5′-UTR 3 sequence 5′- atttataaatttcttgacattttggaatagatgtgatataatgtgtacataaacacaagctcaacctatactagagaa gtcaggc 4 Promoter-5′-UTR 4 sequence 5′- atttataaatttcttgacatatagtagatatcaccatataatgtgtacataaacacaagctcatcctatactagagga agtcaggc 5 Promoter-5′-UTR 5 sequence 5′- atttataaatttcttgacaggacgtcgccagcgcgctataatgtgtacataaacacaagctcatcctatactagag gaagtcaggc 6 The amino acid sequence of N-acetylglucosaminyltransferase from Rhizobium sp. GRH2: mdllntigigavscyallstahksmqtlyaqpkdqssasedfaflpsvdiivpcynenphtfseclasianqdya gklrvyvvddgsanreklervhhtyagdprfdfillrenvgkrkaqiaairgssgdlvlnvdsdstlasdvvtklal kmqnpeigaamgqltasnrndtwltrlidmeywlacneeraaqarfgavmcccgpcamyrrsallslldqye sqffrgkpsdfgedrhltilmlkagfrtdyvpdaiaatvvpdrmgpylrqqlrwarstfrdtllalrllpgldhyitl dvigqnlgplllalavltgvlqvaltatvplwtvmmiasmtmircavaavrarqlrflvfslhtpinlffllpmkay alctlsnsdwlsrsspanktsaggehptteasaggtsgnatplrrlnlardsstvtpagvysdd 7 The amino acid sequence of N-acetylglucosaminyltransferase from Sinorhizobium meliloti: mylldttstaaisiyallltayrsmqvlyarpidgpavaaepvetrplpavdvivpsfnedpgilsaclasiadqdy pgelrvyvvddgsrnreaivrvrafysrdprfsfillpenvgkrkaqiaaigqssgdlvlnvdsdstiafdvvskla skmrdpevgavmgqltasnsgdtwltklidmeywlacneeraaqsrfgavmcccgpcamyrrsalaslldq yetqlfrgkpsdfgedrhltilmlkagfrteyvpdaivatvvpdtlkpylrqqlrwarstfrdtflalpllrglspflaf davgqnigqlllalsvvtglahlimtatvpwwtiliiacmtiircsvvalharqlrflgfvlhtpinlflilplkayalc tlsnsdwlsrysapevpvsggkqtpiqtsgrvtpdctcsgelrrqwshpqfek 8 The amino acid sequence of N-acetylglucosaminyltransferase from Sinorhizobium fredii USDA 191: mdllgttgavaislyaalstaykgmqaiyalptnttaastpvtgsgappsvdvivpcynedpralsaclasiakqd yagelrvyvvddgsgnrnaiipvhdhyacdprfrfilmpknvgkrkaqivairessgdlvlnvdsdttiapdvv tklalkmyspavgaamgqltasnrsdtwltrlidmeywlacneeraaqarfgavmcccgpcamyrrsalllll dkyetqlfrgrpsdfgedrhltilmlnagfrteyvpdaiaatvvpnsmgaylrqqlrwarstfrdtllalrllpgldr yltldvigqnlgplllalsvltglaqlaltatvpwstilmiasmtmvrcgvaafrarelrflgfslhtllnvalllplkay alctlsnsdwlsrgspaaapngvkdspephc 9 The amino acid sequence of N-acetylneuraminic acid synthase from Campylobacter jejuni: mkeikiqniiiseekaplvvpeiginhngslelakimvdaafsagakiikhqthivedemskaakkvipgnak isiyeimqkcaldykdelalkeyteklglvylstpfsraganrledmgvsafkigsgecnnyplikhiaafkkp mivstgmnsiesikptvkilldneipfvlmhttnlyptphnlvrlnamlelkkefscmvglsdhttdnlaclgav vlgacvlerhftdsmhrsgpdivcsmdtkalkeliiqseqmaiirgnneskkaakqeqvtidfafasvvsikdik kgevlsmdniwvkrpglggisaaefenilgkkalrdiendaqlsyedfa 10 The amino acid sequence of UDP-N-acetylglucosamine 2-epimerase from Campylobacter jejuni: mvkkilfitgsradyskikslmyrvqnssefelyifatgmhlsknfgytvkelykngfkniyefinydkyyqtd kalattidgfsryanelkpdlivvhgdrieplaaaivgalnnilvahieggeisgtiddslrhaisklahihlvndefa krrlmqlgedeksifiigspdlellndnkislseakkyydinyenyallmfhpvtteitsiknqadnlvkaliqsn knyiviypnndlgfelilqsyeefknnprfklfpslrfeyfitllknadfiignsscilkealylktagilvgsrqngrl gnentlkvnansdeilkaintihkkqdlfsakleildssklffeylqsgdffklstqkvfkdik 11 The amino acid sequence of endochitinase from Escherichia coli: mklniftksmigmglvcsalpalameawnnqqggnkyqvifdgkiyenawwvsstncpgkakandatnp wrlkrtataaeisqfgntlsceksgsssssnsntpasntpanggsatpaqgtvpsnssvvawnkqqggqtwyv vfngavyknawwvassncpgdaksndasnpwryvraatateisetsnpqsctsapqpspdvkpapdvkpa pdvqpapadksndnyavvawkgqegsstwyviynggiyknawwvgaancpgdakendasnpwryvra atateisqygnpgscsvkpdnnggavtpvdptpetpvtptpdnsepstpadsvndyslqawsgqegseiyhvi fngnvyknawwvgskdcprgtsaensnnpwrlertataaelsqygnpttceidnggvivadgfqaskaysad sivdyndahyktsvdqdawgfvpggdnpwkkyepakawsastvyvkgdrvvvdgqayealfwtqsdnp alvanqnatgsnsrpwkplgkaqsysneelnnapqfnpetlyasdtlirfngvnyisqskvqkvspsdsnpwr vfvdwtgtkervgtpkkawpkhvyapyvdftlntipdlaalaknhnvnhftlafvvskdantclptwgtayg mqnyaqyskikalreaggdvmlsiggannaplaascknvddlmqhyydivdnlnlkvldfdiegtwvadq asierrnlavkkvqdkwksegkdiaiwytlpilptgltpegmnvlsdakakgvelagvnvmtmdygnaicq santegqnihgkcatsaianlhsqlkglhpnksdaeidammgttpmvgvndvqgevfylsdarlvmqdaqk rnlgmvgiwsiardlpggtnlspefhgltkeqapkyafseifapftkq 12 The amino acid sequence of endochitinase from Serratia marcescens: mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecawdpatndakardvv nrltalkahnpslrimfsiggwyysndlgvshanyvnavktpaartkfaqscvrimkdygfdgvdidweypq aaevdgfiaalqeirtllnqqtiadgrqalpyqltiagaggafflsryysklaqivapldyinlmtydlagpwekit nhqaalfgdaagptfynalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygraf kgvsggnggqysshstpgedpypnadywlvgcdecvrdkdpriasyrqleqmlqgnygyqrlwndktktp ylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtgl rytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrla 13 The amino acid sequence of β-galactosidase from Escherichia coli: mtmitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnytypitvnppfvptenptgcysltfnvdeswlqegqtriifdg vnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrwsdgsyledqdmwrmsgifrdvsllhk pttqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrln venpklwsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmde qtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamser vtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedq pfpavpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdqslikyden gnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhw mvaldgkplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenl svtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldndigvseatrid pnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfisrktyridgsgqmaitvdvevasdt phpariglncqlaqvaervnwlglgpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygph qwrgdfqfnisrysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwc qk 14 The amino acid sequence of N-acetylneuraminate lyase from Escherichia coli: matnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereqvleivaeeakgkikl iahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdhyraiidsadglpmvvynipalsgvkltld qintlvtlpgvgalkqtsgdlyqmeqirrehpdlvlyngydeifasgllagadggigstynimgwryqgivkal kegdiqtaqklqtecnkvidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqerg 15 The amino acid sequence of a bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase from Escherichia coli: mlnnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdllkqalkddnl nwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakpqggiglltvklddptgygritren gkvtgivehkdatdeqrqiqeintgiliangadmkrwlakltnnnaqgeyyitdiialayqegreivavhpqrls evegvnnrlqlsrlervyqseqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcvi knsvigddceispytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskaghltylgdaei gdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaagttvtrnvgenalaisrvpqtqke gwrrpvkkk 16 The amino acid sequence of bifunctional UDP-N-acetylglucosamine pyrophosphorylase/Glucosamine-1-phosphate N-acetyltransferase from Corynebacterium glutamicum: msasdfssavvvlaagagtrmksdlqktlhsiggrslishslhaaaglnpehivavighrrdqvgpaysqvaeel drevliaiqeeqngtghavqcamdqlegfegtiivtngdvplltddtlsalldahvevptavtvltmrlddptgyg rivrneegevtaiveqkdasaeipidevnsgvfafdaailrsalaelksdnaggelyltdvlgiargeghpvraht aadarelagyndrvqlaeagaelnrrtviaamrggativdpattwidvevsigrdviihpgtqlkgetvigdrve vgpdttltnmtigdgasvvrthgfdstigenatvgpftyirpgttlgpegklggfvetkkatigrgskvphltyvgd atigeesnigassvfvnydgenkhhttigshvrtgsdtmfiapvtvgdgaysgagtvikddvppgalavsggrq rniegwvqkkrpgtaaaqaaeaaqnvhnqeg 17 The amino acid sequence of L-glutamine-D-fructose-6-phosphate aminotransferase from Escherichia coli: mcgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaeehplhggtgiahtr wathgepsevnahphvsehivvvhngiienheplreelkargytfvsetdteviahlvnwelkqggtlreavlr aipqlrgaygtvimdsrhpdtllaarsgsplviglgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktg aevkrqdiesnlqydagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglrlskelgylgslaicnvp gsslvresdlalmtnagteigvastkafttqltvllmlvaklsrlkgldasiehdivhglqalpsrieqmlsqdkrie alaedfsdkhhalflgrgdqypialegalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklk snieevrarggqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprnlaks vtve 18 The amino acid sequence of L-glutamine-D-fructose-6-phosphate aminotransferase from Escherichia coli with mutations A38T, R249C and G471S: mcgivgaiaqrdvaeilleglrrleyrgydsaglavvdteghmtrlrrlgkvqmlaqaaeehplhggtgiahtrw athgepsevnahphvsehivvvhngiienheplreelkargytfvsetdteviahlvnwelkqggtlreavlrai pqlrgaygtvimdsrhpdtllaarsgsplviglgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgae vkrqdiesnlqydagdkgiychymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilacgts ynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglrlskelgylgslaicnvpgss lvresdlalmtnagteigvastkafttqltvllmlvaklsrlkgldasiehdivhglqalpsrieqmlsqdkriealae dfsdkhhalflsrgdqypialegalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnie evrarggqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprnlaksvtve 19 The amino acid sequence of L-glutamine-D-fructose-6-phosphate aminotransferase from Corynebacterium glutamicum: mcgivgyigqagdsrdyfaldvvveglrrleyrgydsagiaihangeisyrkkagkvaaldaeiakaplpdsil gightrwathggptdvnahphvvsngklavvhngiienfaelrselsakgynfvsdtdtevaasllaeiyntqan gdltlamqltgqrlegaftllaihadhddrivaarrnsplvigvgegenflgsdvsgfidytrkavelandqvvtita ddyaitnfdgseavgkpfdvewdaaaaekggfgsfmekeihdqpaavrdtlmgrldedgklvldelrideail rsvdkivivacgtaayagqvaryaiehwcriptevelahefryrdpilnektlvvalsqsgetmdtlmavrhare qgakvvaicntvgstlpreadaslytyagpeiavastkaflaqitasyllglylaqlrgnkfadevssildslrempe kiqqvidaeeqikklgqdmadaksvlflgrhvgfpvalegalklkeiaylhaegfaagelkhgpialveegqpi fvivpsprgrdslhskvvsniqeirargavtiviaeegdeavndyanfiiripqaptlmqpllstvplqifacavat akgynvdqprnlaksvtve 20 The codon optimized nucleotide sequence encoding SEQ ID NO: 6 for expression in E. coli: atggacctgctgaacacgattggtattggtgctgtctcctgctacgctctgctgtcaacggctcataagtcgatgcaa accctgtatgcccagccgaaagatcaaagctctgcatcagaagactttgctttcctgccgtcggtggatattatcgttc cgtgttataacgaaaatccgcatacctttagcgaatgcctggcgtctattgccaaccaggattatgcgggcaaactg cgtgtgtacgtggttgatgacggtagtgccaatcgtgaaaagctggaacgcgttcatcacacctacgcaggcgatc cgcgttttgacttcatcctgctgcgtgaaaacgtgggtaagcgtaaggcacagattgcagcaatccgtggcagttcc ggtgatctggtgctgaatgttgatagcgactctaccctggcatcagacgtcgtgacgaaactggctctgaagatgca gaacccggaaattggcgcagctatgggtcaactgaccgcgtctaaccgtaatgatacctggctgacgcgcctgatc gacatggaatattggctggcctgtaatgaagaacgtgcagcacaggcacgttttggtgcagtgatgtgctgttgcgg tccgtgcgcaatgtatcgtcgctcagctctgctgtcgctgctggatcagtacgaaagccaatttttccgtggcaaacc gtctgattttggtgaagaccgccatctgaccattctgatgctgaaggcgggcttccgtacggattatgttccggacgc catcgcagctaccgttgtcccggatcgtatgggtccgtacctgcgccagcaactgcgttgggcacgcagcaccttc cgtgatacgctgctggctctgcgtctgctgccgggtctggatcactatattacgctggacgttatcggtcagaacctg ggtccgctgctgctggcactggctgtcctgaccggtgtcctgcaagtggcactgaccgctacggtcccgctgtgga ccgtgatgatgattgcatcaatgacgatgatccgttgtgcagttgcagcagtccgtgcacgtcagctgcgctttctgg trnctcgctgcataccccgattaacctgrnttcctgctgccgatgaaagcgtacgccctgtgcacgctgagtaactcc gattggctgagtcgctcatcgccggcgaataaaacctccgccggcggtgaacacccgaccacggaagcaagtgc tggcggtacctccggcaacgcgacgccgctgcgtcgcctgaacctggctcgtgactcctctaccgttaccccggct ggtgtctactccatgattga 21 The codon optimized nucleotide sequence encoding SEQ ID NO: 7 for expression in E. coli: atgtacctgatgacacaaccagcaccgccgctatctcaatctacgcgctgctcttgaccgcctacaggagcatgca agtcctatatgctcggccgatagacggtccagcagtggcggcagaaccggtcgagacccgccctctgccagccg tggatgttatcgtccccagatcaatgaggacccaggcatcctctcggcgtgcctcgcgtccattgcagaccaggat tatcctggagaattgcgagtctatgtcgttgatgatggttctcggaaccgcgaggccattgtgcgtgtacgcgccttct attcgcgcgatccgaggttcagcttcattctgctcccagagaacgtcggaaagcggaaagcgcagattgccgcga taggccaatcctctggggatttggtgctgaatgtcgactcggacagcacgatcgctttcgatgtggtctccaagcttg cctcgaagatgcgagatccagaggtcggtgcggttatgggtcaactcacggctagcaattcgggtgacacttggct gactaaattgatcgacatggagtattggcttgcctgtaacgaagaacgcgcggcacagtctcgcttcggtgctgttat gtgttgctgcggcccttgtgctatgtaccgtcggtcggcgctcgcttcgctgcttgaccagtacgaaacgcaactgtt tcgcggtaagccaagcgacttcggtgaggaccgccatctgacgattctcatgttgaaggcaggctttcgaactgag tacgttccagacgccatagtggcaaccgtcgtcccggatacgctgaaaccatatctgcgccaacaactgcgttggg cacgcagcacgttccgtgacacgtttctagcgctccctctgttgcgcggcctcagcccttttctcgcatttgacgcgg tcggacagaatatcgggcaactgttgctcgccctttcggtggtgacgggtcttgcgcatctcataatgaccgccaca gtgccatggtggacaattttgattattgcgtgcatgaccattatacgctgcagcgtcgtagcattgcatgctcgccaac ttagatttcttggcttcgttctgcacacacccatcaacctctttctcatacttccgctgaaagcttatgcgttgtgtacattg tccaatagcgactggctgtcacgctactccgcgccagaagtaccagtcagcgggggaaagcagaccccaattca aacctccggtcgagtgacacctgactgcacttgcagcggcgagctccgtcgacaatggtcacatcctcaatttgaa aaatag 22 The native nucleotide sequence encoding SEQ ID NO: 8: atggatctgcttggcacgaccggcgccgtagccatctccttgtatgcagcactctcgacggcttacaaaggcatgc aagctatatacgctttgccaacaaacaccacagctgcgtcaacgcccgtgaccggctccggtgcaccgccgagc gtggatgttatcgtcccctgctacaatgaggatccgcgcgcgctctcggcgtgcctagcttccattgcaaagcaaga ctacgctggagagttgcgggtctacgtggttgacgacggttctggcaatcgcaacgccatcatacctgtacacgatc attatgcgtgcgacccgaggttccgctttatcctgatgccaaagaacgtcggaaagcgcaaggcgcagattgtcgc aatacgggaatcatcgggagatttggtgctcaacgttgactcggacacgaccattgcgccggacgtagtcacgaa acttgccctgaagatgtacagtcccgcggtcggcgcggcgatgggtcagttgacggccagcaaccgcagcgaca catggctgacgcggttgatcgacatggagtactggctcgcctgcaacgaggaacgagcagcacaggctcgctttg gagccgttatgtgttgctgcggcccgtgtgccatgtaccggcggtccgcactcctattgctgctcgataaatacgag acgcaactgtttcgaggcaggccaagcgacttcggggaagaccgccacctcacaatcctcatgctgaatgcaggc tttcgaaccgagtacgttccggacgccatcgcggcgacggtcgttccaaactcgatgggggcctatctgcgccaa caactgcgctgggcacgcagcacgtttcgcgacacattgctcgcgctccgcctactgccgggccttgatcgctatc ttacgctggacgtgatcggacagaatcttggtccgctgctcctagccctctcggtcctgacggggctagcacagctc gctctgacggccacagtgccttggtcgacgatcctgatgattgcatctatgacaatggtccgctgcggcgtggcgg cgtttcgagcgcgagagctgcgattccttgggttttcgctgcacaccctcctcaacgtcgctctcctgctccccctca aagcatatgcgttgtgcacgttgagcaacagcgactggctgtcgcgtggttccccggctgccgcacccaacggcg taaaggattctcctgaaccccattgctaa 23 The codon optimized nucleotide sequence encoding SEQ ID NO: 9 for expression in E. coli: atgaaagagattaagatccagaatattatcatcagcgaagagaaagcgccgctggtggtgccggaaattggcatta accacaacggcagcctggaactggctaagattatggtggatgcaagatgagatgagcaaggcggcgaagaagg tgattcctggcaacgccaagattagcatctatgagatcatgcagaaatgcgcgcttgattataaagatgaactggcg ctgaaagaatataccgagaagttaggtctggtctatctgtcgacgccattctcgcgcgcaggtgccaaccgtctgga agatatgggcgtgtctgccttcaagattggttccggtgaatgtaataattatccactgatcaagcatattgccgcattca agaagccgatgattgtcagcaccggcatgaacagcattgaatctatcaaaccgaccgttaagattctgctggataat gagattccgttcgttctgatgcacaccaccaatctgtatccgacgccgcataacctggttcgcctgaacgcgatgct ggagctgaagaaggagttctcctgtatggttggcctgagcgatcataccaccgataacctcgcctgtcttggcgcg gtggttctcggcgcatgcgtgcttgaacgtcacttcaccgacagcatgcatcgcagcggtccggatatcgtctgctc gatggataccaaggcactgaaggaactgattattcagagcgagcagatggcgattattcgcggcaataacgaatcc aagaaggccgccaagcaggaacaggtgaccatcgacttcgcgttcgcttcggtggtcagtattaaggacatcaag aaaggcgaagtgctgtcaatggacaacatctgggtgaagcgtccaggcttaggcggcatcagtgcggcagaattc gagaacattctcggtaagaaggctctgcgcgatattgagaatgatgcgcagctgagctatgaagacttcgcctgata a 24 The codon optimized nucleotide sequence encoding SEQ ID NO: 10 for expression in E. coli: atggtgaagaagatcctgttcattaccggctcccgcgccgactacagcaaaattaaatcgctgatgtatcgcgtgca gaatagcagcgagtttgagctctatatcttcgccaccgggatgcacctgtcgaaaaacttcggctacaccgtgaag gagctgtataaaaatggctttaaaaacatctacgagttcattaactacgataaatattatcagaccgacaaagcgctg gcgaccaccattgatggcttctcgcgctatgccaacgaactgaaaccggatctgatcgtggtgcacggcgatcgca ttgaaccgctggcagcggcgattgtcggcgcgctgaataatatcctggtggcgcacatcgaaggcggcgagattt ccggcaccatcgacgatagcctccgccacgccatcagcaagctcgcgcatattcatctggttaacgatgaatttgcc aaacgccgcctgatgcagctgggcgaagatgagaaaagcatttttattattggctcgccggacctggaactgctga acgacaataaaatctccctgagcgaagcgaagaaatactacgacatcaattacgaaaactacgccctgttgatgttc catccggtgacgaccgaaatcaccagcatcaagaatcaggcggataacctggtcaaagccctgattcagtcgaac aaaaactatattgtgatttatccgaacaatgatctcggttttgaattgattctgcaaagctatgaagaattcaaaaataac ccgcgctttaagctgttcccgagcctgcgcttcgagtatttcatcacgctgctcaagaacgccgattttatcatcggca acagctcctgcattctgaaagaggcgctgtacctgaaaaccgcgggcattctggtgggcagccgccagaacggc cgcctcggcaatgaaaataccctgaaggtgaacgcgaactccgacgaaattctcaaagcaatcaacaccatccat aaaaaacaggatttgttcagcgcgaaactggagatcctcgacagcagtaaactatattgaatatctgcagagcgg cgacttcttcaaactgtccacccagaaagtgttcaaggacatcaagtga 25 The native nucleotide sequence encoding SEQ ID NO: 11: atgaaattaaatatatttactaaatctatgattggtatggggctggtgtgttccgctctgccagcattggcaatggaagc atggaataaccaacaaggtggtaataaatatcaggttattttcgatggcaaaatttatgaaaatgcctggtgggtttctt ctacaaattgcccgggaaaagcgaaagcaaatgatgcaactaacccgtggcgtttaaagcgtaccgcaacagctg ctgaaattagtcagtttggcaatacactttcctgcgaaaagagcggcagctcatcttatcaaattcaaatacgcctgc atccaatacgccggctaatggcggttcggctacaccagcacagggcactgttccgtctaattcttctgtagttgcctg gaataaacagcagggcggtcagacctggtatgtcgtattaatggtgcggtatataaaaatgcctggtgggtagcct cttctaactgtccgggtgatgcgaaaagcaatgatgccagcaacccatggcgttatgttcgtgccgctacggcaac ggaaatctcagaaaccagtaatccacagtcctgtacttcagcaccacagccttcaccggatgtgaaaccggcaccg gacgttaaaccggctcctgatgttcagccagccccagctgataagtcaaacgacaactatgctgtagtagcctgga aaggtcaggaaggttcttctacatggtacgttatctataacggcggcatttataagaacgcctggtgggtaggcgcg gcaaattgcccaggcgatgcgaaagaaaacgatgccagtaacccatggcgttatgttcgcgcggcaacggcaac agaaatcagccagtatggtaaccctggctcctgttccgttaagccggataataatggcggtgctgtgactccggttg atccaactccggaaacaccggtgaccccaactccggataacagcgagccatcaacaccagcggatagcgttaac gattactcattgcaagcgtggagcggccaggaaggtagcgaaatttaccatgttattttcaatggtaatgtttacaaga acgcctggtgggttgggtctaaagattgcccacggggtaccagcgctgaaaactccaataacccatggcgtctcg agcgtacagctaccgctgcggaattgagtcagtacggtaacccgactacctgtgaaattgataacggcggcgtcat tgttgcggatggtttccaggccagcaaagcgtacagcgcggacagcatcgtagattataacgatgcacattataaa acttctgtcgatcaagacgcatggggctttgtcccgggcggcgataacccgtggaagaaatacgaaccggcgaaa gcatggtccgcatccactgtgtacgtgaaaggtgatcgcgttgttgttgatgggcaggcttatgaagcgctgttctgg acgcaaagtgacaaccctgctctggtggcgaaccaaaacgccaccggtagcaatagccgcccgtggaagccgtt aggtaaggctcagagctatagcaacgaagagctgaataatgcgccgcagtttaatccagaaacgctttatgccagc gatacgctgattcgctttaacggtgtgaactacatttctcagagtaaagtgcagaaagtttctccttctgacagcaacc cgtggcgtgtttttgttgactggaccggaaccaaagagcgcgtaggtacgccgaagaaagcgtggccgaaacac gtttatgcaccgtatgtcgactttacgctgaatacgatcccggatctggctgcgctggctaagaatcataacgtcaac cacttcacgctggcgtttgtggtgagtaaagatgcgaacacctgtctgccgacatggggtaccgcttacggtatgca gaattacgctcagtacagcaaaatcaaagctctgcgtgaggctggcggcgatgtgatgctgtctatcggtggtgcta acaacgctccgctggctgcttcctgtaagaacgtagacgatctgatgcagcattattatgacatcgttgataacctga acctcaaagtcctggacttcgatatcgaaggcacctgggttgcggatcaggcatctattgaacgtcgtaaccttgctg tgaagaaagtgcaggataaatggaagtcagaaggcaaagatattgctatctggtacaccttgccaattctgccgact ggcctgacgccggaagggatgaatgtcctgagcgatgccaaagcgaaaggtgttgagctggcgggtgtgaacgt gatgacaatggactacggtaacgcgatttgtcagtctgcaaataccgaaggccagaacattcacggtaagtgtgca acgtctgcgattgccaacctgcattcacaattgaaaggcctccatcccaataagagcgatgcagaaattgacgctat gatgggtaccacgccgatggttggcgtgaacgacgttcagggcgaggtgttctatctctctgatgctcgtctggtcat gcaggatgcgcagaagcgtaatctcggtatggttggtatctggtcaatcgcgcgcgacctgccgggcggcactaa cctgtctccggaattccacggcctgactaaagaacaggcaccgaagtacgcatttagcgaaatcttcgcgccgttta ctaagcaataa 26 The native nucleotide sequence encoding SEQ ID NO: 12: gtacaggcggcagtgtaatgaaaattcattgttatggtgatttatttcgacttttattctcgaggaaaataaacattaatg gcgacggggaatattcccccattgtaaaaacatccactctggagaaataccatgtccacacgcaaagccgttattgg gtattattttattccgaccaaccaaatcaataattacaccgagaccgatacgtctgtcgtgccattcccggtttccaaca ttacgccggccaaagccaaacagctgacgcacattaacttctcgttcctggatatcaacagcaatctggaatgcgcc tgggatccggccaccaacgacgccaaggcgcgcgatgtggtcaaccgtctgaccgcgctcaaagcgcacaacc ccagcctgcgcatcatgttctccatcggcggctggtactactccaacgatctgggcgtgtcgcacgccaactatgtc aacgcggtgaaaaccccggcgtcgcgcaccaagttcgcccaatcctgcgtgcgcatcatgaaggattacggcttc gacggcgtggacatcgactgggagtacccgcaggcggcggaagtggacggtttcatcgccgcgctgcaggaga tccgcaccttgctgaaccagcaaaccatcgcggacggccgccaggcgttgccgtatcagctgaccatcgccggc gccggcggcgctttcttcctgtcgcgctattacagcaagctggcgcagatcgtcgcgccactcgattacatcaacct gatgacctacgatctggccggcccctgggagaagatcaccaaccaccaggcggcgctgttcggcgacgcggcc gggccgaccttctacaacgcgctgcgcgaagccaatctgggctggagctgggaagagctgacccgcgccttccc cagcccgttcagcctgacggtcgacgccgccgtgcagcaacacctgatgatggaaggcgtgccgagcgccaaa atcgtcatgggcgtgcccttctacggccgcgccttcaagggcgtcagcggcggcaacggcggccagtacagca gccacagcacgccgggcgaagatccgtatccgaacgccgattactggctggtgggctgcgacgagtgcgtgcg cgacaaggatccgcgcatcgcctcctatcgccagctggagcagatgctgcagggcaactacggctatcagcggtt gtggaacgataagaccaaaaccccgtatctgtatcatgcgcagaacgggctgtttgtcacctatgacgatgccgag agatcaaatacaaagcgaagtacatcaagcagcagcagctgggcggcgtaatgttctggcatttggggcaagac aaccgcaacggcgatctgctggccgcgctggatcgctatttcaacgccgcagactacgacgacagccagctgga tatgggcaccggcctgcgatacaccggcgtcggccccggcaacctgcctatcatgaccgcgccggcttatgtgcc gggcaccacttacgcgcagggcgcgctggtgtcctaccaaggctacgtctggcagaccaagtggggttacatca cctcggcgcccggctcagacagcgcctggctgaaggtgggccgcctggcgtaagccgtaaaaaaaccccgtag ccgaatgctgcggggttttcattgagttaaccgtttgattttcgcgtcccttcgtctcaattccttcagttgtggcaccat ggatagccgccatcccgcaccacttcgcggcccatcaggctgtagacatcgcatta 27 The native nucleotide sequence encoding SEQ ID NO: 13: atgaccatgattacggattcactggccgtcgttttacaacgtcgtgactgggaaaaccctggcgttacccaacttaat cgccttgcagcacatccccctttcgccagctggcgtaatagcgaagaggcccgcaccgatcgcccttcccaacag ttgcgcagcctgaatggcgaatggcgctttgcctggtttccggcaccagaagcggtgccggaaagctggctggag tgcgatcttcctgaggccgatactgtcgtcgtcccctcaaactggcagatgcacggttacgatgcgcccatctacac caacgtgacctatcccattacggtcaatccgccgtttgttcccacggagaatccgacgggttgttactcgctcacattt aatgttgatgaaagctggctacaggaaggccagacgcgaattatttttgatggcgttaactcggcgtttcatctgtggt gcaacgggcgctgggtcggttacggccaggacagtcgtttgccgtctgaatttgacctgagcgcatttttacgcgcc ggagaaaaccgcctcgcggtgatggtgctgcgctggagtgacggcagttatctggaagatcaggatatgtggcg gatgagcggcattttccgtgacgtctcgttgctgcataaaccgactacacaaatcagcgatttccatgttgccactcg ctttaatgatgatttcagccgcgctgtactggaggctgaagttcagatgtgcggcgagttgcgtgactacctacgggt aacagtttctttatggcagggtgaaacgcaggtcgccagcggcaccgcgcctttcggcggtgaaattatcgatgag cgtggtggttatgccgatcgcgtcacactacgtctgaacgtcgaaaacccgaaactgtggagcgccgaaatcccg aatctctatcgtgcggtggttgaactgcacaccgccgacggcacgctgattgaagcagaagcctgcgatgtcggtt tccgcgaggtgcggattgaaaatggtctgctgctgctgaacggcaagccgttgctgattcgaggcgttaaccgtca cgagcatcatcctctgcatggtcaggtcatggatgagcagacgatggtgcaggatatcctgctgatgaagcagaac aactttaacgccgtgcgctgttcgcattatccgaaccatccgctgtggtacacgctgtgcgaccgctacggcctgtat gtggtggatgaagccaatattgaaacccacggcatggtgccaatgaatcgtctgaccgatgatccgcgctggctac cggcgatgagcgaacgcgtaacgcgaatggtgcagcgcgatcgtaatcacccgagtgtgatcatctggtcgctgg ggaatgaatcaggccacggcgctaatcacgacgcgctgtatcgctggatcaaatctgtcgatccttcccgcccggt gcagtatgaaggcggcggagccgacaccacggccaccgatattatttgcccgatgtacgcgcgcgtggatgaag accagcccttcccggctgtgccgaaatggtccatcaaaaaatggctttcgctacctggagagacgcgcccgctgat cctttgcgaatacgcccacgcgatgggtaacagtcttggcggtttcgctaaatactggcaggcgtttcgtcagtatcc ccgtttacagggcggcttcgtctgggactgggtggatcagtcgctgattaaatatgatgaaaacggcaacccgtggt cggcttacggcggtgattttggcgatacgccgaacgatcgccagttctgtatgaacggtctggtctttgccgaccgc acgccgcatccagcgctgacggaagcaaaacaccagcagcagtttttccagttccgtttatccgggcaaaccatcg aagtgaccagcgaatacctgttccgtcatagcgataacgagctcctgcactggatggtggcgctggatggtaagcc gctggcaagcggtgaagtgcctctggatgtcgctccacaaggtaaacagttgattgaactgcctgaactaccgcag ccggagagcgccgggcaactctggctcacagtacgcgtagtgcaaccgaacgcgaccgcatggtcagaagccg ggcacatcagcgcctggcagcagtggcgtctggcggaaaacctcagtgtgacgctccccgccgcgtcccacgc catcccgcatctgaccaccagcgaaatggatttttgcatcgagctgggtaataagcgttggcaatttaaccgccagt caggctttctttcacagatgtggattggcgataaaaaacaactgctgacgccgctgcgcgatcagttcacccgtgca ccgctggataacgacattggcgtaagtgaagcgacccgcattgaccctaacgcctgggtcgaacgctggaaggc ggcgggccattaccaggccgaagcagcgttgttgcagtgcacggcagatacacttgctgatgcggtgctgattac gaccgctcacgcgtggcagcatcaggggaaaaccttatttatcagccggaaaacctaccggattgatggtagtggt caaatggcgattaccgttgatgttgaagtggcgagcgatacaccgcatccggcgcggattggcctgaactgccag ctggcgcaggtagcagagcgggtaaactggctcggattagggccgcaagaaaactatcccgaccgccttactgc cgcctgttttgaccgctgggatctgccattgtcagacatgtataccccgtacgtcttcccgagcgaaaacggtctgcg ctgcgggacgcgcgaattgaattatggcccacaccagtggcgcggcgacttccagttcaacatcagccgctacag tcaacagcaactgatggaaaccagccatcgccatctgctgcacgcggaagaaggcacatggctgaatatcgacg gtttccatatggggattggtggcgacgactcctggagcccgtcagtatcggcggaattccagctgagcgccggtcg ctaccattaccagttggtctggtgtcaaaaataa 28 The native nucleotide sequence encoding SEQ ID NO: 14: atggcaacgaatttacgtggcgtaatggctgcactcctgactccttttgaccaacaacaagcactggataaagcgag tctgcgtcgcctggttcagttcaatattcagcagggcatcgacggtttatacgtgggtggttcgaccggcgaggcctt tgtacaaagcctttccgagcgtgaacaggtactggaaatcgtcgccgaagaggcgaaaggtaagattaaactcatc gcccacgtcggttgcgtcagcaccgccgaaagccaacaacttgcggcatcggctaaacgttatggcttcgatgcc gtctccgccgtcacgccgttctactatcctttcagctttgaagaacactgcgatcactatcgggcaattattgattcggc ggatggtttgccgatggtggtgtacaacattccagccctgagtggggtaaaactgaccctggatcagatcaacaca cttgttacattgcctggcgtaggtgcgctgaaacagacctctggcgatctctatcagatggagcagatccgtcgtga acatcctgatcttgtgctctataacggttacgacgaaatcttcgcctctggtctgctggcgggcgctgatggtggtatc ggcagtacctacaacatcatgggctggcgctatcaggggatcgttaaggcgctgaaagaaggcgatatccagacc gcgcagaaactgcaaactgaatgcaataaagtcattgatttactgatcaaaacgggcgtattccgcggcctgaaaa ctgtcctccattatatggatgtcgtttctgtgccgctgtgccgcaaaccgtttggaccggtagatgaaaaatatctgcc agaactgaaggcgctggcccagcagttgatgcaagagcgcgggtga 29 The native nucleotide sequence encoding SEQ ID NO: 15: atgttgaataatgctatgagcgtagtgatccttgccgcaggcaaaggcacgcgcatgtattccgatcttccgaaagt gctgcatacccttgccgggaaagcgatggttcagcatgtcattgatgctgcgaatgaattaggcgcagcgcacgtt cacctggtgtacggtcacggcggcgatctgctaaaacaggcgctgaaagacgacaaccttaactgggtgcttcag gcagagcagctgggtacgggtcatgcaatgcagcaggccgcacctttctttgccgatgatgaagacattttaatgct ctacggcgacgtgccgctgatctctgtcgaaacactccagcgtctgcgtgatgctaaaccgcagggtggcattggt ctgctgacggtgaaactggatgatccgaccggttatggacgtatcacccgtgaaaacggcaaagttaccggcattg ttgagcacaaagatgccaccgacgagcagcgtcagattcaggagatcaacaccggcattctgattgccaacggcg cagatatgaaacgctggctggcgaagctgaccaacaataatgctcagggcgaatactacatcaccgacattattgc gctggcgtatcaggaagggcgtgaaatcgtcgccgttcatccgcaacgtttaagcgaagtagaaggcgtgaataa ccgcctgcaactctcccgtctggagcgtgtttatcagtccgaacaggctgaaaaactgctgttagcaggcgttatgct gcgcgatccagcgcgttttgatctgcgtggtacgctaactcacgggcgcgatgttgaaattgatactaacgttatcat cgagggcaacgtgactctcggtcatcgcgtgaaaattggcaccggttgcgtgattaaaaacagcgtgattggcgat gattgcgaaatcagtccgtataccgttgtggaagatgcgaatctggcagcggcctgtaccattggcccgtttgcccg tttgcgtcctggtgctgagttgctggaaggtgctcacgtcggtaacttcgttgagatgaaaaaagcgcgtctgggtaa aggctcgaaagctggtcatctgacttacctgggcgatgcggaaattggcgataacgttaacatcggcgcgggaac cattacctgcaactacgatggtgcgaataaatttaagaccattatcggcgacgatgtgtttgttggttccgacactcag ctggtggccccggtaacagtaggcaaaggcgcgaccattgctgcgggtacaactgtgacgcgtaatgtcggcga aaatgcattagctatcagccgtgtgccgcagactcagaaagaaggctggcgtcgtccggtaaagaaaaagtg a 30 The native nucleotide sequence encoding SEQ ID NO: 16: ttgagcgcaagcgatttctcgagcgcagttgtcgttttggcagctggtgccggaacccgaatgaaatcagacttaca aaaaacgttgcatagcatcggtggacgcagtctcatttcacatagcttgcatgcagctgccgggcttaatcccgagc acattgttgcagtaattggacatggacgcgaccaggtgggtccagccgttgcccaggttgcagaagaactggacc gggaagtcctcatcgctatccaagaggaacaaaatggcacgggacacgctgtgcagtgcgccatggatcagctc gagggattgaaggcacgatcattgtcaccaacggcgatgttcccctgctcaccgaccacactctgtctgcactgct ggatgcacacgtggaagttccaaccgctgtcaccgtgttgaccatgcgtctggatgaccccaccggctacggccg catcgtgcgcaacgaagaaggcgaagtcaccgccatcgttgagcaaaaagatgcttcagcagaagtccaagcca tcgatgaggtcaactccggtgtctttgctttcgacgccgccatcttgcgttccgcactggctgaactgaagtccgaca acgctcagggcgagctgtacctgaccgacgtattgggcattgctcgtggcgagggccacccagtgcgcgcccac accgccgccgatgctcgtgaactcgccggtgtcaacgatcgtgtgcagctcgcagaagccggcgccgaactaaa ccgtcgcaccgtcatcgccgctatgcgtggtggcgcaaccatcgttgatccagcaaccacctggatcgatgtgga ggtttctatcggccgcgacgtgatcatccaccctggcacccagctcaagggcgaaactgtcatcggagaccgcgtt gaagttggtccagacaccaccttgaccaacatgaccatcggcgacggcgcatccgtaatccgcacccacggtttc gactccaccatcggtgaaaacgccaccgttggccccttcacctacatccgcccaggaaccacactgggaccaga aggcaagctcggtggcttcgtagaaaccaagaaggccacaatcggccgtggctccaaggttccacacctcaccta tgtcggcgacgccaccatcggcgaggaatccaacatcggagcctcctctgtcttcgtgaactacgacggtgaaaa caagcaccacaccaccatcggcagccacgttcgcactggttctgacaccatgtttatcgctccagtgaccgtgggt gacggagcgtattccggagccggtacagtaattaaagacgatgttccgccaggagcccttgccgtgtccggcgga cgccaacgaaacatcgaaggctgggtgcaaaagaagcgccctggaaccgctgcagcacaagccgcagaagcc gcccaaaacgtccacaaccaggaaggctaa 31 The codon optimized nucleotide sequence encoding SEQ ID NO: 16 for expression in Escherichia coli: atgaaaagcgatctgcagaaaacgctgcactctatcggtggccgcagcctgatttctcacagcctgcacgccgctg cgggtctgaacccggaacacatcgttgcggttattggtcacggtcgtgatcaggtgggtccggctgttgcgcaggtt gcagaagaactggaccgtgaagtgctgatcgctatccaagaagaacagaacggcaccggccacgctgtccagtg cgcaatggatcagctggaaggtttcgaaggcactatcatcgttactaacggtgacgtgccactgctgactgatcata ccctgtctgctctgctggacgctcacgttgaagtcccgaccgctgttactgttctgaccatgcgtctggacgatccga ctggctacggccgcatcgtacgtaatgaagagggcgaagtcactgcaattgttgagcagaaagatgcgtctgccg aagttcaggcgatcgatgaagtaaactccggcgttttcgcgttcgatgccgcgattctgcgcagcgctctggcaga gctgaaatccgataacgcgcagggtgaactgtacctgaccgacgttctgggcatcgcccgtggcgaaggtcaccc ggttcgcgcacacactgctgcagacgctcgtgaactggcgggtgttaacgacgtgttcagctggccgaagctggt gcagagctgaaccgtcgtacggttatcgcggctatgcgtggcggtgctacgatcgtggacccagctactacttgga tcgatgtggaagtttctattggtcgtgacgtaatcatccacccgggtacccaactgaaaggtgaaacggtaatcggt gatcgtgttgaggttggtccggacaccaccctgactaatatgaccatcggcgacggcgcgagcgttatccgcactc acggctttgattctactatcggcgaaaacgccaccgttggtccattcacctatattcgtccaggcactactctgggtcc ggaaggcaaactgggcggtttcgttgaaactaagaaagctactatcggtcgtggtagcaaagtgccgcatctgacg tacgttggcgatgctaccatcggcgaggaatccaacatcggtgcaagcagcgtctttgtgaattatgacggtgaaaa caaacaccacaccacgatcggttcccatgttcgtaccggctctgataccatgttcatcgcaccggtcaccgtgggtg atggcgcatactccggcgcgggtaccgtgatcaaggacgacgtgccaccgggtgcactgcgtgtttccggtggc cgccagcgtaacatcgaaggttgggttcagaaaaaacgtccaggtaccgcggcggcccaggccgctgaagctg ctcaaaacgttcacaaccaggaaggttga 32 The native nucleotide sequence encoding SEQ ID NO: 17: atgtgtggaattgttggcgcgatcgcgcaacgtgatgtagcagaaatccttcttgaaggtttacgtcgtctggaatac cgcggatatgactctgccggtctggccgttgttgatgcagaaggtcatatgacccgcctgcgtcgcctcggtaaagt ccagatgctggcacaggcagcggaagaacatcctctgcatggcggcactggtattgctcacactcgctgggcgac ccacggtgaaccttcagaagtgaatgcgcatccgcatgtttctgaacacattgtggtggtgcataacggcatcatcg aaaaccatgaaccgctgcgtgaagagctaaaagcgcgtggctataccttcgtttctgaaaccgacaccgaagtgat tgcccatctggtgaactgggagctgaaacaaggcgggactctgcgtgaggccgttctgcgtgctatcccgcagct gcgtggtgcgtacggtacagtgatcatggactcccgtcacccggataccctgctggcggcacgttctggtagtccg ctggtgattggcctggggatgggcgaaaactttatcgcttctgaccagctggcgctgttgccggtgacccgtcgcttt atcttecttgaagagggcgatattgcggaaatcactcgccgttcggtaaacatcttcgataaaactggcgcggaagt aaaacgtcaggatatcgaatccaatctgcaatatgacgcgggcgataaaggcatttaccgtcactacatgcagaaa gagatctacgaacagccgaacgcgatcaaaaacacccttaccggacgcatcagccacggtcaggttgatttaagc gagctgggaccgaacgccgacgaactgctgtcgaaggttgagcatattcagatcctcgcctgtggtacttcttataa ctccggtatggtttcccgctactggtttgaatcgctagcaggtattccgtgcgacgtcgaaatcgcctctgaattccgc tatcgcaaatctgccgtgcgtcgtaacagcctgatgatcaccttgtcacagtctggcgaaaccgcggataccctggc tggcctgcgtctgtcgaaagagctgggttaccttggttcactggcaatctgtaacgttccgggttcttctctggtgcgc gaatccgatctggcgctaatgaccaacgcgggtacagaaatcggcgtggcatccactaaagcattcaccactcagt taactgtgctgttgatgctggtggcgaagctgtctcgcctgaaaggtctggatgcctccattgaacatgacatcgtgc atggtctgcaggcgctgccgagccgtattgagcagatgctgtctcaggacaaacgcattgaagcgctggcagaag atttctctgacaaacatcacgcgctgttcctgggccgtggcgatcagtacccaatcgcgctggaaggcgcattgaa gttgaaagagatctcttacattcacgctgaagcctacgctgctggcgaactgaaacacggtccgctggcgctaattg atgccgatatgccggttattgttgttgcaccgaacaacgaattgctggaaaaactgaaatccaacattgaagaagttc gcgcgcgtggcggtcagttgtatgtcttcgccgatcaggatgcgggttttgtaagtagcgataacatgcacatcatc gagatgccgcatgtggaagaggtgattgcaccgatcttctacaccgttccgctgcagctgctggcttaccatgtcgc gctgatcaaaggcaccgacgttgaccagccgcgtaacctggcaaaatcggttacggttgagtaa 33 The codon optimized nucleotide sequence encoding SEQ ID NO: 18 for expression in Escherichia coli: atgtgcggtatcgttggtgccatcgcgcagcgtgacgtggctgaaatcctgctggagggtctgcgtcgtctggaata ccgtggctacgacagcgcgggcctggcagttgtcgatactgagggtcatatgacccgtctgcgtcgtctgggtaaa gtacagatgctggcgcaggcagcggaagaacatccgctgcacggcggcaccggtattgcacacacgcgctggg cgacccatggcgaaccgagcgaagtcaacgcacacccgcatgtttctgagcatattgttgtggttcacaacggcat catcgaaaaccacgagccgctgcgtgaagaactgaaagcccgcggttacacctttgtatctgaaacggatactga ggttatcgctcacctggtaaactgggagctgaagcaaggcggcaccctgcgcgaagcggtactgcgtgctattcc acagctgcgtggcgcctatggtaccgttattatggatagccgtcatcctgataccctgctggcagcccgttctggttct ccgctggtaattggcctgggcatgggcgagaactttatcgccagcgaccaactggctctgctgccggttactcgtc gcttcatttttctggaagaaggcgacatcgcagaaatcactcgtcgctccgtgaatatttttgataaaaccggcgctga agtcaaacgtcaggacatcgagtctaacctgcagtacgatgcaggtgacaaaggcatttattgccattatatgcaga aagaaatctacgaacagccgaacgctatcaagaataccctgactggtcgtatctcccacggtcaggttgatctgtcc gaactgggtccgaacgctgacgaactgctgtctaaagtggaacacatccagattctggcgtgcggtactagctaca actccggtatggtttctcgttactggttcgaatctctggctggtatcccgtgcgacgttgaaatcgcgtctgaatttcgtt accgcaaaagcgctgttcgtcgtaacagcctgatgatcaccctgtcccagtctggtgaaaccgctgacaccctggc aggcctgcgcctgagcaaagaactgggttacctgggttctctggcgatctgcaacgtgccgggctcttctctggtgc gcgagtctgacctggcactgatgaccaacgctggcaccgaaatcggcgttgcatctaccaaggccttcaccactca gctgactgtgctgctgatgctggtggctaaactgtctcgtctgaaaggtctggacgcgagcatcgaacacgatatcg ttcacggcctgcaggcgctgccttctcgtatcgaacagatgctgagccaggacaagcgcatcgaagcgctggcg gaagatttctccgacaaacatcatgcgctgttcctgtcccgtggtgaccagtatccgattgctctggaaggcgctctg aaactgaaagaaattagctacatccacgctgaggcatatgctgcaggtgaactgaaacacggcccgctggctctg atcgatgcggacatgccagttatcgttgtagccccgaacaacgagctgctggaaaaactgaaatccaacattgaag aagtgcgcgctcgtggcggccaactgtacgttttcgctgaccaggacgctggttttgttagcagcgataacatgcac attattgaaatgccgcacgttgaagaagttatcgctccgatcttctacaccgttccgctgcagctgctggcataccac gttgctctgatcaaaggtactgacgtggatcagccacgtaatctggctaaaagcgtgactgttgaataa 34 The native nucleotide sequence encoding SEQ ID NO:1 9: atgtgtggaattgttggatatattggccaagcgggcgactcccgtgattactttgctctagatgtagttgttgaaggact acgtcgcctggaataccgcggatatgactccgcaggtattgctattcacgccaatggtgagattagctaccgaaag aaggccggaaaggttgctgcactagatgcagaaatcgctaaagcacctatccagattctattttgggaattggaca cacccgttgggcaactcatggtggcccaaccgatgtcaacgctcacccccacgttgtttccaatggcaagcttgcc gtagtacacaacggcatcatcgaaaactttgcggaactgcgctctgagctttccgctaagggctacaactttgtatcc gataccgataccgaagttgctgcttctttgcttgctgaaatttacaatactcaggcaaacggtgacctcacccttgctat gcagctgaccggtcagcgccttgagggtgctttcaccctgctagctattcatgctgatcacgatgaccgcatcgttg cagctcgtcgtaactctcctttggttatcggcgtcggcgagggcgagaacttcctcggatctgacgtttctggctttatt gattacacccgcaaggctgtagagctggctaatgaccaggttgttaccatcaccgctgatgattacgccatcaccaa ctttgatggatcagaagcagttggcaagcctttcgacgtggagtgggacgctgcagctgctgaaaagggtggcttc ggttccttcatggagaaggaaatccacgatcagccagcagctgttcgcgataccctgatgggccgtcttgatgaag atggcaagctcgttcttgatgagctgcgcatcgatgaagctattctgcgtagtgtcgacaagatcgtcattgttgcttgt ggtactgcagcttatgcaggccaggttgctcgttacgccattgagcactggtgccgcatcccaaccgaggtggagc tggctcacgagttccgttaccgcgacccaatcctcaacgagaagacccttgttgtggcattgtcccagtccggcga gaccatggataccctcatggctgttcgccacgcacgtgagcagggtgccaaggttgttgctatttgtaacactgttgg atccactcttccacgtgaagcagatgcgtccctgtacacctacgctggccctgagatcgctgtggcgtccaccaag gcgttcttggctcagatcactgcttcttacttgcttggcctgtacttggctcagctgcgcggcaacaagttcgctgatg aggtttcttccattctggacagcctgcgtgagatgcctgagaagattcagcaggtcatcgatgcagaagagcagatc aagaagcttggccaagatatggcagatgctaagtctgtgctgttcctgggccgccacgttggtttcccagttgcgctt gagggtgcgttgaagctcaaggagatcgcatacctgcacgctgaaggtttcgctgcaggcgagctcaagcacgg cccaattgctttggttgaggaaggccagccgatcttcgttatcgtgccttcacctcgtggtcgcgattccctgcactcc aaggttgtctccaacattcaggagatccgtgcacgtggcgctgtcaccatcgtgattgcagaggaaggcgatgag gctgtcaacgattacgccaacttcatcatccgcattcctcaggccccaaccctgatgcagcctctgctgtccaccgtg cctctgcagatctttgcgtgcgctgtggcaaccgcaaagggctacaacgtggatcagcctcgtaacctggcaaagt ctgtcaccgtcgaataa

EXAMPLES

Material and Methods

[0096] 1. Chemicals, Oligonucleotides and Molecular Biology

[0097] All reagents were purchased from Sigma-Aldrich (Bornem, Belgium), unless otherwise stated. Agarose and ethidium bromide were purchased from Thermo Fisher Scientific (Erembodegem, Belgium). Standard molecular biology procedures were conducted as described by Sambrook et al. (Sambrook and Russell 2001). Qiagen kits (Hilden, Germany) were used for all DNA preparations. Oligonucleotides were purchased from Integrated DNA Technologies (Leuven, Belgium), genes were purchased from Geneart (Thermo Fisher Scientific, Erembodegem, Belgium). Sequencing services were conducted by Macrogen (Amsterdam, The Netherlands).

[0098] The sequence of the E. coli murA operon was obtained from E. coli K-12 MG1655 complete genome (Genbank access code: NC_000913; MurA, Genbank accession code: NP_417656.1, Table 1). The sequence of the Corynebacterium glutamicum murA operons was obtained from C. glutamicum ATCC 13032 complete genome (Genbank access code: NC_003450).

[0099] The sequence of L-glutamine:D-fructose-6-phosphate aminotransferase was obtained from E. coli (EcGlmS, Genbank accession code: NP418185, Table 1). A mutant GlmS was used, GlmS*54, which contains 3 non-silent mutations, i.e., A38T, R249C and G471S (Deng et al., 2006). The sequence of a fused N-acetylglucosamine-1-phosphate uridyltransferase and glucosamine-1-phosphate acetyltransferase was obtained from Corynebacterium glutamicum (GlmU, Genbank accession code: WP038583267, Table 1).

[0100] The sequence of the oligomer chitin synthase (oCHS) was obtained from Rhizobium sp. GRH2 (NodC, Genbank access code: AJW76243, Table 1).

[0101] The sequence of the UDP-N-acetylglucosamine 2-epimerase, N-acetylneuraminic acid synthase and the CMP-Neu5Ac synthetase were obtained from Campylobacter jejuni strain ATCC 43438 (NeuC, NeuBl, and NeuA, respectively, Genbank access code: AF400048, Table 1) (Fierfort and Samain 2008). The sequence for the a-2,3-sialyltransferase was obtained from Neisseria meningitidis (NST, Genbank accession code: U60660, Table 1).

[0102] The sequence of the β-1,3-N-acetylglucosaminyltransferase was obtained from Neisseria meningitidis (LgtA, Genbank accession code: U25839, Table 1) and β-1,3-galactosyltransferase was obtained from Escherichia coli 055:H7 (WgbO, Genbank accession code: AF461121, Table 1).

TABLE-US-00003 TABLE 1 Sequences of used enzymes SEQ ID NO: Enzyme Protein sequence (Genbank accession code) 35 MurA NP_417656.1 mdkfrvqgpt klqgevtisg aknaalpilf aallaeepve iqnvpklkdv dtsmkllsql gakverngsv hidardynvf capydlvktm rasiwalgpl varfgqgqvs lpggctigar pvdlhisgle qlgatiklee gyvkasvdgr lkgahivmdk vsvgatvtim caatlaegtt iienaarepe ivdtanflit lgakisgqgt driviegver lgggyyrylp drietgtflv aaaisrgkii crnaqpdtld avlaklrdag adievgedwi sldmhgkrpk avnvrtaphp afptdmqaqf tllnlvaegt gfitetvfen rfmhvpelsr mgahaeiesn tvichgvekl sgaqvmatdl rasaslvlag ciaegttvvd riyhidrgye riedklralg aniervkge 36 MurA1 NCgl0345 myaeinggfipegtvrvsgaknsatrllaaalltdevvhlgnfptklvdvehkirfieelggkvhvd hdeqilvvdakdlaaremttdelnipirttyllaaaqigrgeiarvpfpggcaigggpaggrgydlhl mvweqlgckilekddhievtapqgfiggvidfpistvggtenallcasiasgdtkianayitpeitdl iellrrmgaeitvygtsrihvkgragllqgaymdvmpdriealtwivygiisggritvegvpfssm evpfihlekagvdlfrnsssvyitpeclpsgsvqpfelacgthpgvisdmqalfvllglkgagtsrvy dyryperiafveeltnlvsgdklsaeagkitiqgdatfrpgyanstdlrgsmavvlaalcadgkstin nvhmalrgyneldkklrllgadltiregevpsp 37 MurA2 NCgl2470 vkdkflvtggaqlqgavkvygaknsvlklmaaallaegtttltncpeildvplmrdvlvglgcdvti dgstvtittpaelssnadfpavtqfrasvcvlgpltarcgravvslpggdaigsrpldmhqsgleklg attrishgavvaeaeklvganitldfpsvgateniltasvmaegrtvldnaarepeivdlcrmlrsmg aniegegsptitiegvekltptqhevigdrivagtwayaaamtrgditvggiaprylhlpleklkiag akvetyengfrvqmdkqpeatdyqtlpfpgfptdlqpmaiginavsngtsvitenvfesrfrfvde mlrlgadanvdghhvvirgieqlsstsvwssdiragaglvlaalcadgvtevhdvfhidrgypnfv enlqklgatiervss 6 NodC AJW76243 mdllntigigavscyallstahksmqtlyaqpkdqssasedfaflpsvdiivpcynenphtfsecla sianqdyagklrvyvvddgsanreklervhhtyagdprfdfillrenvgkrkaqiaairgssgdlvl nvdsdstlasdvvtklalkmqnpeigaamgqltasnrndtwltrlidmeywlacneeraaqarfg avmcccgpcamyrrsallslldqyesqffrgkpsdfgedrhltilmlkagfrtdyvpdaiaatvvp drmgpylrqqlrwarstfrdtllalrllpgldhyitldvigqnlgplllalavltgvlqvaltatvplwtv mmiasmtmircavaavrarqlrflvfslhtpinlffllpmkayalctlsnsdwlsrsspanktsagg ehptteasaggtsgnatplrrlnlardsstvtpagvysdd 38 LgtA U25839 mqplvsvlicaynvekyfaqslaavvnqtwcnldilivddgstdgtlaiakdfqkrdsrikilaqaq nsglipslnigldelaksggeyiartdaddiaapdwiekivgemekdrsiiamgawlevlseekd gnrlarhhrhgkiwkkptrhediadffpfgnpihnntmimrrsvidgglrynterdwaedyqfw ydvsklgrlayypealvkyrlhanqvsskysvrqheiaqgiqktarndflqsmgfktrfdsleyrqi kavayellekhlpeedferarrflyqcfkrtdtlpagawldfaadgrmrrlftlrqyfgilhrllknr 39 WbgO AF461121 miideaesaesthpvvsvilpvnkknpfldeainsilsqtfssfeiiivancctddfynelkhkvndk iklirtniaylpyslnkaidlsngefiarmdsddishpdrftkqvdflknnpyvdvvgtnaifiddkg reinktklpeenldivknlpykccivhpsvmfrkkviasiggymfsnysedyelwnrlslakikfq nlpeylfyyrlheggstakknlymvmvndlvikmkcffltgninylfggirtiasfiyckyik 40 NeuA AF400048 mslaiiparggskgiknknlvllnnkpliyytikaalnaksiskvvvssdsdeilnyaksqnvdilkr pislaqddttsdkvllhalkfykdyedvvflqptsplrtnihineafnlyknsnanalisvsecdnkil kafvcndcgdlagicndeypfmprqklpktymsngaiyilkikeflnnpsflqsktkhflmdess sldidcledlkkveqiwkk 41 NST U60660 mglkkacltvlclivfcfgifytfdrvnqgernavsllkeklfneegepvnlifcytilqmkvaerim aqhpgerfyvvlmsenrnekydyyfnqikdkaerayffhlpyglnksfnfiptmaelkvksmll pkvkriylaslekvsiaaflstypdaeiktfddgtgnliqsssylgdefsvngtikrnfarmmigdw siaktrnasdehytifkglknimddgrrkmtylplfdaselktgdetggtvrillgspdkemkeise kaaknfkiqyvaphprqtyglsgvttlnspyviedyilreikknphtryeiytffsgaaltmkdfpn vhvyalkpaslpedywlkpvyalftqsgipiltfddkn 9 NeuB1 AF400048 mkeikiqniiiseekaplvvpeiginhngslelakimvdaafsagakiikhqthivedemskaak kvipgnakisiyeimqkcaldykdelalkeyteklglvylstpfsraganrledmgvsafkigsge cnnyplikhiaafkkpmivstgmnsiesikptvkilldneipfvlmhttnlyptphnlvflnamlel kkefscmvglsdhttdnlaclgavvlgacvlerhftdsmhrsgpdivcsmdtkalkeliiqseqm aiirgnneskkaakqeqvtidfafasvvsikdikkgevlsmdniwvkrpglggisaaefenilgkk alrdiendaqlsyedfa 10 NeuC AF400048 mvkkilfitgsradyskikslmyrvqnssefelyifatgmhlsknfgytvkelykngfkniyefiny dkyyqtdkalattidgfsryanelkpdlivvhgdrieplaaaivgalnnilvahieggeisgtiddslr haisklahihlvndefakrrlmqlgedeksifiigspdlellndnkislseakkyydinyenyallmf hpvtteitsiknqadnlvkaliqsnknyiviypnndlgfelilqsyeefknnprfklfpslrfeyfitllk nadfiignsscilkealylktagilvgsrqngrlgnentlkvnansdeilkaintihkkqdlfsakleil dssklffeylqsgdffklstqkvfkdik 17 GlmS NP418185 mcgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaeehplhg gtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvsetdteviahlvn welkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplviglgmgenfiasdqlallpvtr rfifleegdiaeitrrsvnifdktgaevkrqdiesnlqydagdkgiyrhymqkeiyeqpnaikntltg rishgqvdlselgpnadellskvehiqilacgtsynsgmvsrywfeslagipcdveiasefryrksa vrrnslmitlsqsgetadtlaglrlskelgylgslaicnvpgsslvresdlalmtnagteigvastkaftt qltvllmlvaklsrlkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdq ypialegalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarggq lyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprnlaksvtve 16 GlmU WP038583267 msasdfssavvvlaagagtrmksdlqktlhsiggrslishslhaaaglnpehivavighrrdqvgp avsqvaeeldrevliaiqeeqngtghavqcamdqlegfegtiivtngdvplltddtlsalldahvev ptavtvltmrlddptgygrivrneegevtaiveqkdasaeiqaidevnsgvfafdaailrsalaelks dnaqgelyltdvlgiargeghpvrahtaadarelagvndrvqlaeagaelnrrtviaamrggativd pattwidvevsigrdviihpgtqlkgetvigdrvevgpdttltnmtigdgasvvrthgfdstigenat vgpftyirpgttlgpegklggfvetkkatigrgskvphltyvgdatigeesnigassvfvnydgenk hhttigshvrtgsdtmfiapvtvgdgaysgagtvikddvppgalavsggrqrniegwvqkkrpgt aaaqaaeaaqnvhnqeg [0103] 2. Strains

[0104] Escherichia coli TOP10 cells (Invitrogen) were used for the construction of all plasmids. Escherichia coli K12 MG1655 (code: E. coli sWT) was used as the parent for all strain engineering experiments and was obtained from ATCC. Escherichia coli K12 MG1655 ArecA AendA DE3 (code: E. coli sDE3) was used in experiments with pT7 and was carried from Ajikumar et al. (Ajikumar et al., 2010).

[0105] Site-directed chromosomal alterations in E. coli was accomplished by homologous recombination mediated by X-Red recombinase (induced from pKD46) as described by Datsenko and Wanner (Datsenko and Wanner 2000). Linear DNA for homologous recombination was generated by amplifying the FRT flanked antibiotic resistance cassette from the appropriate template (pKD3 or pKD4 for gene deletion, p_P22RBS-cITCmurA for knocking in the translational coupled cassette cITCmurA and p_P22-layY for knocking in lacY under control of P22). Knocking in the translational coupled library was performed identically, with the exception that the linear fragment was amplified directly from the single stranded assembly (SSA) mix. Positive transformants were cured from the antibiotic resistance cassette using FLP recombinase (induced from pCP20). Successful chromosomal integration/deletion was confirmed by colony PCR and subsequent sequencing. All oligonucleotides used are listed in Table 2.

[0106] Chromosomal alteration in C. glutamicum was established using the CRISPR/Cpfl system as described by (Jiang et al., 2017). This system, based on the CRISPR mechanism of Francisella novicida, uses two plasmids (pjYS1 and pJYS2) to perform genomic alterations.

[0107] A list of all used strains is given in Table 3. Genomic sequences of promoter and 5′-UTR regions of the P22RBS-cITCmurA knock-in (sP22) and seven selected mutants from the library (sRND1-sRND7) is given in Table 4.

TABLE-US-00004 TABLE 2 List of used oligonucleotides SEQ ID NO: Oligonucleotides (5′-3′) Construction pIndicator 42 Fw_pR_pIndicator GGTTATTGTCTCATGAGCGGTAGAGTAAC ACCGTGCGTGTTG 43 Fw_pR_pIndicator CTCCTTATGTATTCTCTGGGCAACCATTAT CACC 44 Fw_mKate2_pIndicator CCCAGAGAATACATAAGGAGGTACGACAT GGTTAGC 45 Rv_mKate2_pIndicator CTAGGACTCTTGATCCGGATATAGTTCCTC CTTTC 46 Fw_Backbone_pIndicator CTATATCCGGATCAAGAGTCCTAGGATGC TAGC 47 Rv_Backbone_pIndicator CACGGTGTTACTCTACCGCTCATGAGACA ATAACC p_P22-cITCmurA 48 Fw_cI_LVA_pcITCmurA TCGGAGGAAACAAAGATGAGCACAAAAA AGAAACC 49 Rv_cI_LVA_pcITCmurA ACCATCCTAATGATGGTGGTGATGATGGA GCTACTAAAGCGTAGTTTTCG 50 Fw_murA_pcITCmurA ACCACCATCATTAGGATGGTGGTGATGAT AATGGATAAATTTCGTGTTCAGG 51 Rv_murA_pcITCmurA TTAAGCGGAAGTTATTCGCCTTTCACACGC TC 52 Fw_FRT_CmR_FRT_pcITCmurA GACGCTCAGTGGAACGGAAGCTGAGTTGG CTGCTG 53 Rv_FRT_CmR_FRT_pcITCmurA GCTTGTCTGTAAGCGCCATGGTCCATATGA ATATCC 54 Fw_P22_pcITCmurA TCATATGGACCATGGCGCTTACAGACAAG CTGTGACC 55 Rv_P22_pcITCmurA CTTTTTTGTGCTCATCTTTGTTTCCTCCGAA TTCG p_P22_LacY 56 Fw_LacY_pP22LacY CCGTCGACCTCGAATTCGGAGGAAACAAA GATGTACTATTTAAAAAACACAAACTTTT GG 57 Rv_LacY_pP22LacY GCTGGCACATGTTCTTTAAGCGGAAGTTA AGCGACTTCATTCACC 58 Fw_Backbone_pP22LacY CGTCAGGTGAATGAAGTCGCTTAACTTCC GCTTAAAGAACATGTGCCAGC 59 Rv_Backbone_pP22LacY CCAAAAGTTTGTGTTTTTTAAATAGTACAT CTTTGTTTCCTCCGAATTCG Alteration KO chb 60 Fw_KO_chb GGAATTAATCGCCGGATGCAAGGTTCACG CCGCATCTGGCAAACATCCTCACGTGTAG GCTGGAGCTGCTTC 61 Rv_KO_chb GGCTTGCGGAGTGTCTGGCTGACAGATAA TCGTCGATGAGGGCAGTTTTCATATGAAT ATCCTCCTTAG 62 Fw_control_chb TATTCCCATCCGCGTCTGTTC 63 Rv_control_chb AAGCGCCCAATGTATTCCAGG KO nagZ 64 Fw_KO_nagZ GGCTGGCCGATGACACCTGGCGGCAGCTA TTAATAAAACAATAAGGAGAGCAGTCAGC ATTACACGTCTTGAGCG 65 Rv_KO_nagZ CTGATTCAGACGGGTGCTGATCGCTTTCCA GCGAGCCGAGTCCATCAGTTCCTGCCATA TGAATATCCTCCTTAG 66 Fw_control_nagZ CGGCGCAATTATGGCGTCAG 67 Rv_control_nagZ CGGACTGTTAGAGTCAAAACC KO chiA 68 Fw_KO_chiA TAATTCCTGCGTAGGACTTTTGTTTTGCAG TTTTTACGTCACAAGGGCATATGAATATCC TCCTTAG 69 Rv_KO_chiA GTAGCCCATTGACAAAAAATGCGGCGATA CTGGAAGGTATCGCCAACACGTGTAGGCT GGAGCTGGAGCTGCTTC 70 Fw_control_chiA GAGACTCCCGTATACTTTCTTC 71 Rv_control_chiA CGCCCTTTTTGCATTTGTTG KI cITCmurA 72 Fw-KI-murA AGTGGGCGCGCGATCGCAAACTGAACGGC TTTTGAGCTATGGGCGATTCGGTGGAACG GAAGCTGAGTTG 73 Rv-KI-murA GCGCCAACGCTGACTTTATC Randomization promoter and 5′-UTR upstream of cITCmurA 74 Fw-Backbone-randomization AAGTCAGGCATGAGCACAAAAAAGAAAC C 75 Rv-Backbone-randomization TGTCAAGAAATTTATAAATGAAGC 76 Fw-SSA-randomization TGTGTACATAAACACAAGCTCARCMTATA CTAGASRAAGTCAGGCATGAGCACAAAAA AG 77 Rv-SSA-randomization GTGTTTATGTACACATTATA NNNNNNNNTGTCAAGAAATTTATAAAT KO nanRATEK 78 Fw_KO_nanRATEK TAATGCGCCGCCAGTAAATCAACATGAAA TGCCGCTGGCTCCGTGTAGGCTGGAGCTG CTTC 79 Rv_KO_nanRATEK CAATCCTGTGATAGGATGTCACTGATGAT GTTAATCACACTGACCTTACAGACATATG AATATCCTCCTTAG 80 Fw_control_nanRATEK GTCGCCCTGTAATTCGTAAC 81 Rv_control_nanRATEK TTTATGGTGCGGATGTCGTG qPCR murA 82 Fw_qPCR_murA GCGGGCATCAATATGCACAG 83 Rv_qPCR_murA GATCCAGAACGTCCCGAAAC KO LacZ 84 Fw_KO_lacZ CATAATGGATTTCCTTACGCGAAATACGG GCAGACATGGCCTGCCCGGTTATTAGTGT AGGCTGGAGCTGCTTC 85 Rv_KO_lacZ GTATGTTGTGTGGAATTGTGAGCGGATAA CAATTTCACACAGGAAACAGCTCATATGA ATATCCTCCTTAG 86 Fw_control_lacZ GCGGTTGGAATAATAGCG 87 Rv_control_lacZ CAGGTTTCCCGACTGGAAAG KI prom-LacY 88 Fw_KI_P22LacY TCGCTGAACTTGTAGGCCTGATAAGCGCA GCGTATCAGGCAATTTTTATAATTTAAGCG ACTTCATTCACCTGACG 89 Rv_KI_P22LacY GTATGTTGTGTGGAATTGTGAGCGGATAA CAATTTCACACAGGAAACAGCGTGGAACG GAAGCTGAGTTG 90 Fw_control_KIP22LacY ACGCTTGTTCCTGCGCTTTG 91 Rv_control_KIP22LacY TTATGCTTCCGGCTCGTATG

TABLE-US-00005 TABLE 3 List of all used strains code genotype Reference E. coli sTOPO Escherichia coli One Shot TOP 10 Electro-comp ™ Life Technologies E. coli sWT Escherichia coli K12 MG1655 ATCC E. coli sDE3 Escherichia coli K12 MG1655 ΔrecA ΔendA DE3 (Ajikumar et al., 2010) E. coli s3KO Escherichia coli K12 MG1655 Δchb ΔchiA ΔnagZ E. coli sP22 Escherichia coli MG1655 ibaG:: TT.sub.T7-P22- cITCmurA E. coli sRND Escherichia coli MG1655 ibaG:: TT.sub.T7-PRND- RBSlibrary-cITCmurA E. coli sCOS Escherichia coli sRND + pCOS E. coli sSA Escherichia coli sRND ΔnanRATEK + pSA C. glutamicum Corynebacterium glutamicum 13032 ATCC sWT

TABLE-US-00006 TABLE 4 Genomic sequences of promoter and 5′-UTR regions of the P22RBS-cITCmurA knock-in (sP22) and seven selected mutants from the derived library (sRND1-sRND7) SEQ ID NO: Strain Promoter and 5′-UTR sequence 92 sP22 5′- atttataaatttcttgacattttggaatagatgtgatataatgtgtacatatccatggcggccgctcta gaagaagcttgggatccgtcgacctcgaattcggaggaaacaaag 1 sRND1 5′- atttataaatttcttgacacagcatcggaactaccctataatgtgtacataaacacaagctcaacat atactagacaaagtcaggc 2 sRND2 5′- atttataaatttcttgacaactaacactacagagattataatgtgtacataaacacaagctcaacata tactagacaaagtcaggc 3 sRND3 5′- atttataaatttcttgacattttggaatagatgtgatataatgtgtacataaacacaagctcaacctat actagagaagtcaggc 4 sRND4 5′- atttataaatttcttgacatatagtagatatcaccatataatgtgtacataaacacaagctcatcctat actagaggaagtcaggc 5 sRND5 5′- atttataaatttcttgacaggacgtcgccagcgcgctataatgtgtacataaacacaagctcatcct atactagaggaagtcaggc 93 sRND6 5′- atttataaatttcttgacaaacataggaataaattttataatgtgtacataaacacaagctcaacatat actaggcaaagtcaggc 94 sRND7 5′- atttataaatttcttgacaggaggtgacaattaacctataatgtgtacataaacacaagctcagcat atactagagaaagtcaggc [0108] 3. Plasmids

[0109] All plasmids used in this study are listed in Table 5. All plasmids were constructed using Circular Polymerase Extension Cloning (CPEC) assembly (Quan and Tian 2009). DNA oligonucleotides were purchased from IDT and are listed in Table 2. All E. coli expression vectors contained a pBR322 origin of replication (Prentki and Krisch 1982) except for the pIndicator plasmid that contained a pSC101 origin of replication (Kazuo and Mitsuyo 1984) and for the pHBP plasmid that contained the p15A origin of replication (Selzer et al., 1983). The pIndicator plasmid was provided with a kanamycin resistance marker (Pridmore 1987), p_P22RBS-cITCmurA, p_PRND-cITCmurA and p_P22LacY, with a chloramphenicol resistance marker (Alton and Vapnek 1979), pHBP with a spectinomycin resistance marker (Bose, Fey, and Bayles 2013) and the production plasmids pCOS, pSA, and pLNT with an ampicillin resistance marker (Hedges and Jacob 1974).

[0110] The pCOS production plasmid was based on the pCXhP14-mKATE2 expression vector (origin, antibiotic resistance and P14 promoter and RBS (De Mey et al., 2007; Aerts et al., 2011; Shcherbo et al., 2009)). The sequence of the chitin synthase was obtained from Rhizobium sp. GRH2 (NodC, Genbank accesion code: AJW7624371 (Hamer et al., 2015)). The pSA production plasmid used was constructed as described by Peters et al. (Gert Peters et al., 2018). The pLNT production plasmid was based on the pSA vector (Gert Peters et al., 2018). The CMP-Neu5Ac synthetase was obtained from Campylobacter jejuni strain ATCC 43438 (NeuA, Genbank access code: AF400048) (Fierfort and Samain 2008). The sequence for the a-2,3-sialyltransferase was obtained from Neisseria meningitidis (NST, Genbank accession code: U60660).

[0111] The pIndicator plasmid was provided with a lambda-promoter PR (Ptashne 2004), derived from the pDAWN plasmid (Ohlendorf et al., 2012) that drove the fluorescent mKATE2 reporter (Shcherbo et al., 2009) derived from the in-house pCXhP22-mKATE2 plasmid. The p P22RBS-cITCmurA plasmid was composed of the cI repressor gene with LVA tag, derived from the pDAWN plasmid (Ohlendorf et al., 2012), translationally coupled to the first 1000 bp of the murA coding sequence derived from the E. coli genome. An FRT-site flanked chloramphenicol cassette was cloned from the pKD3 plasmid (Datsenko and Wanner 2000) and the P22 promoter and RBS (De Mey et al., 2007) were derived from the in-house pCXhP22-mKATE2 plasmid. Detailed maps of all plasmids are provided in FIGS. 3A-3E.

[0112] The introduction of degenerated DNA sequences, resulting in the p_PRND-cITCmurA plasmid, was performed using single strand assembly (SSA), as described in the 2-P CPEC protocol of Coussement et al. (Coussement et al., 2017). Oligonucleotidess used for randomization are summarized in Table 2. Sequencing confirmed the full and partial randomization of the promoter and 5′-UTR region, respectively.

[0113] The pHBP plasmid was constructed by golden gate assembly (Coussement et al., 2017) whereby codon optimized glmU from C. glutamicum is controlled by a PTrc promoter (Nielsen and Voigt 2014), with IPTG as inducer, codon optimized glmS*54 is controlled by a PTet promoter, with anhydrinetetracycline (aTc) as inducer (Nielsen and Voigt 2014) and nodC is controlled by the constitutive promoter P14 (De Mey et al., 2007).

[0114] The pCOSCg production plasmid for Corynebacterium glutamicum is based on the pEKEx3 E. coli/C. glutamicum shuttle vector (Stansen et al., 2005). The constitutive P14 promoter (De Mey et al., 2007) controlled the nodC expression. The sequence of the chitin synthase was obtained from Rhizobium sp. GRH2 (NodC, Genbank accesion code: AJW7624371 (Hamer et al., 2015)). The pSACg production plasmid for Corynebacterium glutamicum is based on the pEKEx3 E. coli/C. glutamicum shuttle vector (Stansen et al., 2005). The constitutive P14 promoter (De Mey et al., 2007) controlled the NeuC and NeuB1 expression. The sequence of the UDP-N-acetylglucosamine 2-epimerase and N-acetylneuraminic acid synthase were obtained from Campylobacter jejuni strain ATCC 43438 (NeuC and NeuBl, respectively, Genbank access code: AF400048).

TABLE-US-00007 TABLE 5 Overview of the used, constructed and characterized plasmids Plasmid name Description Reference pKD46 Helper plasmid for genome modification (λ-Red (Datsenko and recombinase) Wanner 2000) pCP20 Helper plasmid for genome modification (FLP (Datsenko and recombinase) Wanner 2000) pKD3 FRT-CmR-FRT (Datsenko and Wanner 2000) pKD4 FRT-KanR-FRT (Datsenko and Wanner 2000) pDAWN pFixK2-cI-PR.sub.lambda-MCS (Ohlendorf et al., 2012) pCXhP22- pBR322-P22-mKATE2 (Aerts et al., 2011; mKate2 Shcherbo et al., 2009) pCXhP14- pBR322-P14-mKATE2 (Aerts et al., 2011; mKate2 Shcherbo et al., 2009) pCOS pBR322-P14-nodC pSA pBR322-PFAB46(mut)-RBS.sub.T7-neuC-neuB1 (Gert Peters et al., 2018) pIndicator pSC101-PR.sub.lambda-mKATE2 p_P22- TT.sub.T7-FRT-CmR-FRT-P22-RBS-cI′-TCC-′murA′ cITCmurA p_PRND- TT.sub.T7-FRT-CmR-FRT-PRND-RBS.sub.library-cI′-TCC- cITCmurA ′murA′ P_P22LacY TT.sub.T7-FRT-CmR-FRT-P22-lacY pHBP p15A-PTrc-glmU-PTet-glmS*54-P14-nodC-lacIq pLNT pBR322-PFAB46(mut)-RBS.sub.T7-neuC-neuB1-P14-nst- neuA pCOSCg pEKE-P14-nodC pSACg pEKE-P14- neuC-neuB1 [0115] 4. Media

[0116] Lysogeni broth (LB) medium consisted of 10 g/L tryptone peptone (Difco, Belgium), 5 g/L yeast extract (Difco) and 10 g/L NaCl and was autoclaved for 21 minutes at 121° C. Luria Bertani Agar (LBA) is similarly composed to LB, be it for the addition of 10 g/L agar. Minimal medium contained 2 g/L NH.sub.4CL, 5 g/L (NH.sub.4).sub.2SO.sub.4, 3 g/L KH.sub.2PO.sub.4, 7.3 g/L K2HPO.sub.4, 8.4 g/L MOPS, 0.5 g/L NaCl, 0.5 g/L MgSO.sub.4.7H.sub.2O, and 16.5 g/L glucose.H.sub.2O or 15.3 g/L glycerol as carbon source, 1 mL/L trace element solution and 100 μL/L molybdate solution. Trace element solution consisted of 3.6 g/L FeCl.sub.2.4H.sub.2O, 5 g/L CaCl.sub.2.2H.sub.2O, 1.3 g/L MnCl.sub.2.2H.sub.2O, 0.38 g/L CuCl.sub.2. 2H.sub.2O, 0.5 g/L CoCl.sub.2. 6H.sub.2O, 0.94 g/L ZnCl.sub.2, 0.0311 g/L H.sub.3BO.sub.4, 0.4 g/L Na.sub.2EDTA. 2H.sub.2O, 1.01 g/L thiamine.HCl. The molybdate solution contained 0.967 g/L Na.sub.2MoO.sub.4.2H.sub.2O. To avoid Maillard reaction and precipitation during sterilization of the shake flask medium, the glucose and magnesium sulphate were autoclaved separately from the remaining salts. Glucose and magnesium sulphate were autoclaved in a 200 mL solution, the remaining salts in an 800 mL solution. Prior to autoclaving, the latter was set to a pH of 7 with 1 M KOH. After autoclaving, these two solutions were cooled down and mixed. Subsequently, the trace element and molybdate solutions were added filter-sterilized with a bottle top filter (Corning PTFE filter, 0.22 μm). If required, the culture medium was supplemented with appropriate antibiotics. Stock concentrations for antibiotics were 100 mg/mL for spectinomycin, 100 mg/mL for ampicillin, 25 mg/mL for chloramphenicol, and 50 mg/L for kanamycin. Antibiotic stocks were diluted 1000× for cell culture experiments. If required, the culture medium was supplemented with inducers.

[0117] Brain Heart Infusion (BHI) medium is used as liquid medium for growth as well as basis for agar medium used when working with C. glutamicum strains. The liquid medium consists of 12.5 g/L brain infusion solids, 5.0 g/L beef heart infusion solids, 10.0 g/L proteose peptone, 2.0 g/L glucose, 5 g/L NaCl and 2.5 g/L disodium phosphate. The mixture is bought ready-made from Sigma-Aldrigh (USA). In case BHI agar is needed 12 g/L agar is added before autoclaving. If required, the culture medium was supplemented with appropriate antibiotics. Stock concentrations for antibiotics were 250 mg/mL for spectinomycin, 5 mg/mL for chloramphenicol, and 25 mg/L for kanamycin. Antibiotic stocks were diluted 1000× for cell culture experiments. If required, the culture medium was supplemented with inducers.

[0118] CGXII medium is used as synthetic medium for C. glutamicum. To make CGXII agar plates 12 g/L agar is added. CGXII medium contained 20 g/L (NH.sub.4).sub.2SO, 1 g/L KH.sub.2PO.sub.4, 1 g/L K.sub.2HPO.sub.4, 0.25 g/L MgSO.sub.4.7H.sub.2O, 10 mg/L CaCl.sub.2, 42 g/L MOPS, 0.2 mg/L Biotin, 1 mL/L Trace elements solution, 1 mL/L 3% Protocatechuic acid solution, 100 mL/L 40% glucose solution. The trace elements solution consisted of 10 g/L FeSO.sub.4.7H.sub.2O, 10 g/L MnSO.sub.4.H.sub.2O, 1 g/L ZnSO.sub.4.7H.sub.2O, 0.2 g/L CuSO.sub.4.5H.sub.2O, 20 mg/L NiCl.sub.2.6H.sub.2O. The glucose solution is made separately and autoclaved. The trace elements solution is made and components are dissolved by adding concentrated HCl until a final pH of about 1 is reached. This solution is sterilized via filter sterilization. The protocatechuatic acid is dissolved in diluted NaOH in H.sub.2O, sterilized via filtration and stored at 4° C. The CGXII medium is made by dissolving all components except the trace elements, glucose and protocatchuate in 798 mL. The solution is brought to pH 7 and sterilized by autoclaving at 121° C. for 21 minutes (1 atm overpressure). After autoclaving the three remaining components are added once the solution is lukewarm. [0119] 5. Culture Conditions, Optical Density (OD) Measurements

[0120] For strain engineering and plasmid construction strains were grown in lysogeny broth (LB) at 30° C. with shaking (200 rpm, LS-X AppliTek orbital shaker, Nazareth, Belgium).

[0121] In vivo library evaluation was performed in 96-well flat-bottomed microtiter plates (MTP, Greiner) at 30° C. with shaking (200 rpm, LS-X AppliTek orbital shaker, Nazareth, Belgium).

[0122] For growth experiments, E. coli and C. glutamicum strains were plated on LBA or BHI agar medium, respectively, with appropriate antibiotics for maintenance and selection of the various plasmids used, incubated for 16 hours at 30° C. and a single colony was used for a preculture. For flask experiments, precultures were grown in 50 ml centrifuge tubes containing 10 ml LB or BHI medium, respectively, with the necessary antibiotic for selection pressure. Pre-cultures were grown overnight (16 hours) at 30° C. and 200 rpm (LS-X AppliTek orbital shaker, Nazareth, Belgium) and subsequently, used for 1% inoculation of 100 ml glucose defined medium, i.e., minimal medium or CGXII medium respectively, in 500 ml shake flasks and grown at 30° C. and 200 rpm (LS-X AppliTek orbital shaker, Nazareth, Belgium). At regular intervals, samples for extracellular metabolites analysis were collected and optical density (OD) at 600 nm is determined. For 24-well deep well plates (DWP) experiments, precultures were grown in 50 ml centrifuge tubes containing 10 ml LB or BHI medium, respectively, with the necessary antibiotic for selection pressure. Pre-cultures were grown overnight (16 hours) at 30° C. and 200 rpm (LS-X AppliTek orbital shaker, Nazareth, Belgium) and subsequently, used for 1% inoculation of 3 ml glucose defined medium, i.e., minimal medium or CGXII, respectively, in 24-well DWP plates with sandwich covers (EnzyScreen, Heemstede, The Netherlands) and grown at 30° C. and 200 rpm (LS-X AppliTek orbital shaker, Nazareth, Belgium). In 24-well DWPs, cultures were sampled at regular intervals for extracellular metabolite analysis and OD measurement. OD was measured at 600 nm using a Jasco V-630Bio spectrophotometer (Easton, UK). [0123] 6. Cell Fitness and In Vivo Fluorescence Measurements for Library Evaluation and Strain Characterization

[0124] For screening purposes 276 colonies were picked randomly with an automated colony-picker (QPix2, Genetix) and inoculated into sterile 96-well flat-bottomed microtiter plates (Greiner) enclosed by a sandwich cover (Enzyscreen, Leiden, Netherlands) containing 150 μL minimal medium per well, supplemented with appropriate antibiotics and grown overnight on a Compact Digital Microplate Shaker (Thermo Scientific) at 800 rpm and 30° C. Subsequently, these cultures were 1:200 diluted in 150 μL of fresh minimal medium containing the appropriate antibiotics and were cultured for 24 hours at 30° C. and measured every 20 minutes for fluorescence and optical density using a Tecan M200 infinite PRO (Tecan, Mechelen, Belgium). Excitation and emission wavelengths were 588 and 633 nm respectively. Optical density was measured for biomass correction and for maximal growth rate calculations at a wavelength of 600 nm. Data collection was based on single colony measurements, except for sWT and sWT+strains that were analyzed in triplicate.

[0125] For strain characterization, a similar protocol is adopted with the exception that strains are not randomly picked and 3 biological replicates were analysed (n=3). Strains were analysed using a Biotek Synergy H1 (Biotek, Vermont, USA), excitation, emission and optical density wavelengths were identical. [0126] 7. Culture Conditions for Glycan Biosynthesis

[0127] Chitopentaose biosynthesis experiments were performed in defined medium (minimal medium for E. coli and CGXII medium for C. glutamicum) supplemented with the appropriate antibiotics. Experiments were performed for 24 hours, in triplicate (n=3), in pyramide-bottem square 24-deepwell microplates (0.5 ml) (Enzyscreen, Heemstede, The Netherlands) at 30° C. with shaking (250 rpm/50 mm).

[0128] Sialic acid biosynthesis experiments were performed in defined medium (minimal medium for E. coli and CGXII medium for C. glutamicum) supplemented with the appropriate antibiotics. Experiments were performed for 48 hours, in duplicate (n=2), in 250 ml shake flasks (25 ml) at 30° C. with shaking (250 rpm/50 mm). [0129] 8. UDP-GlcNAc Pool Determination for Strain Characterization

[0130] UDP-GlcNAc was extracted from the wild type strain (sWT) and the seven library strains (sRND1-7) that were cured from their pIndicator plasmid, in 3 biological replicates (n=3) unless stated otherwise. Strains were cultivated in minimal medium until the mid-exponential phase in pytamid-bottom square 24-deepwell microplates (0.5 ml) (Enzyscreen, 150 Heemstede, The Netherlands) at 30° C. with shaking (250 rpm/50 mm). [0131] 9. Sample Preparation

[0132] For chitopentaose biosynthesis, first 0.1 mL broth was diluted 10 times in physiological water for OD600 measurements in a Jasco V-630Bio spectrophotometer (Easton, UK). Subsequently, 0.3 mL broth was centrifuged at 14000 rpm for 10 minutes. The supernatant was stored at −80° C. for the analysis of extracellular metabolites. Pellets were stored at −80° C. until further use. Pellets were resuspended in 100 μL 60% ACN, vortexed and centrifuged at 14000 rpm for 10 minutes. The supernatant was subsequently applied for COS analysis. UDP-GlcNAc samples were prepared identically, but were resuspended in 200 μL 60% ACN before analysis.

[0133] Sialic acid synthesis samples were collected by collecting 2 mL broth, measuring OD600 as described above, and centrifuged at 14000 rpm for 10 minutes. The supernatant was subsequently stored at −80° C. for SA analysis. [0134] 10. HPLC-ELSD/ESI-MS Analysis

[0135] The applied HPLC-ELSD/ESI-MS method was developed based on the methods described (Leijdekkers et al., 2011; Remoroza et al., 2012). Analyses of COS were performed using a Shimadzu HPLC system (Shimadzu, Jette, Belgium) coupled to an evaporative light scattering detector or/and an ESI-MS -detector. COS were separated by hydrophilic interaction chromatography (HILIC) using a Kinetix 2.6 _HILIC 100A column (2.6_m, 4.6 mm×150 mm; Phenomenex, Utrecht, The Netherlands) in combination with an appropriate SecurityGuard ULTRA Cartridge.

[0136] Glycan molecules were analyzed on a Waters ACQUITY UPLC system (Waters, Milford, Mass., USA). Chitopentaose was separated by hydrophilic interaction chromatography (HILIC) using an ACQUITY UPLC BEH Amide 1.7 μm column (2.1×100 mm, Waters) connected to a ELSD detector. Sialic acid was separated by ion exclusion chromatography using a Rezex ROA-Organic Acid H+8 μm column (7.8×300 mm, Phenomenex) connected to a UV-detector. Detailed information is summarized in Table 6. Sialyllactose was separated using an ACQUITY UPLC BEH Amide, 130 A, 1.7 μm column (2.1 mm×50 mm) connected to a ELSD detector. A mixture of 75/25 acetonitrile/water solution with 1% formic acid was used as mobile phase. The flow rate was set to 0.130 mL/minute and the column temperature to 35° C. Lacto-N-tetraose was separated using an)(Bridge UPLC BEH Amide 1.8 μm 2.1×100 mm Column (Waters). Chromatographic conditions involved 1μL sample injection, gradient elution of acetonitrile/water with 0.1% formic acid at 50° C. and at a flow rate of 0.3 ml/minute.

[0137] UDP-GlcNAc analysis was performed on a Dionex ICS-3000 (Thermo Scientific) using a Carbopac PA20 column (Thermo Scientific) and a ICS-5000 electrochemical detector cell (Thermo Scientific). Flow rate was set to 0.5 ml/minute, column temperature at 30° C. 5 μL sample was injected, the elution profile was isocratical and eluent consisted of 500 mM acetic acid and 100 mM NaOH.

TABLE-US-00008 TABLE 6 UPLC details and elution profile for glycan analysis Method Details Time (min) % A % B Chitopentaose Column: Acquity UPLC BEH Amide 0 20 80 Column temperature: 45° C. 2 20 80 ELSD detector: 40° C., Gain 400 7 50 50 Eluens A: 10 mM NH.sub.4-formate in H.sub.2O 7.26 65 35 Eluens B: 100% AcN 7.75 65 35 Injection volume: 1 μL 8.8 20 80 Flow rate (mL/min) 450 10 20 80 Sialic acid Column: Rezex ROA-Organic Acid H+ 0 100 0 Column temperature: ambient 20 100 0 UV-detector 205 nm Eluens A: 5 mM H.sub.2SO.sub.4 Injection volume 1 μL Flow rate (mL/min) 0.200 [0138] 11. TLC Analysis

[0139] The different chitooligosaccharides (fully acetylated chitopentamers, fully acetylated chitotetramers) are analyzed using thin layer chromatography (TLC). The TLC plates used are HPTLC silica gel 60F.sub.254 plates (Merck). The eluent comprises butanol, methanol, 25% NH.sub.3 and H.sub.2O with ratio 5:4:2:1. Spots of 3 μL sample (supernatant) or standard solution are applied to the TLC plate. Next, the TLC plates are placed in the equilibrium tank and the eluent allowed to develop. The plates are then removed from the tank and quickly dried. Subsequently the TLC plate is stained with 30% [w/v] NH.sub.4HSO.sub.4 and heat up till 500° C. to visualize the components under UV-light. The standard solutions are 10 g/L glucose, 10 g/L GlcNAc, and 10 g/L COS mixture (15% fully acetylated chitotetramers (A4), 85% fully acetylated chitopentamers (A5)). [0140] 12. Quantitative PCR

[0141] Quantitative PCR was performed on the wild type strain (sWT) and the seven library strains (sRND1-7) that were cured from their pIndicator plasmid. Measuring the expression levels, RNA was isolated from 3 biological replications (n=3); mid-exponentially growing E. coli cells using RNA later in combination with a RNeasy Mini Kit (QIAGEN, Hilden, Germany). mRNA was subsequently stored at −80° C. until further use.

[0142] DNA was synthesized using a First Strand cDNA synthesis kit with random hexamers (Thermo Scientific). For the amplification of the three E. coli reference genes (cysG, hcaT and idnT) oligos were ordered as described in Zhou et al. (Zhou et al., 2011). QPCR oligos for murA are charted in Table 2.

[0143] QPCR was performed as a technical duplicate (n=2) using a CFX96 TouchTM Real-Time PCR Detection System (Bio-Rad, Hercules, Calif., USA) and data was analysed using CFX manager Version 3.1.1517.0823 (Bio-Rad). [0144] 13. Sequencing

[0145] Every constructed plasmid was verified by sequencing. Genetic parts of interest were sequenced upon alteration (Knock-out, Knock-in). All sequencing was performed via sequencing services (Macrogen Inc.). [0146] 14. Data and Statistical Analysis

[0147] All data analysis was performed using pandas unless stated otherwise. Library evaluation and strain characterization consisted of maximal growth rate and fluorescent measurements. Maximal growth rates were determined by plotting the OD600 values in function of time and fitting Richards growth-model (Birch 1999). A fluorescent parameter was calculated by correcting each individual fluorescent data-point for its concurrent biomass (OD600), plotting them in function of time and scanning for a typical maximum.

[0148] The cellular volumetric determination of the UDP-GlcNAc was determined based on a calibration curve and was calculated assuming an OD600 of 1.0=8×108 cells/ml, and assuming 1 fL volume per cell. Chromatogram analysis was performed using the Chromeleon 7.2 software package (Thermo Scientific).

[0149] Final glycan concentrations were determined based on a calibration curve, and were corrected for biomass by OD600 measurements in order to overcome influences that were caused by the differences in culturing methods. Chromatogram analysis was performed using the Openchrom 1.1.0 software package.

Example 1

Influence of Cell Envelope Synthesis on COS Production

[0150] To evaluate the potential of increasing UDP-GlcNAc supply for a UDP-derived product, i.e., COS titer, by decreasing the conversion of UDP-GlcNAc to at least one cell envelope precursors or component, Escherichia coli s3KO transformed with pCOS is grown on minimal medium with glucose until OD600 of 3 is reached. At that point, all cells are collected through centrifugation and resuspended in fresh minimal medium with glucose. This batch is divided in four sub-batches and various concentrations of fosfomycin are added, i.e., 0 mM, 0.1 mM, 0.25 mM and 1mM, respectively. Subsequently, samples are taken for COS analysis. FIG. 4 gives the result of the TLC analysis of the corresponding cultures. Addition of fosfomycin to an E. coli culture has a positive effect on COS production. Hence, lowering the peptidoglycan synthesis results in an increased conversion of UDP-GlcNAc to COS.

Example 2

Engineering murA in Escherichia coli

[0151] In order to explore the expression profile of MurA, which catalyzes the first committed step in the peptidoglycan synthesis pathway, its expression must be varied as widely as possible and, therefore, a high-throughput screening method is required (see FIGS. 5-8). To this end, E. coli sP22 is generated in which the endogenous ibaG-murA operon (FIG. 5) is replaced by cI gene translational coupled to murA under control of the P22RBS (FIG. 6). To convert the expression of MurA into a measurable signal, i.e., fluorescence, pIndicator is constructed. Next, the p_PRND_cITCmurA plasmid is constructed randomizing the promoter and 5′-UTR regions. The translationally coupled randomized conformations are installed in a pIndicator-mKATE2 containing E. coli sP22, yielding a phenotypically diverse strain library (E. coli sRND, FIG. 7) in terms of fluorescence levels (FIG. 8). From the library seven mutants are randomly selected (displaying a range of red intensity) and characterized in depth. FIG. 9 depicts the specific fluorescence and specific corrected maximal growth rate measurements. Analysis of variance indicated that the maximal growth rate of all the selected strains were comparable to one another (one-way ANOVA, p=0.5436, F=0.8906), despite the substantial variation in murA expression we anticipated. The ability of the selected strains to maintain their fitness, despite the diverse murA expression is further substantiated by qPCR (FIG. 10). Furthermore, the data clearly showed that the fluorescence is inversely correlated to the amount of MurA mRNA (R.sup.2=0.996), validating the translationally coupled screening technique (FIG. 11). Two out of the seven selected strains (sRND6 and sRND7, with the lowest fluorescence) showed an increased MurA expression compared to the wild type strain (E. coli sWT) (FIG. 10). Investigating the peptidoglycan synthesis metabolic network and quantifying mutant UDP-GlcNAc pools, surprisingly resulted in comparable titers (FIG. 12). Analysis of variance confirmed that altering MurA expression does not affect UDP-GlcNAc levels (one-way ANOVA, p=0.4065, F=1.1384).

Example 3

Production of Fully Acetylated Chitopentaose in Escherichia coli

[0152] For the production of fully acetylated chitopentaose E. coli sRND1-5 and sWT are transformed with pCOS yielding sCOS1-5 and sWTCOS, respectively. These metabolically engineered strains are grown in minimal medium with glucose. Production of chitopentaose is depicted in FIG. 13. Production titers for fully acetylated chitopentaose ranged from 1.58 up to 5.43 times that of sWTCOS.

Example 4

Production of N-Acetylneuramic Acid (Neu5Ac) in Escherichia coli

[0153] For the production of Neu5Ac, E. coli sRND1-5 and sWT were first made deficient in E. coli's native catabolic sialic acid pathway, yielding sRNDAnanRATEK1-5 and sWTAnanRATEK, respectively. Next these metabolically engineered strains are transformed with pSA yielding sSA1-5 and sWTSA, respectively, and grown in minimal medium with glucose. Production of Neu5Ac is depicted in (FIG. 14. Specific production showed that the engineered MurA expression levels have a major impact on Neu5Ac synthesis. Upon decreasing MurA levels, E. coli sSA1-5 strains were able to produce up to 10.99 times that of E. coli sWTSA.

Example 5

Production of Lacto-N-Tetraose (LNT) in Escherichia coli

[0154] For the production of Lacto-N-tetraose, lacZ, coding for β-galactosidase, is knocked out to avoid lactose degradation and the expression of lacY, coding for a lactose permease, is ensured by means of a medium strong constitutive promoter in E. coli sRND1-5. Further, the genes lgtA and wbgO encoding β-1,3-N-acetylglucosaminyltransferase and β-1,3-galactosyltransferase, respectively, are expressed under control of the artificial promoter P14 from production plasmid pBR322 (pLNT). These metabolically engineered strains are grown in minimal medium with glucose, which is supplemented with 10 g/L lactose. Strains are cultivated in shake-flask and yielded mg amounts of LNT.

Example 6

Production of 3′-sialyllactose

[0155] For the production of 3′-sialyllactose, lacZ, coding for β-galactosidase, is additionally knocked out to avoid lactose degradation and the expression of lacY, coding for a lactose permease, is ensured by means of a medium strong constitutive promoter in E. coli sRND1-5. The metabolically engineered E. coli strains additionally expresses UDP-N-acetylglucosamine 2-epimerase (NeuC), N-acetylneuraminic acid synthase (NeuB1), CMP-NeuAc synthetase (NeuA) obtained from Campylobacter jejuni and a α-2,3-sialyltransferase (NST) obtained from Neisseria meningitidis. These metabolically engineered strains are grown in minimal medium with glucose, which is supplemented with 10 g/L lactose. This system yielded mg amounts of 3′-sialyllactose.

Example 7

Engineering of murA in Corynebacterium glutamicum

[0156] For the engineering of MurA in C. glutamicum the gene murA2, coding for a UDP-N-acetylglucosamine 1-carboxyvinyltransferase (NCgl2470), is deleted yielding strain C. glutamicum sCgl. Additionally, the epression of murAl, coding for a UDP-N-acetylglucosamine 1-carboxyvinyltransferase (NCgl0345), is altered by replacing the endogeneous promoter and 5′-UTR sequence with the cognate promoter and 5′-UTR sequence of sRND2 in C. glutamicum sWT and sCgl yielding C. glutamicum sCg2 and C. glutamicum sCg3, respectively.

Example 8

Production of N-acetylneuramic Acid (Neu5Ac) in Corynebacterium glutamicum

[0157] For the production of N-acetylneuramic acid (Neu5Ac) in C. glutamicum, C. glutamicum sCgl-1 and sWT are first made deficient in C. glutamicum's native catabolic sialic acid pathway, yielding C. glutamicum sCgAnanAl-3 and sWTΔnanA, respectively. The metabolically engineered C. glutamicum strains additionally express UDP-N-acetylglucosamine 2-epimerase (NeuC) and N-acetylneuraminic acid synthase (NeuB1) obtained from Campylobacter jejuni. These metabolically engineered strains are grown in CGXII medium with glucose, which is supplemented with 10 g/L lactose. This system yielded mg amounts of Neu5Ac.

Example 9

Production of Fully acetylated chitopentaose in Corynebacterium glutamicum

[0158] For the production of fully acetylated chitopentaose C. glutamicum sCgl-1 and sWT additionally expresses the chitin synthase obtained from Rhizobium sp. GRH2 under the control of the artificial promoter P14 from plasmid pEXK3. These metabolically engineered strains are grown in CGXII medium with glucose.

Example 10

Production of Fully Acetylated Chitopentaose in Escherichia coli with Optimized Hexosmanine Biosynthesis Pathway

[0159] For COS production in E. coli with optimized hexosmanine biosynthesis pathway strain sWT and sRND2 additionally expresses a chitin synthase obtained from Rhizobium sp. GRH2 (NodC) under control of the constitutive promoter P14, a fused N-acetylglucosamine-1-phosphate uridyltransferase and glucosamine-1-phosphate acetyltransferase (GlmU) obtained from Corynebacterium glutamicum under control of a PTrc promoter and a L-glutamine:D-fructose-6-phosphate aminotransferase (GlmS) obtained from E. coli with three mutations A38T, R249C and G471S under control of a PTet promoter (pHBP) yielding sWTCOS+pHBP and sCOS2+pHBP, respectively. These metabolically engineered strains together with sCOS2 and sWTCOS are grown in minimal medium with varies inducer concentrations (aTc/IPTG [mM/mM]: 5/0.01, 5/0.05, 10/0.01 and 10/0.05. FIG. 15 depicts the COS production. The sWTCOS+pHBP strain and sCOS2+pHBP strain were able to produce up to 2.2 and 6.8 times that of E. coli sWTCOS, respectively.

LIST OF ABBREVIATIONS USED IN THE TEXT

[0160] 5′-UTR: 5′ untranslated region

[0161] ADP: adenosine diphosphate

[0162] aTc: anhydrinetetracycline

[0163] CmR: chloramphenicol resistance

[0164] CDW: cell dry weight

[0165] CMP: cytidine-5′-monophosphate

[0166] CMP-Neu5Ac: CMP-N-acetylneuramic acid

[0167] CNRQ: calibrated normalized relative quantity

[0168] COS: chitooligosaccharide

[0169] CPEC: Circular Polymerase Extension Cloning

[0170] DWP: deep well plate

[0171] GalNAc: N-acetylgalactosamine

[0172] GDP: guanosine diphosphate

[0173] GG: Golden Gate

[0174] GH: glycoside hydrolase

[0175] Glc: glucose

[0176] GlcN: N-glucosamine

[0177] GlcNAc: N-acetylglucosamine

[0178] GlcUA: D-glucuronic acid

[0179] Gly: glycerol

[0180] GP: glycoside phosphorylase

[0181] GT: glycosyltransferase

[0182] HA: hyaleuronic acid

[0183] IPTG: isopropyl β-D-1-thiogalactopyranoside

[0184] KanR: kanamycin resistance

[0185] KO: knock-out

[0186] KI: knock-in

[0187] LB: lysogeni broth

[0188] LNT: lacto-N-tetraose

[0189] ManNAc: N-acetylmannosamine

[0190] MurNac: N-acetylmuramic acid

[0191] Neu5Ac: N-acetyl-neuramic acid

[0192] oCHS: oligomer chitin synthase

[0193] OD: optical density

[0194] P14: promoter 14 of the promoter library of De Mey et al. (De Mey et al., 2007)

[0195] P22: promoter 22 of the promoter library of De Mey et al. (De Mey et al., 2007)

[0196] Pyr: Pyruvate

[0197] pCHS: polymer chitin synthase

[0198] RBS: ribosome binding site

[0199] rpm: rotations per minute

[0200] SSA: single stranded assembly

[0201] TC: translational coupling

[0202] TCC: translational coupling cassette

[0203] TDP: thymidine diphosphate

[0204] TG: transglycosidase

[0205] UDP: uridine diphosphate

[0206] UDP-GalNAc: UDP-N-acetylgalactosamine

[0207] UDP-GlcNAc: UDP-N-acetylglucosamine

[0208] UDP-GlcUA: UDP-α-D-glucuronic acid

[0209] UDP-ManNAc: UDP-N-acetylmannosamine

[0210] UDP-MurNAc: N-acetylmuramic acid (MurNac)

[0211] WT: wild type

REFERENCES

[0212] Aerts, Dirk, Tom Verhaeghe, Marjan De Mey, Tom Desmet, and Wim Soetaert. 2011. “A Constitutive Expression System for High-Throughput Screening.” Engineering in Life Sciences 11 (1): 10-19. https://doi.org/10.1002/elsc.201000065.

[0213] Agrawal, Neema, P V N Dasaradhi, Asif Mohmmed, Pawan Malhotra, Raj K Bhatnagar, and Sunil K Mukherjee. 2003. “RNA Interference: Biology, Mechanism, and Applications.” Microbiology and Molecular Biology Reviews: MMBR 67 (4): 657-85. https://doi.org/10.1128/MMBR.67.4.657.

[0214] Aguilar-Uscanga, B, and J M Francois. 2003. “A Study of the Yeast Cell Wall Composition and Structure in Response to Growth Conditions and Mode of Cultivation.” Letters in Applied Microbiology 37: 268-74. https ://doi org/10. 1046/j.1472-765X.2003. 01394.x.

[0215] Ajikumar, Parayil Kumaran, Wen-hai Xiao, Keith E J Tyo, Yong Wang, Fritz Simeon, Effendi Leonard, Oliver Mucha, Too Heng Phon, Blaine Pfeifer, and Gregory Stephanopoulos. 2010. “Isoprenoid Pathway Optimization for Taxol Precursor Overproduction in Escherichia Coli.” Science 330 (October): 70-74. http://www.sciencemag.org/content/330/6000/70. short.

[0216] Alper, Hal, Curt Fischer, Elke Nevoigt, and Gregory Stephanopoulos. 2005. “Tuning Genetic Control through Promoter Engineering.” Proceedings of the National Academy of Sciences of the United States of America 102 (36): 12678-83. https://doi.org/10.1073/pnas.0504604102.

[0217] Alper, Hal, and Gregory Stephanopoulos. 2007. “Global Transcription Machinery Engineering: A New Approach for Improving Cellular Phenotype.” Metabolic Engineering 9 (3): 258-67. https://doi.org/10.1016/j.ymben.2006.12.002.

[0218] Alton, N. K., and D. Vapnek. 1979. “Nucleotide Sequence Analysis of the Chloramphenicol Resistance Transposon Tn9.” Nature 282 (5741): 864-69.

[0219] Antoine, Tatiana, Claude Bosso, Alain Heyraud, and Eric Samain. 2005. “Large Scale in Vivo Synthesis of Globotriose and Globotetraose by High Cell Density Culture of Metabolically Engineered Escherichia Coli.” Biochimie 87 (2): 197-203. https://doi.org/10.1016/j.biochi.2004.10.010.

[0220] Avihoo, a., I. Gabdank, M. Shapira, and D. Barash. 2007. “<emphasis>In Silico</Emphasis>Design of Small RNA Switches.” IEEE Transactions on NanoBioscience 6 (1): 4-11. https://doi.org/10.1109/TNB.2007.891894.

[0221] Balbas, Paulina, Mikhail Alexeyev, Irma Shokolenko, Francisco Bolivar, and Fernando Valle. 1996. “A PBRINT Family of Plasmids for Integration of Cloned DNA into the Escherichia Coli Chromosome.” Gene 172 (1): 65-69. https://doi.org/10.1016/0378-1119(96)00028-5.

[0222] Balbás, Paulina, and Guillermo Gosset. 2001. “Chromosomal Editing in Escherichia Coli: Vectors for DNA Integration and Excision.” Molecular Biotechnology 19 (1): 001-012. https://doi.org/10.1385/MB:19:1:001.

[0223] Bernardi, Anna, and Pavel Cheshev. 2008. “Interfering with the Sugar Code: Design and Synthesis of Oligosaccharide Mimics.” Chemistry—A European Journal 14 (25): 7434-41. https://doi.org/10.1002/chem.200800597.

[0224] Bertozzi, Carolyn R. 1995. “Cracking the Carbohydrate Code for Selectin Recognition.” Chemistry and Biology 2 (11): 703-8. https://doi.org/10.1016/1074-5521(95)90096-9.

[0225] Bhan, Namita, Peng Xu, and Mattheos Ag Koffas. 2013. “Pathway and Protein Engineering Approaches to Produce Novel and Commodity Small Molecules.” Current Opinion in Biotechnology 24 (6): 1137-43. https://doi.org/10.1016/j.copbio.2013.02.019.

[0226] Biggs, Bradley Walters, Chin Giaw Lim, Kristen Sagliani, Smriti Shankar, Gregory Stephanopoulos, Marjan De Mey, and Parayil Kumaran Ajikumar. 2016. “Overcoming Heterologous Protein Interdependency to Optimize P450-Mediated Taxol Precursor Synthesis in Escherichia Coli.” Proceedings of the National Academy of Sciences of the United States of America 113 (12): 3209-14. https://doi.org/10.1073/pnas.1515826113.

[0227] Biggs, Bradley Walters, Brecht De Paepe, Christine Nicole S Santos, Marjan De Mey, and Parayil Kumaran Ajikumar. 2014. “Multivariate Modular Metabolic Engineering for Pathway and Strain Optimization.” Current Opinion in Biotechnology 29 (1): 156-62. https://doi.org/10.1016/j.copbio.2014.05.005.

[0228] Birch, Colin P. D. 1999. “A New Generalized Logistic Sigmoid Equation Compared with the Richards Growth Equation.” Annals of Botany 83: 713-23. https://doi.org/10.1006/anbo.1999.0877.

[0229] Boddy, Christopher, N., Ian C. Schoenhofen, Susan M. Logan, Dennis M. Whitfield, and Benjamin R. Lundgren. 2011. Cell-based production of nonulosonates. WO/2011/130836, PCT/CA2011/000449, issued 2011.

[0230] Boltje, T. J., T Buskas, and G. J. Boone. 2009. “Opportunities and Challenges in Synthetic Oligosaccharide and Glycoconjugate Research.” Nature Chemistry 1 (8): 611-22.

[0231] Bose, Jeffrey L., Paul D. Fey, and Kenneth W. Bayles. 2013. “Genetic Tools to Enhance the Study of Gene Function and Regulation in Staphylococcus Aureus.” Applied and Environmental Microbiology 79 (7): 2218-24. https://doi.org/10.1128/AEM.00136-13.

[0232] Brophy, J. A., C. A. Voigt, G. André, S. Even, H. Putzer, P. Burguiere, C. Croux, et al. 2016. “Antisense Transcription as a Tool to Tune Gene Expression.” Molecular Systems Biology 12 (1): 854-854. https://doi.org/10.15252/msb.20156540.

[0233] Bruyn, Frederik De, Maarten Van Brempt, Jo Maertens, Wouter Van Bellegem, Dries Duchi, and Marjan De Mey. 2015. “Metabolic Engineering of Escherichia Coli into a Versatile Glycosylation Platform: Production of Bio-Active Quercetin Glycosides.” Microbial Cell Factories 14 (1): 138. https://doi.org/10.1186/s12934-015-0326-1.

[0234] Bruyn, Frederik De, Jo Maertens, Joeri Beauprez, Wim Soetaert, and Marjan De Mey. 2015. “Biotechnological Advances in UDP-Sugar-Based Glycosylation of Small Molecules.” Biotechnology Advances 33 (2): 288-302. https://doi.org/10.1016/j.biotechadv.2015.02.005.

[0235] Bruyn, Frederik De, Brecht De Paepe, Jo Maertens, Joeri Beauprez, Pieter De Cocker, Stein Mincke, Christian Stevens, and Marj an De Mey. 2015. “Development of an in Vivo Glucosylation Platform by Coupling Production to Growth: Production of Phenolic Glucosides by a Glycosyltransferase of Vitis Vinifera.” Biotechnology and Bioengineering 112 (8): 1594-1603. https://doi.org/10.1002/bit.25570.

[0236] Bryant, Jack a, Laura E Sellars, Stephen J W Busby, and David J Lee. 2014. “Chromosome Position Effects on Gene Expression in Escherichia Coli K-12.” Nucleic Acids Research 42 (18): 11383-92. https://doi.org/10.1093/nar/gku828.

[0237] Byun, Seong Goo, Myoung Dong Kim, Won Heong Lee, Kun Jae Lee, Nam Soo Han, and Jin Ho Seo. 2007. “Production of GDP-L-Fucose, L-Fucose Donor for Fucosyloligosaccharide Synthesis, in Recombinant Escherichia Coli.” Applied Microbiology and Biotechnology 74 (4): 768-75. https ://doi org/10.1007/s00253 -006-0730-x.

[0238] Chang, Ching-Ming, Jeffy Chern, Ming-Yi Chen, Kai-Fa Huang, Chein-Hung Chen, Yu-Liang Yang, and Shih-Hsiung Wu. 2015. “Avenaciolides: Potential MurA-Targeted Inhibitors Against Peptidoglycan Biosynthesis in Methicillin-Resistant Staphylococcus Aureus (MRSA).” Journal of the American Chemical Society 137: 267-75. https://doi.org/10.1021/j a510375f.

[0239] Cheng, Albert W, Haoyi Wang, Hui Yang, Linyu Shi, Yarden Katz, Thorold W Theunissen, Sudharshan Rangarajan, Chikdu S Shivalila, Daniel B Dadon, and Rudolf Jaenisch. 2013. “Multiplexed Activation of Endogenous Genes by CRISPR-on, an RNA-Guided Transcriptional Activator System.” Cell Research 23 (10): 1163-71. https://doi. org/10.1038/cr.2013.122.

[0240] Cherepanov, Peter P., and Wilfried Wackernagel. 1995. “Gene Disruption in Escherichia Coli: TcR and KmR Cassettes with the Option of Flp-Catalyzed Excision of the Antibiotic-Resistance Determinant.” Gene 158 (1): 9-14. https://doi.org/10.1016/0378-1119(95)00193-A.

[0241] Cocinero, Emilio J., and Pierre Carcabal. 2013. “Carbohydrates.” Topics in Current Chemistry 364: 299-334. https://doi.org/10.1007/128.

[0242] Cong, Le, F Ann Ran, David Cox, Shuailiang Lin, Robert Barretto, Naomi Habib, Patrick D Hsu, et al. 2013. “Multiplex Genome Engineering Using CRISPR/Cas Systems.” Science 339 (6121): 819-23. https://doi.org/10.1126/science.1231143.

[0243] Copeland, Matthew F, Mark C Politz, and Brian F Pfleger. 2014. “Application of TALEs, CRISPR/Cas and SRNAs as Trans-Acting Regulators in Prokaryotes.” Current Opinion in Biotechnology 29C (March): 46-54. https://doi.org/10.1016/j.copbio.2014.02.010.

[0244] Coussement, Pieter, David Bauwens, Jo Maertens, Wim Soetaert, and Marjan De Mey. 2017. “Direct Combinatorial Pathway Optimization.” ACS Synthetic Biology 6 (2): 224-32. https://doi.org/10.1021/acssynbio.6b00122.

[0245] Coussement, Pieter, Jo Maertens, Joeri Beauprez, Wouter Van Bellegem, and Marjan De Mey. 2014. “One Step DNA Assembly for Combinatorial Metabolic Engineering.” Metabolic Engineering 23 (March): 70-77. https ://doi org/10. 1016/j.ymben.2014. 02.012.

[0246] Cox, Robert Sidney, Michael G Surette, and Michael B Elowitz. 2007. “Programming Gene Expression with Combinatorial Promoters.” Molecular Systems Biology 3 (January): 145. https://doi.org/10.1038/msb4100187.

[0247] Datsenko, K A, and B L Wanner. 2000. “One-Step Inactivation of Chromosomal Genes in Escherichia Coli K-12 Using PCR Products.” Proceedings of the National Academy of Sciences 97 (12): 6640-45. https://doi.org/10.1073/pnas.120163297.

[0248] Demchick, P, and A L Koch. 1996. “The Permeability of the Wall Fabric of Escherichia Coli and Bacillus Subtilis” 178 (3): 768-73.

[0249] Deng, Ming-De, Alan D. Grund, Sarah L. Wassink, Susan S. Peng, Kathleen L. Nielsen, Brian D. Huckins, Bonnie L. Walsh, and Richard P. Burlingame. 2006. “Directed Evolution and Characterization of Escherichia Coli Glucosamine Synthase.” Biochimie 88 (5): 419-29. https://doi.org/10.1016/j.biochi.2005.10.002.

[0250] Didovyk, A., and L. Tsimring. 2016. “Orthogonal Modular Gene Repression in Escherichia Coli Using Engineered CRISPR/Cas9.” ACS Synthetic Biology 5: 81-88.

[0251] Farmer, W R, and J C Liao. 2000. “Improving Lycopene Production in Escherichia Coli by Engineering Metabolic Control.” Nature Biotechnology 18: 533-37. http://www.nature.com/nbt/journal/v18/n.sup.5/abs/nbt0500533 .html.

[0252] Farzadfard, Fahim, Samuel D Perli, and Timothy K Lu. 2013. “Tunable and Multifunctional Eukaryotic Transcription Factors Based on CRISPR/Cas.” ACS Synthetic Biology 2 (10): 604-13. https://doi.org/10.1021/sb400081r.

[0253] Fierfort, Nicolas, and Eric Samain. 2008. “Genetic Engineering of Escherichia Coli for the Economical Production of Sialylated Oligosaccharides.” Journal of Biotechnology 134: 261-65. https://doi.org/10.1016/j.jbiotec.2008.02.010.

[0254] Gabius, Hans Joachim. 2000. “Biological Information Transfer beyond the Genetic Code: The Sugar Code.” Natunvissenshaften 87 (3): 108-21.

[0255] Gabius, Hans Joachim, Sabine Andrá, Jesús Jimenez-Barbero, Antonio Romero, and Dolores Solis. 2011. “From Lectin Structure to Functional Glycomics: Principles of the Sugar Code.” Trends in Biochemical Sciences 36 (6): 298-313. https://doi.org/10.1016/j.tibs.2011.01.005.

[0256] Gabius, Hans Joachim, and Jorgen Roth. 2017. “An Introduction to the Sugar Code.” Histochemistry and Cell Biology 147 (2): 111-17. https://doi.org/10.1007/s00418-016-1521-9.

[0257] Gaj, Thomas, Shannon J Sirk, and Carlos F Barbas. 2014. “Expanding the Scope of Site-Specific Recombinases for Genetic and Metabolic Engineering.” Biotechnology and Bioengineering 111 (1): 1-15. https://doi.org/10.1002/bit.25096.

[0258] Goedl, Christiane, Alexandra Schwarz, Alphonse Minani, and Bernd Nidetzky. 2007. “Recombinant Sucrose Phosphorylase from Leuconostoc Mesenteroides: Characterization, Kinetic Studies of Transglucosylation, and Application of Immobilised Enzyme for Production of Alfa-d-Glucose 1-Phosphate.” Journal of Biotechnology 129 (1): 77-86. https://doi.org/10.1016/j.jbiotec.2006.11.019.

[0259] Goh, Shan, Jaroslaw M. Boberek, Nobutaka Nakashima, Jem Stach, and Liam Good. 2009. “Concurrent Growth Rate and Transcript Analyses Reveal Essential Gene Stringency in Escherichia Coli.” PLoS ONE 4 (6). https://doi.org/10.1371/journal.pone.0006061.

[0260] Graslund, S., P. Nordlund, J. Weigelt, B.M. Hallberg, J. Bray, 0. Gileadi, S. Knapp, et al. 2008. “Protein Production and Purification.” Nature Methods 5 (2): 135-46. https://doi.org/10.1038/nmeth.f.202.Protein.

[0261] Hamer, Stefanie Nicole, Stefan Cord-Landwehr, Xevi Biarnes, Antoni Planas, Hendrik Waegeman, Bruno Maria Moerschbacher, and Stephan Kolkenbrock. 2015. “Enzymatic Production of Defined Chitosan Oligomers with a Specific Pattern of Acetylation Using a Combination of Chitin Oligosaccharide Deacetylases.” Scientific Reports 5: 8716. https://doi.org/10.1038/srep08716.

[0262] Hebert, Colin G., James J. Valdes, and William E. Bentley. 2008. “Beyond Silencing—Engineering Applications of RNA Interference and Antisense Technology for Altering Cellular Phenotype.” Current Opinion in Biotechnology 19 (5): 500-505. https://doi.org/10.1016/j.copbio.2008.08.006.

[0263] Hedges, R., and A. Jacob. 1974. “Transposition of Ampicillin Resistance from RP4 to Other Replicon.” Molecular and General Genetics MGG 132: 31-40.

[0264] Hendlin, D., E. 0. Stapley, M. Jackson, H. Wallick, A. K. Miller, F. J. Wolf, T. W. Miller, et al. 1967. “Phosphonomycin, a New Antibiotic Produced by Strains of Streptomyces.” Science 166 (3901): 20122-123-22.

[0265] Hoang, Tung T., Roxann R. Karkhoff-Schweizer, Alecksandr J. Kutchma, and Herbert P. Schweizer. 1998. “A Broad-Host-Range F 1p-FRT Recombination System for Site-Specific Excision of Chromosomally-Located DNA Sequences: Application for Isolation of Unmarked Pseudomonas Aeruginosa Mutants.” Gene 212 (1): 77-86. https://doi.org/10.1016/S0378-1119(98)00130-9.

[0266] Hove, Bob Van, Chiara Guidi, Jo De Wannemaeker, Lien Maertens, and Marjan De Mey. 2017. “Recursive DNA Assembly Using Protected Oligonucleotide Duplex Assisted Cloning (PODAC).” ACS Synthetic Biology 6 (6): 943-49. https://doi.org/10.1021/acssynbio.7b00017.

[0267] Hove, Bob Van, Aaron M Love, Parayil Kumaran Ajikumar, and Marjan De Mey. 2016. “Programming Biology: Expanding the Toolset for the Engineering of Transcription.” In Synthetic Biology, edited by Anton Glieder, Christian P Kubicek, Diethard Mattanovich, Birgit Wiltschi, and Michael Sauer, 1-64. Springer Cham Heidelberg New York Dordrecht London: Springer International Publishing.

[0268] Hrast, Martina, Izidor Sosic, Roman Sink, and Stanislav Gobec. 2014. “Inhibitors of the Peptidoglycan Biosynthesis Enzymes MurA-F.” Bioorganic Chemistry 55: 2-15. https://doi.org/10.1016/j.bioorg.2014.03.008.

[0269] Jennewein, Stefan. 2014. Total fermentation of oligosaccharides. EP2927316A1, issued 2014.

[0270] Jiang, Yu, Fenghui Qian, Junjie Yang, Yingmiao Liu, Feng Dong, Chongmao Xu, Bingbing Sun, et al. 2017. “CRISPR-Cpfl Assisted Genome Editing of Corynebacterium Glutamicum.” Nature Communications 8: 15179. https://doi.org/10.1038/ncomms15179.

[0271] Kahan, Frederick M, Jean S Kahan, Patrick J Cassidy, and Helmut Kropp. 1974. “The Mechanism of Action of Fosfomycin (Phosphonomycin).” Annals of the New York Academy of Sciences 235: 364-86.

[0272] Kazuo, Yamaguchi, and Yamaguchi Mitsuyo. 1984. “The Replication Origin of PSC101: The Nucleotide Sequence and Replication Functions of the Ori Region.” Gene 29 (1-2): 211-19. https://doi.org/10.1016/0378-1119(84)90181-1.

[0273] Keseler, Ingrid M., Amanda Mackie, Martin Peralta-Gil, Alberto Santos-Zavaleta, Socorro Gama-Castro, Cesar Bonavides-Martinez, Carol Fulcher, et al. 2013. “EcoCyc: Fusing Model Organism Databases with Systems Biology.” Nucleic Acids Research 41 (November 2012): 605-12. https://doi.org/10.1093/nar/gks1027.

[0274] Kogure, Takahisa, Naoki Wakisaka, Hiroaki Takaku, and Masamichi Takagi. 2007. “Efficient Production of 2-Deoxy-Scyllo-Inosose from d-Glucose by Metabolically Engineered Recombinant Escherichia Coli.” Journal of Biotechnology 129 (3): 502-9. https://doi.org/10.1016/j.jbiotec.2007.01.016.

[0275] Kristensen, C. S., L. Eberl, J. M. Sanchez-Romero, M. Givskov, S. Molin, and V. De Lorenzo. 1995. “Site-Specific Deletions of Chromosomally Located DNA Segments with the Multimer Resolution System of Broad-Host-Range Plasmid RP4.” Journal of Bacteriology 177 (1): 52-58.

[0276] Larson, Matthew H, Luke a Gilbert, Xiaowo Wang, Wendell a Lim, Jonathan S Weissman, and Lei S Qi. 2013. “CRISPR Interference (CRISPRi) for Sequence-Specific Control of Gene Expression.” Nature Protocols 8 (11): 2180-96. https://doi.org/10.1038/nprot.2013.132.

[0277] Lipke, Peter N, and Rafael Ovalle. 1998. “Cell Wall Architecture in Yeast : New Structure and New Challenges †” 180 (15): 3735-40.

[0278] Maeder, Morgan L, Samantha J Linder, Deepak Reyon, James F Angstman, Yanfang Fu, Jeffry D Sander, and J Keith Joung. 2013. “Robust, Synergistic Regulation of Human Gene Expression Using TALE Activators.” Nature Methods 10 (3): 243-45. https://doi. org/10.1038/nmeth.2366.

[0279] Maertens, Jo, Joeri Beauprez, and Marjan De Mey. 2010. Metabolically engineered organisms for the production of added value bio-products. EP 10169304.2 (12/07/2010)/WO2012/007481, issued 2010.

[0280] Merzendorfer, Hans. 2011. “European Journal of Cell Biology The Cellular Basis of Chitin Synthesis in Fungi and Insects : Common Principles and Differences.” European Journal of Cell Biology 90 (9): 759-69. https://doi.org/10.1016/j.ejcb.2011.04.014.

[0281] Mey, Marjan De, Jo Maertens, Gaspard J Lequeux, Wim K Soetaert, and Erick J Vandamme. 2007. “Construction and Model-Based Analysis of a Promoter Library for E. Coli: An Indispensable Tool for Metabolic Engineering.” BMC Biotechnology 7 (January): 34. https://doi.org/10.1186/1472-6750-7-34.

[0282] Molina-Lopez, Jose, Francois Sanschagrin, and Roger C Levesque. 2006. “A Peptide Inhibitor of MurA UDP- N -Acetylglucosamine Enolpyruvyl Transferase : The First Committed Step in Peptidoglycan Biosynthesis.” Peptides 27 (3000): 3115-21. https://doi.org/10.1016/j.peptides.2006.08.023.

[0283] Moon, Tae Seok, Chunbo Lou, Alvin Tamsir, Brynne C Stanton, and Christopher a Voigt. 2012. “Genetic Programs Constructed from Layered Logic Gates in Single Cells.” Nature 491 (7423): 249-53. https://doi.org/10.1038/nature11516.

[0284] Mutalik, Vivek K, Joao C Guimaraes, Guillaume Cambray, Colin Lam, Marc Juul Christoffersen, Quynh-Anh Mai, Andrew B Tran, et al. 2013. “Precise and Reliable Gene Expression via Standard Transcription and Translation Initiation Elements.” Nature Methods 10 (4): 354-60. https://doi.org/10.1038/nmeth.2404.

[0285] Neidhardt, Frederick C, and Roy Curtiss. 1996. Escherichia Coli and Salmonella: Cellular and Molecular Biology. 2nd ed. Washington, DC: ASM Press.

[0286] Nevoigt, Elke, Jessica Kohnke, Curt R Fischer, Hal Alper, Ulf Stahl, and Gregory Stephanopoulos. 2006. “Engineering of Promoter Replacement Cassettes for Fine-Tuning of Gene Expression in Saccharomyces Cerevisiae.” Applied and Environmental Microbiology 72 (8): 5266-73. https://doi.org/10.1128/AEM.00530-06.

[0287] Nielsen, Alec AK, and Christopher A Voigt. 2014. “Multi-Input CRISPR/Cas Genetic Circuits That Interface Host Regulatory Networks.” Molecular Systems Biology 10 (January): 763. http://www.ncbi.nlm.nih.gov/pubmed/25422271.

[0288] Ohlendorf, Robert, Roee R Vidayski, Avigdor Eldar, Keith Moffat, and Andreas Moglich. 2012. “From Dusk till Dawn: One-Plasmid Systems for Light-Regulated Gene Expression.” Journal of Molecular Biology 416 (4): 534-42. https://doi.org/10.1016/j.jmb.2012.01.001.

[0289] Palmeros, Beatriz, Jadwiga Wild, Waclaw Szybalski, Sylvie Le Borgne, Georgina Hernandez-Chavez, Guillermo Gosset, Fernando Valle, and Francisco Bolivar. 2000. “A Family of Removable Cassettes Designed to Obtain Antibiotic-Resistance-Free Genomic Modifications of Escherichia Coli and Other Bacteria.” Gene 247 (1-2): 255-64. https://doi.org/10.1016/S0378-1119(00)00075-5.

[0290] Patil, Kiran Raosaheb, Mats Akesson, and Jens Nielsen. 2004. “Use of Genome-Scale Microbial Models for Metabolic Engineering.” Current Opinion in Biotechnology 15: 64-69. https://doi.org/10.1016/j.copbio.2003.11.003.

[0291] Perez-Pinera, P, D D Kocak, and C M Vockley. 2013. “RNA-Guided Gene Activation by CRISPR-Cas9-Based Transcription Factors.” Nature Methods 10 (10): 973-76. https://doi.org/10.1038/nmeth.2600.RNA-guided.

[0292] Peters, Geert, Pieter Coussement, Jo Maertens, Jeroen Lammertyn, and Marjan De Mey. 2015. “Putting RNA to Work: Translating RNA Fundamentals into Biotechnological Engineering Practice.” Biotechnology Advances 33 (8): 1829-44.

[0293] Peters, Gert, Brecht De Paepe, Lien De Wannemaeker, Dries Duchi, Jo Maertens, Jeroen Lammertyn, and Marjan De Mey. 2018. “Development of N-Acetylneuraminic Acid Responsive Biosensors Based on the Transcriptional Regulator NanR.” Biotechnology and Bioengineering 115: 1855-65. https://doi.org/10.1002/bit.26586.

[0294] Pirie, Christopher M, Marjan De Mey, Kristala L Prather, and Parayil K Ajikumar. 2013. “Integrating the Protein and Metabolic Engineering Toolkits for Next-Generation Chemical Biosynthesis.” ACS Chemical Biology 8 (4): 662-72. https://doi.org/10.1021/cb300634b.

[0295] Pitzer, Julia, Bob Van Hove, Aaron M Love, Parayil Kumaran Ajikumar, Marjan De Mey, and Anton Glieder. 2016. “Novel DNA and RNA Elements.” In Synthetic Biology, edited by Anton Glieder, Christian P Kubicek, Diethard Mattanovich, Birgit Wiltschi, and Michael Sauer, 65-100. Springer Cham Heidelberg New York Dordrecht London: Springer International Publishing.

[0296] Politz, Mark C, Matthew F Copeland, and Brian F Pfleger. 2013. “Artificial Repressors for Controlling Gene Expression in Bacteria.” Chemical Communications 49 (39): 4325-27. https://doi.org/10.1039/c2cc37107c.

[0297] Prentki, Pierre, and Henry M Krisch. 1982. “A Modified PBR322 Vector with Improved Properties for the Cloning, Recovery, and Sequencing of Blunt-Ended DNA Fragments.” Gene 17: 189-96.

[0298] Pridmore, Raymond David. 1987. “New and Versatile Cloning Vectors with Kanamycin-Resistance Marker.” Gene 56: 309-12.

[0299] Priem, B, M Gilbert, W.W. Wakarchuk, A Heyraud, and Eric Samain. 2002. “A New Fermentation Process Allows Large-Scale Production of Human Milk Oligosaccharides by Metabolically Engineered Bacteria.” Glycobiology 12 (4): 235-40.

[0300] Ptashne, M. 2004. A Genetic Switch: Phage Lambda Revisited. 3rd ed. CHS Laboratory Press.

[0301] Qi, Lei S, and Adam P Arkin. 2014. “A Versatile Framework for Microbial Engineering Using Synthetic Non-Coding RNAs.” Nature Reviews. Microbiology 12 (5): 341-54. https://doi.org/10.1038/nrmicro3244.

[0302] Qi, Lei S, Matthew H Larson, Luke a Gilbert, Jennifer a Doudna, Jonathan S Weissman, Adam P Arkin, and Wendell a Lim. 2013. “Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression.” Cell 152 (5): 1173-83. https://doi. org/10.1016/j.cell.2013 .02.022.

[0303] Quan, Jiayuan, and Jingdong Tian. 2009. “Circular Polymerase Extension Cloning of Complex Gene Libraries and Pathways.” Plos One 4 (7): e6441. https://doi.org/10.1007/978-1-62703-764-88.

[0304] Rasmussen, Louise, Hans Sperling-Petersen, and Kim Mortensen. 2007. “Hitting Bacteria at the Heart of the Central Dogma: Sequence-Specific Inhibition.” Microbial Cell Factories 6 (1): 24. https://doi.org/10.1186/1475-2859-6-24.

[0305] Rodriguez-Diaz, Jesús, Antonio Rubio-del-Campo, and Maria J. Yebra. 2012. “Metabolic Engineering of Lactobacillus Casei for Production of UDP-N-Acetylglucosamine.” Biotechnology and Bioengineering 109 (7): 1704-12. https://doi.org/10.1002/bit.24475.

[0306] Rozman, Kaja, Samo Legnik, Boris Brus, Martina Hrast, Matej Soya, Delphine Patin, Helene Barreteau, Janez Konc, Dusanka Janezic, and Stanislav Gobec. 2017. “Discovery of New MurA Inhibitors Using Induced-Fit Simulation and Docking.” Bioorganic & Medicinal Chemistry Letters 27: 944-49. https://doi.org/10.1016/j.bmc1.2016.12.082.

[0307] Ruffing, Anne, and Rachel Ruizhen Chen. 2006. “Metabolic Engineering of Microbes for Oligosaccharide and Polysaccharide Synthesis.” Microbial Cell Factories 5: 25. https://doi.org/10.1186/1475-2859-5-25.

[0308] Salis, Howard M. 2011. “The Ribosome Binding Site Calculator.” Methods in Enzymology 498: 19-42. https://doi.org/10.1016/B978-0-12-385120-8.00002-4.

[0309] Samain, Eric, Sophie Drouillard, Alain Heyraud, Hugues Driguez, and Roberto a Geremia. 1997. “Gram-Scale Synthesis of Recombiant Chitooligosaccharides in Escherichia Coli.” Carbohydrate Research 302: 35-42.

[0310] Sambrook, J. F., and D. W. Russell. 2001. Molecular Cloning: A Laboratory Manual. 3rd ed. Cold Spring Harbor Laboratory Press.

[0311] Sauer, B. 1987. “Functional Expression of the Cre-Lox Site-Specific Recombination System in the Yeast Saccharomyces Cerevisiae.” Molecular and Cellular Biology 7 (6): 2087-96. https://doi.org/10.1128/MCB.7.6.2087.

[0312] Schweizer, Herbert P. 2003. “Applications of the Saccharomyces Cerevisiae Flp-FRT System in Bacterial Genetics.” Journal of Molecular Microbiology and Biotechnology 5 (2): 67-77. https://doi.org/10.1159/000069976.

[0313] Selzer, G, T Som, T Itoh, and J Tomizawa. 1983. “The Origin of Replication of Plasmid PISA and Comparative Studies on the Nucleotide Sequences around the Origin of Related Plasmids.” Cell32 (1): 119-29.

[0314] Shcherbo, Dmitry, Christopher S Murphy, Galina V Ermakova, Elena A Solovieva, Tatiana V Chepurnykh, Aleksandr S Shcheglov, V Vladislav, et al. 2009. “Far-Red Fluorescent Tags for Protein Imaging in Living Tissues.” Biochemical Journal 418 (3): 567-74. https://doi.org/10.1042/BJ20081949.Far-red.

[0315] Silhavy, Thomas, Daniel Kahne, and Suzanne Walker. 2010. “The Bacterial Cell Envelope.” Cold Spring Harbor Perspectives in Biology 2 (5): 1-16. https://doi.org/10.1101/cshperspect.a000414.

[0316] Stansen, Corinna, Davin Uy, Stephane Delaunay, Lothar Eggeling, Jean Louis Goergen, and Volker F. Wendisch. 2005. “Characterization of a Corynebacterium Glutamicum Lactate Utilization Operon Induced during Temperature-Triggered Glutamate Production.” Applied and Environmental Microbiology 71 (10): 5920-28. https://doi.org/10.1128/AEM.71.10.5920-5928.2005.

[0317] Stephanopoulos, Gregory. 2012. “Synthetic Biology and Metabolic Engineering.” ACS Synthetic Biology 1 (11): 514-25. https://doi.org/10.1021/sb300094q.

[0318] Trantas, Emmanouil A., Mattheos A. G. Koffas, Peng Xu, and Filippos Ververidis. 2015. “When Plants Produce Not Enough or at All: Metabolic Engineering of Flavonoids in Microbial Hosts.” Frontiers in Plant Science 6 (7): 1-16. https://doi.org/10.3389/fpls.2015.00007 When.

[0319] Tsuda, Masataka. 1998. “Use of a Transposon-Encoded Site-Specific Resolution System for Construction of Large and Defined Deletion Mutations in Bacterial Chromosome.” Gene 207 (1): 33-41. https://doi.org/10.1016/S0378-1119(97)00601-X.

[0320] Tweeddale, Helen, Lucinda Notley-m C Robb, and Thomas Ferenci. 2006. “Effect of Slow Growth on Metabolism of Escherichia Coli, as Revealed by Global Metabolite Pool (‘Metabolome’) Analysis” 180 (19): 5109-16.

[0321] Tyo, Keith E, Hal S Alper, and Gregory N Stephanopoulos. 2007. “Expanding the Metabolic Engineering Toolbox: More Options to Engineer Cells.” Trends in Biotechnology 25 (3): 132-37. https://doi.org/10.1016/j.tibtech.2007.01.003.

[0322] Varki, Ajit. 1993. “Biological Roles of Oligosaccharides: All of the Theories Are Correct.” Glycobiology 3 (2): 97-130.

[0323] Verpoorte, R., R. Van Der Hejden, H. J G Ten Hoopen, and J. Memelink. 1999. “Metabolic Engineering of Plant Secondary Metabolite Pathways for the Production of Fine Chemicals.” Biotechnology Letters 21 (6): 467-79. https://doi. org/10.1023/A: 1005502632053.

[0324] Weaver, Daniel S, Ingrid M Keseler, Amanda Mackie, Ian T Paulsen, and Peter D Karp. 2014. “A Genome-Scale Metabolic Flux Model of Escherichia Coli K-12 Derived from the EcoCyc Database.” BMC Systems Biology 8: 79. https://doi.org/10.1186/1752-0509-8-79.

[0325] Westbrook, Adam W, Xiang Ren, Jaewon Oh, Murray Moo-young, and C Perry Chou. 2018. “Metabolic Engineering to Enhance Heterologous Production of Hyaluronic Acid in Bacillus Subtilis.” Metabolic Engineering 47 (November 2017): 401-13. https://doi.org/10.1016/j.ymben.2018.04.016.

[0326] Williams, James A., Jeremy Luke, and Clague Hodgson. 2009. “Strain Engineering by Genome Mass Transfer: Efficient Chromosomal Trait Transfer Method Utilizing Donor Genomic DNA and Recipient Recombineering Hosts.” Molecular Biotechnology 43 (1): 41-51. https://doi.org/10.1007/s12033-009-9177-5.

[0327] Xie, Xianfa, and Peter N. Lipke. 2011. “On the Evolution of Fungal and Yeast Cell Walls Xianfa.” Yeast 27 (8): 479-88. https://doi.org/10.1002/yea.1787.0n.

[0328] Yadav, Vikramaditya G., Marjan De Mey, Chin Giaw Lim, Parayil K Ajikumar, and Gregory Stephanopoulos. 2013. “The Future of Metabolic Engineering and Synthetic Biology: Towards a Systematic Practice” 14 (.sup.3): 233-41. https://doi.org/10.1016/j.ymben.2012.02.001. The.

[0329] Zhang, Dawei, Peng George Wang, and Qingsheng Qi. 2007. “A Two-Step Fermentation Process for Efficient Production of Penta-N-Acetyl-Chitopentaose in Recombinant Escherichia Coli.” Biotechnology Letters 29 (11): 1729-33. https://doi.org/10.1007/s10529-007-9462-y.

[0330] Zhang, J., P. Kowal, X. Chen, and P.G. Wang. 2003. “Large-Scale Synthesis of Globotriose Derivatives through Recombinant E. Coli.” Organic & Biomolecular Chemistry 1 (17): 3048-53.

[0331] Zhou, Kang, Lihan Zhou, Qing 'En Lim, Ruiyang Zou, Gregory Stephanopoulos, and Heng-Phon Too. 2011. “Novel Reference Genes for Quantifying Transcriptional Responses of Escherichia Coli to Protein Overexpression by Quantitative PCR.” BMC Molecular Biology 12: 18. https://doi.org/10.1186/1471-2199-12-18.