Non-invasive ocular biomarkers for early diagnosis of diseases
11166633 · 2021-11-09
Assignee
Inventors
Cpc classification
A61B5/4833
HUMAN NECESSITIES
International classification
Abstract
Materials and methods are disclosed for screening advanced glycation end-products from mammalian ocular lens proteins to quantify early biomarkers for the diagnosis of diseases such as diabetes mellitus and to prevent related complications.
Claims
1. A method for detecting and characterizing fluorophores in an ocular protein, cell or tissue, the method comprising: (a) focusing an excitation light beam on the ocular protein, cell or tissue; (b) detecting a fluorescent light emitted from the ocular protein, cell or tissue in a one or more wavebands, by an intensity of fluorescence from the ocular protein, cell or tissue; (c) calculating the intensity of fluorescence for each waveband, wherein the calculation detects the fluorophore in the ocular protein, cell or tissue; (d) measuring fluorescence decay with time after a short excitation pulse from the ocular protein, cell or tissue in the specific waveband; and (e) calculating the fluorescence lifetimes from the fluorescent decay curves using global 1-4 three exponential fitting analysis.
2. The method of claim 1, wherein the fitting analysis is calculated based on good autocorrelation function around zero, weighted number of residuals randomly distributed between +3 and −3, reduced chi square values between 0.9-1.1 and Durbin-Watson parameters of greater than or equal to 1.6, 1.7 and 1.8 for one, two and three exponential decays respectively.
3. An in vitro diagnostic test using the method of claim 1 for distinguishing the normal samples from pathological samples, further defined as based on the fluorescence intensity, decay and change in lifetime measurements at specific excitation wavelengths between 280-600 nm, and the damage to the proteins in the tissue is confirmed based on mass spectrometry and X-ray scattering.
4. The method of claim 1, wherein the fluorophores are selected from the group consisting of A2E, lipofuscin, FAD, NADH, photo-degradation products of tryptophan and advanced glycation end-products.
5. The method of claim 1, wherein results of calculating the intensity of fluorescence for each waveband distinguished normal from pathological cells or tissues based on differences in the fluorescence intensity maps.
6. The method of claim 1, wherein detecting comprises screening changes in fluorophores over time and in response to treatments for a condition or disease.
7. The method of claim 6, wherein the disease is selected from the group consisting of diabetes mellitus and diabetic retinopathy.
8. The method of claim 4, wherein the photo-degradation products of tryptophan are selected from the group consisting of N-formyl kynurenine, anthranilic acid, kynurenine, 3-hydroxykynurenine and harmane.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
DETAILED DESCRIPTION
(39) Physical and chemical biomarkers were sought for the glycolytic modifications in the ocular lens in order to develop a diagnostic tool for the early diagnosis of eye diseases related to other disorders, e.g. diabetes.
(40) The eye lens doesn't have any protein turnover, and therefore is an ideal tissue to study the early stage glycation due to hyperglycemic conditions. By screening for the formation of AGEs and quantifying the resulting physicochemical changes, the development of diabetes may be diagnosed at a very early stage. This in turn, will help in initiating the treatment/precautionary measures from an early stage and prevent the progression of the diseases like diabetic retinopathy and loss of vision.
(41) Lens proteins as well as intact lenses were glycated and the formation of advanced glycation endproducts (AGEs) were characterized using steady state fluorescence and time resolved single photon counting. The biophysical changes in the protein were studied using Dynamic and Static Light Scattering, Small Angle X-ray Scattering to measure the change in scattering intensities.
(42) From the steady state fluorescence measurements, a resonance energy transfer was observed between tryptophan and AGEs. Also, with increase in time of glycation, the AGEs absorbed at wavelengths longer than 370 nm. The fluorescence lifetimes of glycated protein was measured with excitation at 370 nm and emission was monitored at 440 nm using time correlated single photon counting to be around 0.5, 2.8 and 9.8 ns with varying relative contributions. Small angle X-ray scattering data showed the change in inter-particle distances and structural spacing. Dynamic and Static Light Scattering data indicates an increase in particle size, molecular weight and decrease in protein diffusivity. Subsequent measurements were at an excitation wavelength of 340 nm and 435 nm.
(43) One biomarker for diabetes related diseases is the formation of Advanced Glycation Endproducts (AGEs) that result from the Maillard reaction of proteins with glucose α-crystallin in the ocular lens. Glucose α-crystallin is a small heat shock protein with no protein turnover and, consequently acts as a record for post-translational modifications, especially glycation, which forms fluorescent AGEs. Steady state and time resolved fluorescence measurements were used to analyze the spectroscopic changes in alpha crystallin with increase in time of glycation, in intact lenses from diabetic and non-diabetic donors. Overall, the goal was to develop a non-invasive diagnostic tool for early detection of diabetes mellitus.
(44) AGEs are formed due to non-enzymatic glycation of the proteins on exposure to open chain sugars and dicarbonyl intermediates. Hyperglycemic conditions, oxidative and thermal stress lead to the formation of Schiff's bases with basic amino acids, for example, lysine and arginine. Further, Amadori products are formed due to rearrangement of the Schiff's bases when highly reactive carbonyl intermediates accumulate and attack the amino and guanidine groups on the proteins. Unlike hemoglobin and albumin, the heat shock proteins have long half-lives and very low turnover. As a result, the accumulation of glycation products over a long period of time is of quantitative significance.
(45) By screening the changes in the lens proteins and, consequently, the intact lens, non-invasive spectroscopic biomarkers were identified for the early diagnosis of diabetes mellitus. The appearance of these biomarkers will, in turn, act as a standard diagnostic test for commencing the treatment regimen, thereby preventing further complications.
(46) Establishing a correlation between the structural, molecular and spectroscopic changes in a protein as it slowly denatures due to aggregation induced by non-enzymatic glycation, elucidates the importance of a glycation model of aging and diabetes and the pathological mechanisms in various degenerative diseases.
(47) Emission spectra were recorded from unmodified and glycated alpha crystallin for the excitation wavelengths set at 340 and 435 nm. By excitation at 340 nm, emission spectra showed one distinct peak (
(48) The fluorescence lifetimes of glycated α-crystallin, when excited at 340 and 435 nm can be seen in Tables 1 and 2 respectively. The success of the fit was evaluated using reduced chi-square value and Durbin-Watson parameter. The reduced chi square value was considered good at values between 0.9-1.2. The Durbin-Watson parameter was 1.6, 1.7 and 1.8 or more for a one, two and three exponential decay respectively for successful evaluation of the fit. Similarly, the time resolved fluorescence decay curves from intact lenses at 340 and 435 nm were collected to obtain the lifetimes of the fluorophores as seen in Tables 3, 4, 10-13 respectively.
(49) Time-resolved fluorescence measurements were measured in triplicate and then the fluorescence decay profiles were analyzed assuming that the model followed a multiple exponential fit. In the case of 340 nm excitation, one or two exponential functions did not provide an acceptable fit, as judged by autocorrelation, number of weighted residuals and Durbin Watson parameters. The lifetimes and their relative contributions were determined at excitation wavelengths—340 as seen in Table 1. Table 2 shows the fluorescence lifetimes, from unmodified and modified α-crystallin at an excitation wavelength of 435 nm.
(50) Here, noticeable trends are observed in the lifetimes with glycation of the protein. In the visible region, unmodified α-crystallin showed no fluorescence and therefore, no lifetimes. However, for glycated α-crystallin, new shorter and longer lifetimes appear with increase in the time of glycation.
(51) For excitation at 340 nm, no change in lifetime was observable with increasing time of glycation but the amplitude, A1, decreased as the amplitudes, A2 and A3, increased. In addition, the ratio A1/A2 is nearly linear with time of glycation and serves as a relative measure of glycation. Table 2 shows the fluorescence lifetimes from unmodified and modified a-crystallin at an excitation wavelength of 435 nm.
(52) Table 3 provides an overall summary of time resolved fluorescence lifetimes obtained at 340 nm from various donor lenses. Table 4 provides an overall summary of time resolved fluorescence lifetimes obtained by excitation at 435 nm from various donor lenses. It can be seen that the distribution of lifetimes and their individual contribution to the total fluorescence at 435 nm excitation wavelength is very different for non-diabetic and diabetic donor lenses. While the younger non-diabetics did not show any fluorescence, older non-diabetics showed one fluorescence lifetime around 4.7 ns. In the diabetic lenses from younger donors, the time resolved fluorescence decay spectra showed a very good fit with a double exponential decay with lifetimes around 4.6 and 17 ns. The decay spectra from older diabetic donor lenses gave a good fit with triple exponential decay with lifetimes around 1.4, 4.5 and 16 ns.
(53) Non-enzymatic glycation of α-crystallin is presented as an in vitro model for aging, diabetes and degenerative diseases.
(54) Alpha crystallin, a small heat shock protein, has been studied extensively for its chaperone function. α-crystallin sub-units are expressed in stress conditions and have been found to prevent apoptosis by inhibiting the activation of the caspase pathway. Non-enzymatic glycation of the protein leads to the formation of advanced glycation end-products (AGEs). These AGEs bind to receptors and lead to blocking the signaling pathways or cause protein precipitation as observed in aggregation related diseases.
(55) Methylglyoxal (MGO) is one of the major glycating agent expressed in pathological conditions due to defective glycolysis pathway. MGO reacts rapidly with proteins, forms AGEs and finally leads to aggregation. Understanding the non-enzymatic glycation induced structural damage in α-crystallin using biophysical and spectroscopic characterization, leads to develop better disease models for understanding the biochemical pathways and also in drug discovery.
(56) Non enzymatic glycation of the proteins is a characteristic feature of aging and diseases like diabetes. This reaction leads to the formation of advanced glycation endproducts on the proteins leading to prolific damage to their structural integrity. Advanced glycation end-products have been shown to exhibit very strong fluorescence as the degree of glycation enhances. The change in fluorescence intensity can serve as a probe to explain the alterations occurring in the native state protein and also provides information on the degree of damage done to the protein.
(57) The augmentation of fluorescence from glycated protein was observed by screening the fluorescence emission by excitation in UV-A region at 340 nm as well as visible region at 435 nm. Oxidative stress, tobacco smoking and weakened detoxification of AGE precursors have also been reported as some of the reasons for increase in AGE production. Another risk factor for high AGE production is a diet with high sugar content. Increased AGE levels have also been observed to be major biomarkers in pathophysiology of various degenerative diseases. Compared to sugars like glucose and sucrose, the dicarbonyl intermediates are much more reactive. The rate of AGE formation depends on the rate of sugar breakdown into highly reactive intermediates like methyl glyoxal which in turn depends on many intrinsic and extrinsic factors like defective glycolysis pathway, enzymatic peroxidation, deficiency of triose phosphate isomerase, smoking and consumption of high sugar diet.
(58) Steady state fluorescence emission spectra were recorded from intact human lenses by excitation at 340 and 435 nm. At 340 nm, the shape and emission maxima were the same in case of non-diabetic lenses but showed a red shift in case of diabetic lenses. However, with increasing excitation wavelength, the peak emission gradually shifted to longer wavelengths. At 435 nm, fluorescence was observed only in the case of lenses from diabetic donors but not in the non-diabetics. Steady state fluorescence measurements give valuable information about the spectral profiles. Fluorescence is dependent on various factors like concentration of the fluorophores, optical density and instrumental parameters which are not constant for all the samples. One disadvantage of using fluorescence intensities as a standard is the possibility of inner filter effect or self-quenching, especially in case of intact lenses where the protein concentration is very high and the concentration of AGEs increases with age and diabetes.
(59) A better and more reliable alternative is to measure the lifetimes of AGE fluorophores. The fluorescence lifetime is an intrinsic molecular property which is independent of concentration, hence, gives a consistent, dynamic depiction of the fluorophores. Measuring the fluorescence lifetimes is valuable as the fluorescence decay occurs at a nanosecond time scale and is highly influenced by the interacting molecules as well as their microenvironments. The time resolved fluorescence decay lifetimes are very specific and also helps analysis of multiple parameters.
(60) At the excitation wavelength of 340 nm, the emission spectra from glycated α-crystallin has shown a red shift of the emission maxima from 420 nm to around 445 nm with increase in extent of glycation. The shift in the fluorescence emission maxima with time has always been attributed to the formation of new crosslinks within the protein which affects its conformation and in turn the orientation of the fluorophores in their micro-environments. The fluorescence decay observed when the excitation wavelength is 340 nm can be fitted to a sum of three exponential functions.
(61) There are various fluorophores which include photo-degradation products of tryptophan like N-formyl kynurenine, anthranilic acid, kynurenine, 3-hydroxykynurenine, harmane and several advanced glycation end-products. Further, evidence shows that AGEs exhibit photosensitizer activity in the UV region leading to the rapid oxidation of tryptophan. All of these fluorophores have very similar, overlapping spectral profiles and hence can be contributing to the increase in fluorescence intensity with the time of glycation. However, fluorescence lifetimes are highly dependent on the quantum yields and the lifetimes obtained from the fit might be from the tryptophan oxidation products.
(62) With excitation wavelength at 435 nm and an emission maxima between 500-510 nm, the influence of tryptophan on the spectral profiles is shown. However, a characteristic difference in the fluorescence intensity was observed between non-diabetic and diabetic lenses which follows the trend observed in unmodified and glycated α-crystallin. By exciting the diabetic lenses at 435 nm, a significant difference in contribution and also an occurrence of new lifetimes was observed. The appearance of new lifetimes with increase in age or disease progression in diabetic lens might be due to the formation of extensive AGE cross-links along with other post-translational modifications.
(63) While, the fundus auto-fluorescence lifetimes are valuable information, these values are dominated by contributions from A2E, FAD and NADH which are characteristic of age related macular degeneration. The auto-fluorescence emission from the crystalline lens itself acts as an obstruction for screening the fundus and leads to decrease in fundus autofluorescence (FAF) signal due to back scattering. On the other hand, the fluorescence lifetimes collected from the lens will be primarily from AGE emission without any spectral interference from the connective tissue making it an effective diagnostic tool for diabetes and other diseases associated with AGE formation. The fluorescence lifetimes of glycated α-crystallin was measured as a protein model and similar consistent results were observed in the human donor lenses. The exact chemical nature of the dominant fluorophores when excited in the visible region is examined Lens auto-fluorescence lifetimes promises to be a very sensitive, noninvasive biomarker for early diagnosis of diabetic eye diseases.
(64) Amplified concentrations of glycating agents in the body cause modifications in glycoproteins as well as heat shock proteins which is a characteristic feature of aging and diseases like diabetes, cancer and Alzheimer's. The incubation of α-crystallin with different glycating agents leads to the formation of aggregates over a period of time which varies between minutes to years. The aggregates are associated with the destruction of native state α-crystallin and formation of AGEs which are initiated by the condensation of basic amino acids and sugars to form Schiff's bases which undergo rearrangement to form Amadori products.
(65) Dynamic Light scattering (DLS) uses visible light to measure the time dependent fluctuations in the scattering intensity to determine the translational diffusion coefficient (D.sub.T), and hydrodynamic radius (R.sub.H) of a particle. The protein solutions have shown very good light scattering ability and the particle size of native state α-crystallin was found to be 18±2 nm. The reaction with methyl glyoxal was rapid and the particle size of the aggregates was around 350 nm within 9 hours (
(66) Aggregation studies were performed by glycating 1 mg/ml bovine α-crystallin with 1M glucose, 1M sucrose, 0.05 M glycolaldehyde and 10 μM methyl glyoxal at 25 oC for different time intervals. The change in particle size, hydrodynamic radius, diffusion coefficients and relaxation times of the dilute glycated protein samples were screened using DLS with a HeNe laser at 633 nm as in
(67) Small angle x-ray scattering (SAXS) was used to measure the correlations between alpha-crystallin proteins. SAXS data is very useful in determining the inter-particle spacing providing insight into the packing of α-crystallin in very high concentrations without super-aggregation or crystallization. At low concentrations alpha crystallin shows a monotonic falloff of intensity with scattering vector q. However, for concentrated suspensions there is a peak that appears around q˜0.4 nm.sup.−1 for concentrations of 100 mg/ml and moves out to around q˜0.5 nm.sup.−1 at concentrations around 300 mg/ml with increasing concentration. SAXS was measured from a 250 mg/ml sample of alpha crystallin which showed a strong peak around q=0.42 nm.sup.−1 (
(68) SAXS data is very useful in determining the inter-particle spacing and hence facilitates understanding the packing of α-crystallin in very high concentrations without super-aggregation or crystallization. Previously, it had been reported that concentrated α-crystallin exhibited a spacing of 14.8 nm by measuring the short range interactions. X-ray diffraction patterns from SAXS of native α-crystallin led to reports that the protein exhibits spherical symmetry. Using 250 mg/ml pure α-crystallin has yielded a single reflection pattern at a Q.sub.max of 0.042/Å which corresponds to a spacing value of 14.9 nm as shown in
(69) The ANS dye is a valuable tool for the detection of protein surface hydrophobicity. Usually, the dye has a low fluorescence yield, which is greatly enhanced on interaction with hydrophobic surfaces. From the experimental data as shown in
(70) Progressive loss of soluble α-crystallin, associated with increased hydrophobicity and formation of aggregates is responsible for increasing the lens stiffness. Heat induced denaturation of α-crystallin may be an important factor in the etiology of presbyopia. However, considering the physiological conditions, non-enzymatic glycation seems to be the main culprit. Cataract and presbyopia can produce myopia due to a change in the refractive index of the crystalline lens of the eye. The presence of high molecular weight aggregates and also advanced glycation end-products lead to a change in both the scattering intensities as well as the spectroscopic properties of the lens. Due to change in refractive index of the lens, the angle of the refracted light changes leading to several focal points in close proximity on the retina causing chromatic aberrations.
(71) Change in solubility parameters of the lens proteins with increase in time of glycation have been studied by screening the change in water and urea soluble portions using UV-Vis spectrophotometry at 280 nm.
(72) Cataract and presbyopia can produce myopia due to a change in the refractive index of the crystalline lens of the eye. The refractive index of native α-crystallin which is close to that of water also changes as shown in
(73) Tryptophan has a very strong fluorescence in proteins. The residues which are buried in the hydrophobic core of proteins can have spectra which are shifted by 10 to 20 nm compared to tryptophans on the surface of the protein. Tryptophan fluorescence can be quenched due to microenvironments. The magnitude of fluorescence intensity is a probe to explain the perturbations occurring in the native state. The wavelength maxima of tryptophan fluorescence shifted on modification indicating a change in the microenvironment which was confirmed by surface hydrophobicity measurements (
(74) Another aspect of tryptophan fluorescence spectral profiles is a shift in the isosbestic point of the spectra. Usually, the presence of an isosbestic point indicates that only two species that vary in concentration contribute to the absorption around the isosbestic point. If a third molecule is participating in the process, the spectra typically intersect at varying wavelengths as concentrations change, creating the impression that the isosbestic point is “out of focus”, or that it will shift as conditions change. The reason for this is that the different compounds have varying extinction coefficients at one particular wavelength. Tryptophan oxidation products have spectral profiles similar to AGEs with varying extinction coefficients. This helps explain the decrease in tryptophan fluorescence with increase in the time of glycation.
(75) The rate of AGE formation depends on the rate of the formation of highly reactive intermediates due to defective glycolysis pathway and consumption of high sugar diet. The change in AGE fluorescence with decrease in tryptophan fluorescence can be observed in
(76) Tryptophan (Trp) lifetime measurements can be used to provide information about the changes in the microenvironments. Tryptophan fluorescence is a very valuable tool that can be applied to study folding/unfolding, the effect of environment and solvent exposure on the integrity of the protein. The fluorescence lifetimes of tryptophan can be used to analyze the location of tryptophan and the possibility of short range interactions. The inventors have shown that the fluorescence of α-crystallin is predominantly due to the Trp 9 in both A and B chains while the Trp 60 present in the B chain is buried from exposure. However, after the process of glycation begins, the tryptophans appear to become completely exposed to the surrounding aqueous medium. This can be confirmed from the lifetime measurements as in Table 2, no change were observed in the lifetimes with time of glycation. The tryptophan residues may undergo a shift in their position after once the protein starts to unfold and aggregate leading to the formation of water insoluble residues.
(77) The Trp residues in peptides generally show fluorescence emission spectra, with a peak around the 340-370 nm region, similar to the Trp residues in aqueous media or in fully denatured proteins. However, interaction of peptides possessing Trp residues with proteins would result in diminished exposure of the peptide Trp (as seen in Trp 60) to the aqueous environment with a concomitant blue shift in the fluorescence emission maxima. Simulation studies have shown that, although Trp 60 is exposed to solvent in the α-B subunit, it is buried in the dimer models, located at the interacting interface of the subunits. Using LCMS and isotopic labeling, reports have shown that K70, K88, K92, K99, K103, K145, K150 and K166 are the lysine glycation targets on α-crystallin. R12, R21, R54, R65, R69, R103, R112, R117, R119, R157 and R163 are arginine glycation sites on α-crystallin. Based on these target sites of glycation, modifications may occur within the vicinity of the tryptophan (Trp 60) exposing it to different microenvironments as they are chemically modified.
(78) Approximate molecular masses of modified and unmodified bovine α-crystallin samples were determined using Static Light Scattering (SLS). A Zimm plot was constructed from the light scattering intensities obtained at multiple angles (10, 20, 30, 40, 50, 60, 70, 80, 95, 100, 110 and 120) and different concentrations (0.125, 0.25, 0.5 and 1 mg/ml) to obtain the approximate molecular weights (
(79) Secondary structure is determined by circular dichroism spectroscopy in the “far-UV” spectral region (190-250 nm). At these wavelengths the chromophore is the peptide bond, and the signal arises when it is located in a regular, folded environment. α-crystallin is mainly made of beta sheets and hence the signal is observed as a downward trough at around 220 nm. With increase in period of glycation, unfolding occurs leading to formation of random coil (
(80) Tryptophan
(81) One of the major fluorophores in proteins is tryptophan. With increase in glycation, tryptophan fluorescence decreases (
(82)
(83) Time-resolved fluorescence measurements were analyzed from the fluorescence decay assuming that the model followed a triple exponential fit. In the case of 340 and 370 nm excitation, one or two exponential functions did not provide an acceptable fit, as judged by autocorrelation, number of weighted residuals and Durbin Watson parameters. The lifetimes and their relative contributions were determined at excitation wavelengths—340 and 370 nm as seen in Tables 8 and 9. The overall fluorescence lifetimes were longer for excitation at 370 nm but they did not change with time of glycation in either cases. Table 2 shows the fluorescence lifetimes from unmodified and modified α-crystallin at an excitation wavelength of 435 nm. There are noticeable trends in the lifetimes with glycation of the protein. In the visible region, unmodified α-crystallin showed no fluorescence and therefore, no lifetimes. However, for glycated α-crystallin, new shorter and longer lifetimes were observed with increase in the time of glycation.
(84) Steady state and time resolved fluorescence measurements were collected from intact non-diabetic and diabetic lenses ranging from 6 to 92 year old donors. An illustration of difference in the spectral profiles from donor lenses of 3 different age groups can be seen in
(85) Amplified concentrations of glycating agents in the body cause modifications in glycoproteins as well as heat shock proteins which is a characteristic feature of aging and diseases like diabetes, cancer and Alzheimer's. AGE formation was evaluated in vitro through incubation of α-crystallin with various glycating agents, for example glucose, sucrose, glycolaldehyde (GA) and methyl glyoxal (MGO). Tryptophan and AGE fluorescence was used to evaluate α-crystallin damage. \
(86) The protein solutions have shown very good light scattering ability and the particle size of native state α-crystallin was found to be 18±2 nm. When incubated with glucose and sucrose, there was no effect on the particle size of α-crystallin over a period of 5 weeks. With glycolaldehyde, the particle size slowly increased from 18 to 350 nm over a period of 5 weeks when incubated at 25° C. The reaction with MGO was relatively faster and the particle size of the aggregates was around 350 nm within 9 hours (
(87) A large increase in the molecular weight of α-crystallin was followed using static light scattering (
(88) Increase in temperature is associated with thermal aggregation as well as increase in the spacing. The effect of glycation on short range interactions and spacing, X-ray scattering profiles of 250 mg/ml α-crystallin glycated with 10 μM methyl glyoxal were studied as shown in
(89) Molecular chaperones are a class of proteins which help in the refolding of unfolded proteins to their native state. In the absence of chaperones, these unfolded proteins may mutually associate via exposed hydrophobic regions and precipitate out of solution. Chaperones have an important role in protein folding and refolding by stabilizing the unfolded proteins, hence protecting them from stress conditions. α-crystallin has been shown to function as a molecular chaperone in preventing thermal aggregation of crystallins and other proteins. ANS fluorescence for surface hydrophobicity has been used for the spectroscopic investigation of the high molecular weight complex formed as a result of glycating bovine α-crystallin The surface hydrophobicity increases with the time of glycation providing more hydrophobic surfaces. The chaperone ability of methyl glyoxal modified α-crystallin increases initially. However, with increased time of glycation, the protein aggregates, loses its structural integrity and chaperone ability. As a result, other lens proteins are easily prone to stress leading to their damage. Structural results disclosed herein explain the loss of chaperone activity reported by others, thereby establishing the relation between structure and function of alpha crystallin.
(90) The formation of aggregates, change in inter-particle spacing and decreased protein diffusivity also affect the physicochemical parameters of the proteins. The intricate complexation and arrangement of α-crystallin is responsible for the transparency of the lens.
(91) Far UV circular dichroism (CD) spectra reflect the changes in secondary structure of the proteins. Both the native state and glycated α-crystallin showed a minimum at 217 nm which indicates beta sheets (
(92) Tryptophan has a very strong fluorescence in the proteins. The residues which are buried in the hydrophobic core of proteins can have spectra which are shifted by 10 to 20 nm compared to tryptophans on the surface of the protein. Tryptophan fluorescence is quenched due to microenvironments. In case of α-crystallin, the unmodified protein seems to have more fluorescence than the modified as shown in
(93) There is a shift in the isosbestic point of the spectra. Usually, the presence of an isosbestic point indicates that only two species that vary in concentration contribute to the absorption around the isosbestic point. If a third molecule is participating in the process, the spectra typically intersect at varying wavelengths as concentrations change, creating the impression that the isosbestic point is ‘out of focus’, or that it will shift as conditions change. The reason for this is that the different compounds have varying extinction coefficients at one particular wavelength. Tryptophan oxidation products have spectral profiles similar to AGEs with varying extinction coefficients. Tryptophan fluorescence decreased with increase in the time of glycation.
(94) Advanced glycation end-products have a characteristic fluorescence and are excited in the spectral region of tryptophan emission. Generation of AGEs can be associated with oxidative stress, tobacco smoking and weakened detoxification of AGE precursors. Compared to sugars like glucose and sucrose, the dicarbonyl intermediates cause a lot of damage. This indicates that the rate of AGE formation also depends on the rate of breakdown of sugars into the highly reactive intermediates which in turn is dependent on many intrinsic and extrinsic factors. The change in AGE fluorescence with decrease in tryptophan fluorescence can be observed in
(95) Tryptophan (Trp) lifetime measurements is used to give a rough idea about the changes in the microenvironments. Tryptophan fluorescence is a very valuable tool that can be applied to study folding/unfolding, the effect of environment and solvent exposure on the integrity of the protein. The fluorescence lifetimes of tryptophan can be used to analyze the location of tryptophan and the possibility of short range interactions. Fluorescence of α-crystallin is predominantly due to the Trp 9 in both A and B chains while the Trp 60 present in the B chain is buried from exposure. However, after the process of glycation begins, the tryptophans are completely exposed to the surrounding aqueous medium. This can be confirmed from the lifetime measurements as in Table 5, no change was observed in the lifetimes with time of glycation. However, the measurements hint at a possibility that the tryptophan residues undergo a shift in their position once the protein starts to unfold and aggregate leading to the formation of water insoluble residues.
(96) Predicted flow velocity is extremely slow considering the nutrients transported increase the viscosity of the fluid. This is in tune with the very low diffusion coefficient data obtained from dynamic light scattering data. Glucose and sucrose pass through the lens but do not spontaneously react with the proteins. On the other hand, glycolytic intermediates like methyl glyoxal are extremely reactive and start forming Schiff's bases when they come in contact with the protein and instantaneously lead to the formation of AGEs. Also, the aggregates cause an irreparable damage to the intricate protein network causing opacification which is most commonly observed in case of cataracts.
(97) Non enzymatic glycation of the proteins is a characteristic feature of aging and diseases like diabetes.
(98) The main contributing fluorophore when excited in the UV region is reported to be argpyrimidine. The effect of different microenvironments on the emission spectrum and fluorescence lifetimes explains the red shift. However, the fluorescence lifetimes did not change with time of glycation. This shows that the fluorescence lifetimes measured in this region are not affected by glycation.
MATERIALS AND METHODS
(99) Methyl glyoxal was purchased from Sigma Aldrich. Fresh bovine lenses were obtained from the Aurora meat packing company, Illinois. Whole human donor lenses were obtained from the Eye Bank within 2 days after death. The lenses from donor age range of 40-90 years were used for this study. The lenses were stored at −70° C. in the dark till the day of use.
(100) A) Extraction of Bovine Alpha Crystalline:
(101) Fresh bovine lenses were weighed and then homogenized by stirring in a buffer prepared using 50 mM Tris/0.2 M NaCl/1 mM EDTA/10 mM mercaptoethanol, pH 7.4 at 4° C. The supernatant was centrifuged at 14000 g for 1 hr. at 4° C. Alpha-crystallin was isolated from the total soluble lens protein solution by size exclusion chromatography. A total of 30 ml supernatant was loaded on a 1.7 cm×100 cm CL-6B sepharose gel filtration column, and using a peristaltic pump, eluted at a flow rate of 1 ml/min and monitored by absorbance at 280 nm. Alpha crystallin elutes first as a single symmetrical peak at approximately 170 ml of the buffer corresponding to an apparent molecular mass of 800 KDa. The isolated a crystallin fractions were pooled and desalted with Ultrafree-15 Biomax-10K centrifugal filter devices (Millipore Corporation, Bedford, Mass.) at a speed of 3000 rpm by rinsing three times with water. The purity of the sample was determined by SDS-PAGE with the Pharmacia LKB*Phast System and by mass spectrometry (45).
(102) B) Sample Preparation:
(103) Bovine alpha crystallin was used as the model protein to study the progression of glycation. Methyl glyoxal (MGO) was used as the glycating agent at a concentration of 2.5 μM in 1 mg/ml alpha crystallin solution and incubated at 25° C. over a period of 60 days. The aliquots were collected at regular intervals and dialyzed against 10 mM phosphate buffer, pH 7.4.
(104) C) Steady State Fluorescence Measurements:
(105) The AGE fluorescence of unmodified and methyl glyoxal modified alpha-crystallin was measured using Hitachi F2500 Fluorescence Spectrometer. The fluorescence emission spectrum of the samples was recorded using 340 and 435 nm as excitation wavelength maintaining the slit widths at 5 nm and PMT voltage of 400V. The same procedure was repeated using the whole donor lenses to study the spectral properties of the fluorophores.
(106) D) Time Resolved Fluorescence Measurements:
(107) The lifetime profiles for the fluorescence decay of fluorophores in unmodified and modified alpha crystallin (10 mM phosphate buffer at pH 7.4) were measured in triplicate by using TimeMaster™ LED system (TM-2000). The samples were excited in UV-A region at 340 nm and in visible region at 435 nm using a LED light source having approximately 1.5 ns pulse width. The time domain system was used to measure the decay in fluorescence with respect to time. The raw decay data was analyzed using global 1 to 4 three exponential fitting analysis with deconvolution which gives the lifetimes as well as the relative contributions to the total fluorescence at time zero. These data were assessed with a good auto correlation function around zero, weighted number of residuals randomly distributed between +3 and −3, reduced .sup.2 values between 0.9 to 1.1 and the Durbin-Watson parameters of greater than or equal to 1.6, 1.7 and 1.8 for one, two and three exponential decay respectively. Once the lifetimes were obtained using the model protein, the procedure was extended to measure the fluorescence lifetimes of the intact lenses of diabetic and non-diabetic donors. The donor lenses were positioned parallel to excitation source and the emission was detected at right angles to the excitation beam.
(108) Methyl glyoxal was purchased from Sigma Aldrich. Fresh calf lenses were obtained from the Brown Packing Co. (South Holland, Ill.).
(109) E) Extraction of Bovine Alpha Crystallin:
(110) Fresh calf lenses were weighed and then homogenized by stirring in a buffer prepared using 50 mM Tris/0.2 M NaCl/1 mM EDTA/10 mM mercaptoethanol, pH 7.4 at 4° C. The supernatant was centrifuged at 14000 g for 1 hr at 4° C. α-crystallin was isolated from the total soluble lens protein solution by size exclusion chromatography. A total of 30 ml supernatant was loaded on a 1.7 cm×100 cm CL-6B sepharose gel filtration column, and using a peristaltic pump, eluted at a flow rate of 1 ml/min and monitored by absorbance at 280 nm. Alpha crystallin elutes first as a single symmetrical peak at approximately 170 ml of the buffer corresponding to an apparent molecular mass of 800 KDa. The isolated α crystallin fractions were pooled and desalted with Ultrafree-15 Biomax-10K centrifugal filter devices (Millipore Corporation, Bedford, Mass.) at a speed of 3000 rpm by rinsing three times with water. The purity of the sample was determined by SDS-PAGE with the Pharmacia LKB*Phast System and by mass spectrometry.
(111) F) Sample Preparation:
(112) Bovine α-crystallin was used as the model protein to study the progression of glycation. Methyl glyoxal (MGO) was used as the glycating agent at a concentration of 10 μM in 1 mg/ml alpha crystallin solution and incubated at 37° C. over a period of 9 hours. The aliquots were collected at 0.5, 1, 3, 6, 9 hr. The samples were dialyzed against 10 mM phosphate buffer, pH 7.4, lyophilized and reconstituted with 1 ml of MQ water before measurements.
(113) G) Dynamic Light Scattering Measurements (DLS)
(114) Particle sizes, and particle cluster sizes were measured using DLS on a Brookhaven BI-200SM Research Goniometer and Laser Light Scattering System. For a spherical particle diffusing through a solution of viscosity η the intensity correlation function (g.sub.2) measured through DLS decays with an exponential relaxation rate, g.sub.2(t)=1+β exp(−2Γt). The particle size can be obtained from the decay rate via R=k.sub.BTq.sup.2/6πηΓ. Here k.sub.B is Boltzmann's constant, T is the temperature and
(115)
is the scattering vector of the laser light scattered at θ=90° and λ=632 nm.
(116) For a suspension consisting of a mixture of particles of varying size the distribution of sizes can be obtained from an inverse Laplace transform. We used the CONTIN software package to obtain particle size distributions in this manner. The accuracy of the distributions was determined based on the polydispersity and the baseline difference from the correlation curve.
(117) H) Surface Hydrophobicity Measurements
(118) The surface hydrophobicity of the native and MGO modified alpha crystallin was studied using a specific hydrophobic probe, 1-anilinonaphthalene-8-sulfonic acid (ANS). Ten microliters of a 10 mM methanolic solution of ANS was added to 1 mL of protein [0.1 mg/mL in 10 mM phosphate buffer (pH 7.4)], and the mixture was incubated for 1 hr in the dark at 25° C. Fluorescence emission spectra were recorded between 400 and 600 nm using an excitation wavelength of 370 nm. The excitation and emission band-passes were 5 nm each.
(119) I) Small Angle X-Ray Scattering Measurements
(120) Concentrated samples of alpha crystallin and glycated alpha crystallin have been studied using SAXS. These studies were performed at the 8-ID-I beam line of the Advanced Photon Source at Argonne National labs, IL. The sample in a sealed capillary was placed in the beam line under vacuum. Coherent X ray photons of energy 7.35 keV were focused using a Kinoform lens placed upstream of the sample. The scattered photons were detected by a PI LCX-1300 direct detection CCD (Princeton Instruments, USA) 4.0 m downstream of the sample. A single camera width spans about 0.3 nm.sup.−1 in the scattering vector (Q) space. The intensities were measured at 6 overlapping camera widths covering a Q range from 0.1-1 nm.sup.−1. For a given camera position, 20 frames were collected with an exposure time of 0.2 s for each frame. The shorter exposures of 0.2 s and moving the beam spot to a different location and camera to a new position helps to minimize the radiation damage caused by the X-ray beam. The resulting image pixels were analyzed by a MATLAB GUI to obtain the time averaged intensity profiles as a function of the scattering vector. The inter-particle distance between the sub-units can be determined from scattering vector Q using Q.sub.max=2π/d; where, d=distance between adjacent sub-units.
(121) J) Steady State Fluorescence Measurements:
(122) The tryptophan fluorescence of unmodified and methyl glyoxal modified α-crystallin was measured using Hitachi F2500 Fluorescence Spectrometer. The fluorescence emission spectrum of the samples was recorded between 300-700 nm using 295 nm as excitation wavelengths maintaining the slit widths at 2.5 nm and PMT voltage of 400V.
(123) K) Time Resolved Fluorescence Measurements
(124) The lifetime profiles for the tryptophan fluorescence decay in unmodified and modified alpha crystallin (10 mM phosphate buffer at pH 7.4) were measured by using TimeMaster™ LED system (TM-2000). The samples were excited at 295 nm using a LED light source having approximately 1.5 ns pulse width. The time domain system was used to measure the decay in fluorescence with respect to time. The raw decay data was analyzed using global 1 to 4 three exponential fitting analysis with deconvolution which gives the lifetimes as well as the relative contributions to the total fluorescence at time zero. These data were assessed with a good auto correlation function around zero, weighted number of residuals randomly distributed between +3 and −3, reduced .sup.2 values around 0.9 to 1.1.
(125) TABLE-US-00001 TABLE 1 Time resolved fluorescence lifetimes from glycated α-crystallin by excitation at 340 nm and emission maxima between 420-440 nm. Time of glycation Durbin - with MGO Lifetimes, (ns) and relative contributions at time zero, A (%)
Watson (days) A.sub.1
A.sub.2
A.sub.3
value parameter Control 70.5 ± 1.5 0.5 ± 0.04 18.9 ± 1.9 2.4 ± 0.02 10.6 ± 3.2 7.2 ± 0.17 0.96 1.83 10 65.5 ± 1.4 0.6 ± 0.15 22.1 ± 1.2 2.2 ± 0.3 12.4 ± 0.8 7.2 ± 0.5 1.04 1.87 20 54.8 ± 2.9 0.6 ± 0.01 29.5 ± 1.7 2.5 ± 0.07 15.7 ± 1.2 7.6 ± 0.02 0.98 1.8 30 49.8 ± 2.9 0.7 ± 0.08 34 ± 2.7 2.8 ± 0.3 16.2 ± 2.8 7.9 ± 0.32 1.031 1.92 40 45.3 ± 0.1 0.5 ± 0.1 37.7 ± 2.1 2.3 ± 0.2 17 ± 0.95 7.9 ± 0.1 1.002 1.94 50 34.9 ± 1.1 0.7 ± 0.1 45.2 ± 1.2 2.4 ± 0.3 19.9 ± 0.7 7.85 ± 0.5 0.954 1.81 60 28.8 ± 4.5 0.76 ± 50.1 ± 3.2 2.78 ± 0.4 21.1 ± 1.7 8 ± 0.6 0.97 2.01
(126) TABLE-US-00002 TABLE 2 Time resolved fluorescence lifetimes from glycated α-crystallin by excitation at 435 nm and emission maxima between 500-510 nm. Time of glycation Durbin - with MGO Lifetimes, (ns) and relative contributions at time zero, A (%)
Watson (days) A.sub.1
A.sub.2
A.sub.3
value parameter Control — — — — — — — — 10 — — 100 4.7 ± 0.04 — — 0.999 1.635 20 — — 96.11 ± 1.6 4.76 ± 0.2 3.89 ± 0.06 19.5 ± 1.7 0.985 1.75 30 44.1 ± 0.3 1.67 ± 0.1 20.1 ± 0.2 4.51 ± 0.09 35.8 ± 0.6 17.6 ± 0.5 1.07 1.81 40 45.1 ± 0.2 1.6 ± 0.11 19.7 ± 0.31 4.6 ± 0.04 35.2 ± 0.01 17 ± 0.6 1.075 1.871 50 58.2 ± 0.2 1.4 ± 0.43 30.1 ± 0.3 4.6 ± 0.14 11.8 ± 2.7 16.7 ± 0.3 1.03 1.85 60 51.6 ± 0.2 1.5 ± 0.31 42.3 ± 0.64 4.4 ± 0.43 6.07 ± 0.3 15.6 ± 1.4 0.987 1.961
(127) TABLE-US-00003 TABLE 3 Summary for time resolved fluorescence lifetimes from human donor lenses by excitation at 340 nm and emission maxima between 420-440 nm. Durbin - Types of Lifetimes, (ns) and relative contributions at time zero, A (%)
Watson donor lens A.sub.1
A.sub.2
A.sub.3
value parameter Non-diabetic 52-65% 0.62 ± 0.1 20-33% 2.6 ± 0.14 13-21% 7.6 ± 0.2 1.04 1.97 (n = 35) Diabetic 38-49% 0.66 ± 0.1 37-45% 2.3 ± 0.1 12-19% 7.6 ± 0.12 1.01 1.9 (n = 9)
(128) TABLE-US-00004 TABLE 4 Summary for time resolved fluorescence lifetimes from human donor lenses by excitation at 435 nm and emission maxima between 500-510 nm. Durbin - Types of Lifetimes, (ns) and relative contributions at time zero, A (%)
Watson donor lens A.sub.1
A.sub.2
A.sub.3
value parameter Nondiabetic* — — — — — — — — (<45 year) (n = 10) Nondiabetic — — 100 4.76 ± 0.02 — — 0.967 2.14 (>45 year) (n = 34) Nondiabetic — — 58.1 ± 0.5 4.6 ± 0.14 41.9 ± 0.2 16.2 ± 0.05 0.992 1.76 (>45 year) (n = 4) Diabetic 37.1 ± 4.8 1.6 ± 0.07 33.9 ± 5.2 4.3 ± 0.02 29 ± 2.6 15.1 ± 0.01 0.985 2.06 (>45 year) (n = 5) *No disease conditions and ocular history.
(129) TABLE-US-00005 TABLE 5 Changes in tryptophan lifetimes of α-crystallin after incubating with using 10 μM methylglyoxal over a period of 9 h at 25° C. Lifetimes, τ (ns) and relative Time of glycation with contributions at time zero, A (%) methyl glyoxal (h) A.sub.1 τ.sub.1 A.sub.2 τ.sub.2 A.sub.3 τ.sub.3 value 0 16.1 1.3 53.4 4.3 30.5 9.6 0.97 0.5 12.3 1.5 48.5 4 39.2 9.8 1.11 1 14.7 1.5 44.4 5 40.9 9.8 1.08 3 16.1 1.7 42.3 4.9 39.5 9.8 1.21 6 17.4 1.8 48.2 4.9 34.4 10 1.01 9 18.2 2.3 43.7 3.5 40.2 10 0.99
(130) TABLE-US-00006 TABLE 6 Sequences MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFY LRPPSFLRAPSWFDTGLS[EMRLEKDRFSVNLDVKHFSPEELKVKVLG DVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVL TVNGPRKQVSGPERTIPI]TREEKPAVTAAPKK Black bold—αA- crystallin recognition sites on αB- crystallin Underline—chaperone site Bracketed—α -crystallin domain (Sreelakshmi, Santhoshkumar, Bhattacharyya, & Sharma, 2004)
(131) TABLE-US-00007 TABLE 7 Criteria for the diagnosis of diabetes and of increased risk for diabetes [pre-diabetes]/Impaired Fasting Glucose [IFG] adopted from ADA- Clinical Practice Recommendations [Diabetes Care, 36 [S1], 2013 ADA Goal for Diagnosis of Increased risk Diabetes Test* Diabetes [Prediabetes]/IFG HbA1c ≥6.5% 5.7-6.4% Using a method certified by NGSP and standardized to the DCCT assay. or Fasting Plasma Glucose ≥126 mg/dL 100-125 mg/dL Fasting is defined as no (7.0 mmol/L) (6.9 mmol/L) caloric intake for at least 8 hours. or 2 Hour Plasma Glucose ≥200 mg/dL 140-199 mg/dL [OGTT] The test should be (11.1 mmol/L) (7.8-11.0 mmol/L) performed as described by the WHO, using a glucose load containing the equivalent of 75 g anhydrous glucose dissolved in water.
(132) TABLE-US-00008 TABLE 8 Time resolved fluorescence lifetimes from glycated alpha crystallin by excitation at 340 nm and emission maxima between 420-440 nm Time of glycation with Lifetimes, (ns) and Durbin - MGO Relative contributions at time zero, A (%) Watson (days) A.sub.1
A.sub.2
A.sub.3
value parameter Control 70.5 ± 1.5 0.5 ± 0.04 18.9 ± 1.9 2.4 ± 0.02 10.6 ± 3.2 7.2 ± 0.17 0.96 1.83 10 65.5 ± 1.4 0.6 ± 0.15 22.1 ± 1.2 2.2 ± 0.3 12.4 ± 0.8 7.2 ± 0.5 1.04 1.87 20 54.8 ± 2.9 0.6 ± 0.01 29.5 ± 1.7 2.5 ± 0.07 15.7 ± 1.2 7.6 ± 0.02 0.98 1.8 30 49.8 ± 2.9 0.7 ± 0.08 34 ± 2.7 2.8 ± 0.3 16.2 ± 2.8 7.9 ± 0.32 1.031 1.92 40 45.3 ± 0.1 0.5 ± 0.1 37.7 ± 2.1 2.3 ± 0.2 17 ± 0.95 7.9 ± 0.1 1.002 1.94 50 34.9 ± 1.1 0.7 ± 0.1 45.2 ± 1.2 2.4 ± 0.3 19.9 ± 0.7 7.85 ± 0.5 0.954 1.81 60 28.8 ± 4.5 0.76 ± 0.2 50.1 ± 3.2 2.78 ± 0.4 21.1 ± 1.7 8 ± 0.6 0.97 2.01
(133) TABLE-US-00009 TABLE 9 Time resolved fluorescence lifetimes from glycated alpha crystallin by excitation at 370 nm and emission maxima between 440-460 nm. Time of glycation with Lifetimes, (ns) and Durbin - MGO Relative contributions at time zero, A (%) Watson (days) A.sub.1
A.sub.2
A.sub.3
value parameter Control 40.5 ± 1.8 1.1 ± 0.1 39.2 ± 0.1 3.6 ± 0.17 20.3 ± 2.6 10.1 ± 1.7 0.97 1.82 10 41.9 ± 1.4 1.2 ± 0.2 37.9 ± 0.01 3.7 ± 0.14 20.2 ± 0.6 10.6 ± 0.7 0.997 1.945 20 42.8 ± 2.9 1.3 ± 0.31 36.1 ± 1.6 3.67 ± 0.1 21.1 ± 0.7 10.5 ± 1.7 0.99 1.85 30 44.1 ± 0.3 1.16 ± 0.2 34.1 ± 0.2 3.55 ± 0.09 21.8 ± 0.6 10.6 ± 0.5 1.01 1.801 40 45.1 ± 0.2 1.2 ± 0.11 31.7 ± 0.31 3.6 ± 0.24 23.2 ± 0.01 10 ± 0.6 0.985 1.917 50 49.2 ± 0.2 1.0 ± 0.43 29.1 ± 0.3 3.6 ± 0.19 21.7 ± 2.7 10.7 ± 0.3 1.013 1.95 60 51.6 ± 0.2 1.1 ± 0.39 27.3 ± 0.64 3.4 ± 0.41 21.1 ± 0.3 10.6 ± 1.4 0.988 1.9
(134) TABLE-US-00010 TABLE 10 Comparison of time resolved fluorescence lifetimes from 20 yr old non-diabetic and 18 yr old type I diabetic human donor lenses by excitation at 435 nm and emission maxima between 500-510 nm Type Lifetimes, (ns) and Durbin - of donor Relative contributions at time zero, A (%) Watson lens A.sub.1
A.sub.2
A.sub.3
value parameter Non- — — — — — — — — diabetic (20 yr) Diabetic — — 80.4 ± 0.01 4.7 ± 0.07 19.6 ± 0.1 16.9 ± 0.1 0.997 1.981 (18 yr)
(135) TABLE-US-00011 TABLE 11 Comparison of time resolved fluorescence lifetimes from 42 yr old non-diabetic and 42 yr old type II diabetic human donor lenses by excitation at 435 nm and emission maxima between 500-510 nm Type of Lifetimes, (ns) and Durbin - donor Relative contributions at time zero, A (%) Watson lens A.sub.1
A.sub.2
A.sub.3
value parameter Non- — — — — — — — — diabetic (42 yr) Diabetic — — 84.1 ± 2.2 4.2 ± 0.77 15.9 ± 3.2 17.1 ± 0.5 1.073 1.74 (42 yr)
(136) TABLE-US-00012 TABLE 12 Comparison of time resolved fluorescence lifetimes from donor lenses of 56 yr old non-diabetic and 56 yr old with diabetic retinopathy by excitation at 435 nm and emission maxima between 500-510 nm Type of Lifetimes, (ns) and Durbin - donor Relative contributions at time zero, A (%) Watson lens A.sub.1
A.sub.2
A.sub.3
value parameter Non- — — 100 4.5 ± 0.17 — — 1.07 1.79 diabetic (56 yr) Diabetic — — 51.4 ± 0.8 4.6 ± 0.11 48.6 ± 0.2 17 ± 0.17 1.073 1.74 (56 yr)
(137) TABLE-US-00013 TABLE 13 Comparison of time resolved fluorescence lifetimes from donor lenses of 64 yr old non-diabetic and 67 yr old with cataract by excitation at 435 nm and emission maxima between 500-510 nm Type of Lifetimes, (ns) and Durbin - donor Relative contributions at time zero, A (%) Watson lens A.sub.1
A.sub.2
A.sub.3
value parameter Non- — — 100 4.76 ± 0.1 — — 0.992 1.86 diabetic (64 yr) Diabetic 39 ± 1.9 1.4 ± 0.2 41.9 ± 0.5 4.5 ± 0.3 20.1 ± 1.2 15.6 ± 0.9 1.073 1.94 (67 yr)