Antibody capable of binding to influenza virus intranuclear protein, complex, detection apparatus and detection method using same

11214611 · 2022-01-04

Assignee

Inventors

Cpc classification

International classification

Abstract

The present disclosure provides an antibody capable of binding to an intranuclear protein of an influenza virus and an application thereof. The present disclosure provides an antibody capable of recognizing a peptide consisting of the 205th-231st amino acid sequence in SEQ ID NO: 24.

Claims

1. An antibody or antibody derivative comprising a variable domain comprising: (a) a complementarity determining region 1 (CDR1) comprising the amino acid sequence of SEQ ID NO: 1, (b) a complementarity determining region 2 (CDR2) comprising the amino acid sequence of SEQ ID NO: 2, and (c) a complementarity determining region 3 (CDR3) comprising the amino acid sequence of SEQ ID NO: 3; wherein the antibody or antibody derivative is capable of specifically binding to a protein comprising either: (i) amino acid residues 205-231 of SEQ ID NO: 24, or (ii) amino acid residues 220-231 of SEQ ID NO: 24.

2. The antibody or antibody derivative of claim 1, wherein the antibody or antibody derivative does not exhibit antigen cross-reactivity or has low cross-reactivity with an intranuclear protein of influenza virus other than a type-A influenza virus.

3. The antibody or antibody derivative of claim 1, wherein the antibody or antibody derivative does not exhibit antigen cross-reactivity or has low cross-reactivity with a intranuclear protein of type-B influenza virus.

4. The antibody or antibody derivative of claim 1, wherein the antibody or antibody derivative is selected from an Fab derivative, an F(ab′)2 derivative, an Fv fragment derivative and a VHH antibody.

5. The antibody or antibody derivative of claim 2, wherein the type-A influenza virus is selected from type-A influenza virus of subtypes H1N1, H3N2, H5N1, H7N7 and H7N9.

6. The antibody or antibody derivative of claim 2, wherein the antibody or antibody derivative is operably coupled to a carrier.

7. The antibody or antibody derivative of claim 6, wherein the carrier is selected from a plate, a bead, a disk, a tube, a filter, and a thin film.

8. The antibody or antibody derivative of claim 1, wherein the antibody or antibody derivative is operably coupled to a labeling substance.

9. The antibody or antibody derivative of claim 8, wherein the labeling substance is selected from the group consisting of a fluorescent substance, a luminescent substance, a dye, an enzyme, and a radioactive substance.

10. A device for detecting an intranuclear protein of a type-A influenza virus in an analyte, the device comprising: (a) an antibody or antibody derivative of claim 1, said antibody or antibody derivative operably coupled to a carrier or a labeling substance; and (b) a detection apparatus for the detection of a change in a physical quantity associated with the carrier or labeling substance resulting from formation of a complex between the antibody or antibody derivative and the intranuclear protein of a type-A influenza virus in the analyte.

11. The device of claim 10, wherein the detection apparatus comprises an enzyme immunoassay, enzyme-linked immunosorbent assay (ELISA), enzyme immunoassay (EIA), radioimmunoassay (RIA), immunochromatography, latex agglutination, fluorescence immunoassay or surface plasmon resonance measurement.

12. The device of claim 10, wherein the physical quantity is selected from emission intensity, chromaticity, light transmittance, turbidity, absorbance and radiation dose.

13. The device of claim 10, wherein the detection apparatus is selected from photometers, spectrometers and dosimeters.

14. A method for detecting an intranuclear protein of a type-A influenza virus in an analyte, the method comprising: (a) providing an antibody or antibody derivative of claim 1, said antibody or antibody derivative operably coupled to a carrier or a labeling substance; (b) exposing the antibody or antibody derivative of (a) to the analyte under conditions whereby a complex comprising the antibody or antibody derivative and the intranuclear protein of a type-A influenza virus will form, if present; and (c) detecting a change in a physical quantity based on formation of the complex, thereby detecting the intranuclear protein of the type-A influenza virus in the analyte.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1A shows a map of a vector used to ligate various genes contained in a gene library of a VHH antibody.

(2) FIG. 1B shows details of the vector map shown in FIG. 1A.

(3) FIG. 2 shows a vector map used to express the VHH antibody.

(4) FIG. 3A is a graph showing the results of SPR evaluation of the binding ability of a VHH antibody (concentration: 0.78 nM) containing the amino acid sequence represented by SEQ ID NO: 8 to a recombinant intranuclear protein.

(5) FIG. 3B is a graph showing the results of SPR evaluation of the binding ability of the VHH antibody (concentration: 1.56 nM) containing the amino acid sequence represented by SEQ ID NO: 8 to the recombinant intranuclear protein.

(6) FIG. 3C is a graph showing the results of SPR evaluation of the binding ability of the VHH antibody (concentration: 3.125 nM) containing the amino acid sequence represented by SEQ ID NO: 8 to the recombinant intranuclear protein.

(7) FIG. 3D is a graph showing the results of SPR evaluation of the binding ability of the VHH antibody (concentration: 6.25 nM) containing the amino acid sequence represented by SEQ ID NO: 8 to the recombinant intranuclear protein.

(8) FIG. 3E is a graph showing the results of SPR evaluation of the binding ability of the VHH antibody (concentration: 12.5 nM) containing the amino acid sequence represented by SEQ ID NO: 8 to the recombinant intranuclear protein.

(9) FIG. 3F is a graph showing the results of SPR evaluation of the binding ability of the VHH antibody (concentration: 25 nM) containing the amino acid sequence represented by SEQ ID NO: 8 to the recombinant intranuclear protein.

(10) FIG. 4A is a graph showing the measurement results of the cross-reactivity of the VHH antibody containing the amino acid sequence represented by SEQ ID NO: 8 with regard to an influenza virus type A H1N1 A/Hokkaido/11/2002.

(11) FIG. 4B is a graph showing the measurement results of the cross-reactivity of the VHH antibody containing the amino acid sequence represented by SEQ ID NO: 8 with regard to an influenza virus type A H1N1 A/Hyogo/YS/2011.

(12) FIG. 4C is a graph showing the measurement results of the cross-reactivity of the VHH antibody containing the amino acid sequence represented by SEQ ID NO: 8 with regard to an influenza virus type A H1N1 A/Hokkaido/6-5/2014.

(13) FIG. 4D is a graph showing the measurement results of the cross-reactivity of the VHH antibody containing the amino acid sequence represented by SEQ ID NO: 8 with regard to an influenza virus type A H3N2 A/Hokkaido/M1/2014.

(14) FIG. 4E is a graph showing the measurement results of the cross-reactivity of the VHH antibody containing the amino acid sequence represented by SEQ ID NO: 8 with regard to an influenza virus type A H5N1 A/duck/Hokkaido/Vac-3/2007.

(15) FIG. 4F is a graph showing the measurement results of the cross-reactivity of the VHH antibody containing the amino acid sequence represented by SEQ II) NO: 8 with regard to an influenza virus type A H7N7 A/duck/Hokkaido/Vac-2/2004.

(16) FIG. 4G is a graph showing the measurement results of the cross-reactivity of the VHH antibody containing the amino acid sequence represented by SEQ ID NO: 8 with regard to an influenza virus type A 117N9 A/duck/Mongolia/119/2008.

(17) FIG. 4H is a graph showing the measurement results of the cross-reactivity of the VH antibody containing the amino acid sequence represented by SEQ ID NO: 8 with regard to an influenza virus type B B/Hokkaido/30-4/2014.

(18) FIG. 5 shows the results of an antigen binding region analysis of HDX-MS. The result of subtracting the deuterium exchange rate of the complex from the deuterium exchange rate of the monomer is shown. The horizontal axis indicates the peptide number, and the vertical axis indicates the deuterium exchange rate.

DETAILED DESCRIPTION OF THE EMBODIMENT

(19) As used herein, the term “isolated antibody” does not include an antibody that is natural and has not been subjected to any external manipulation (artificial manipulation), namely, an antibody that has been produced in a body of an individual and remained there. Note that an isolated antibody typically exists in a state in which another type of an antibody is not mixed, namely, exists alone (as a group of antibodies of the same type).

(20) In the present specification, “including” includes “consisting of” and “consisting essentially of”.

(21) In one aspect, the present disclosure relates to an isolated antibody capable of recognizing a peptide consisting of the 205th-231st amino acid sequence in SEQ ID NO: 24. More specifically, the present disclosure relates to an isolated antibody capable of recognizing an epitope contained in the peptide consisting of 205th-231st amino acid sequence in SEQ ID NO: 24.

(22) In another aspect, the present disclosure relates to an isolated antibody capable of recognizing a peptide consisting of the 220th-231st amino acid sequence in SEQ ID NO: 24. More specifically, the present disclosure relates to an isolated antibody capable of recognizing an epitope contained in the peptide consisting of the 220th-231st amino acid sequence in SEQ ID NO: 24.

(23) The antibody of the present disclosure recognizes a specific peptide in SEQ ID NO: 24. The present antibody is a polyclonal antibody or a monoclonal antibody, and is not limited to an antibody having the original complete structure as long as it has such a binding activity. For example, all the various derivatives derived from the complete antibody such as Fab, F (ab′)2, or Fv fragment are included in the present antibody. In one embodiment, the antibody of the present disclosure is a VHH antibody.

(24) In one embodiment, the antibody of the present disclosure can be isolated using techniques known to those skilled in the art by using a peptide consisting of the 205th-231st amino acid sequence in SEQ ID NO: 24.

(25) In another embodiment, the antibody of the present disclosure can be isolated using techniques known to those skilled in the art by using a peptide consisting of the 220th-231st amino acid sequence in SEQ ID NO: 24.

(26) The antibody of the present disclosure can be produced by any method known to those skilled in the art using the above-mentioned peptide or a complex of these and an appropriate adjuvant as an immunogen. For example, in the case where the antibody of the present disclosure is a polyclonal antibody, the antibody of the present disclosure can be obtained from serum after immunizing an animal with the above immunogen. Alternatively, the antibody of the present disclosure can be prepared by introducing an expression vector coding for the above-mentioned immunogen into the muscle or skin of an animal by injection or with a gene gun, and then collecting the serum. Examples of the animals that can be used include mice, rats, rabbits, goats, chickens, camels, and alpaca. Monoclonal antibodies can also be prepared by a method in which antibodies are produced by continuous cell culture. Examples of the method are a hybridoma method (Nature, 1975, Vol. 256, p. 495-497), a trioma method, a human B cell hybridoma method (Immunology Today, 1983, Vol. 4, p. 72), and the EBV-hybridoma method (Monoclonal Antibodies and Cancer Therapy, 1985, pp. 77-96, Alan R. Liss, Inc.).

(27) Whether or not the produced antibody binds to the target peptide can be measured by a known means (Antibodies A Laboratory Manual. Ed Harlow, David Lane, Cold Spring Harbor Laboratory, 1988). For example, ELISA (enzyme-linked immunosorbent assay), EIA (enzyme immunoassay), RIA (radioimmunoassay) or fluorescent immunoassay can be used.

(28) The antibody according to the present disclosure binds to a type-A influenza virus. In particular, the antibody according to the present disclosure binds to an intranuclear protein of the type-A influenza virus. As disclosed in Patent Literature 1, an antibody capable of binding to the influenza virus includes an amino acid sequence containing the following structural domain in the N to C direction: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C, where FR indicates an amino acid sequence of a framework region, and CDR indicates an amino acid sequence of a complementarity determining region.

(29) In the present disclosure, for example, CDR1 includes the amino acid sequence represented by GSAFSLYAMG (SEQ ID NO: 1).

(30) In the present disclosure, CDR2 includes the amino acid sequence represented by, for example, YITNGDITNYADSVQG (SEQ ID NO: 2).

(31) In the present disclosure, CDR3 includes the amino acid sequence represented by, for example, VGGRTF (SEQ ID NO: 3).

(32) Desirably, CDR1, CDR2, and CDR3 are represented by, for example, SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3, respectively. In this case, more desirably, FR1, FR2, FR3, and FR4 includes amino acid sequences represented by QLQLVESGGGLVQAGGSLRLSCAAS (SEQ ID NO: 4), WHRQAPGKQRELVA (SEQ ID NO: 5), RVIISRDNAKNTVYLHMNSLKPEDTAVYYCYA (SEQ ID NO: 6), and WGQGTQVTVSS (SEQ ID NO: 7), respectively.

(33) In other words, the antibody according to the present disclosure can include the following amino acid sequence: QLQLVESGGGLVQAGGSLRLSCAASGSAFSLYAMGWHRQAPGKQRELVAYITNGDITNYADSVQGRVIISRDNAKNT VYLHMNSLKPEDTAVYYCYAVGGRTFWGQGTQVTVSS (SEQ ID NO: 8).

(34) An antibody containing the amino acid sequence represented by SEQ ID NO: 8 does not exhibit an antigen cross-reactivity with an influenza virus other than type-A influenza virus, for example, with an influenza virus such as type-B influenza virus. The antibody of the present disclosure may be lyophilized or mixed with a known stabilizer in order to stably store for a long period of time.

(35) The antibody of the present disclosure can be used in a detection apparatus or a detection method for detecting an intranuclear protein of the type-A influenza virus. In this case, the antibody of the present disclosure may be used in a state of a complex bound to another substance, for example, a complex bound to at least one of a carrier and a labeling substance.

(36) The shape and material of the carrier are not particularly limited, as long as it is a carrier insoluble in a solvent in a reaction system of an antigen-antibody reaction. Examples of the shape of the carrier include a plate, a bead, a disk, a tube, a filter, and a thin film. Examples of the material of the carrier include a polymer such as polyethylene terephthalate, cellulose acetate, polycarbonate, polystyrene, or polymethyl methacrylate, a metal such as gold, silver, or aluminum, and glass. As a method for binding the antibody to the carrier, a known method such as a physical adsorption method, a covalent bond method, an ionic bond method, or a crosslinking method is used.

(37) As the labeling substance, for example, a fluorescent substance, a luminescent substance, a dye, an enzyme, or a radioactive substance is used. As a method for binding the antibody to the labeling substance, a known method such as a physical adsorption method, a covalent bond method, an ionic bond method, or a crosslinking method is used.

(38) In the detection method using the antibody of the present disclosure, a complex containing the antibody and an analyte are brought into contact, and a change in physical quantity based on the antigen-antibody reaction of the intranuclear protein of the type-A influenza virus in the analyte and the antibody of the complex is detected. Examples of the physical quantity include emission intensity, chromaticity, light transmittance, turbidity, absorbance, and radiation dose. Specific examples of the detection method include known methods such as enzyme immunoassay, immunochromatography, latex agglutination, radioimmunoassay, fluorescence immunoassay, and surface plasmon resonance measurement.

(39) The detection apparatus using the antibody of the present disclosure includes a detection part for detecting any of the physical quantities that change based on the antigen-antibody reaction. The detection part is composed of well-known apparatuses such as various photometers, spectrometers, and dosimeters.

(40) The antibody of the present disclosure can be used not only as the complex bound to another substance but also as a composition containing the antibody of the present disclosure or a kit including the antibody of the present disclosure.

(41) The present disclosure further provides the followings. (1): an isolated antibody capable of recognizing the peptide consisting of the 205th-231st amino acid sequence in SEQ ID NO: 24; (2): an isolated antibody capable of recognizing an epitope contained in the peptide consisting of the 220th-231st amino acid sequence in SEQ ID NO: 24; (3) an antibody according to (1) or (2), wherein the antibody is a VHH antibody; (4) a complex including any one of (1)-(3), wherein the antibody has been bound to at least one of a carrier and a labeling substance; (5): the complex according to (4), wherein the carrier is selected from a plate, a bead, a disk, a tube, a filter, and a thin film; (6) the complex according to (4), wherein the labeling substance is selected from a fluorescent substance, a luminescent substance, a dye, an enzyme and a radioactive substance; (7): a detection device including the complex according to (4) and a detection part, wherein the detection part detects a change in physical quantity based on an antigen-antibody reaction between the intranuclear protein in an analyte and the complex; and (8): a detection method including a step of bringing the complex according to (4) into contact with an analyte, and a step of detecting a change in physical quantity based on an antigen-antibody reaction between the intranuclear protein in the analyte and the complex.

EXAMPLES

Inventive Example 1

(42) VHH antibodies (i.e., a variable domain of a heavy chain of a heavy chain antibody) were prepared in accordance with the following procedures as a peptide capable of binding to an intranuclear protein included in a type-A influenza virus H1N1. Hereinafter, the intranuclear protein is referred to as “NP”.

(43) (Immunization of Alpaca and Acquirement of Mononuclear) In order to form a VHH antibody gene library, an alpaca was immunized using a recombinant intranuclear protein (SEQ ID NO: 24) derived from a type-A influenza virus H1N1 (A/Puerto Rico/8/34/Mount Sinai) as an antigen. The recombinant intranuclear protein was prepared using a Brevibacillus expression system by Higeta Shoyu Co., Ltd. The recombinant intranuclear protein was prepared with an adjuvant before administrated to an alpaca.

(44) The recombinant intranuclear protein (SEQ ID NO: 24) used in the inventive example 1 is shown below.

(45) TABLE-US-00001 (SEQ ID NO: 24) MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLS DYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRV NGKWMRELILYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDATYQR TRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELVRMIKRG INDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQKAMMDQVRESRNPGN AEFEDLTFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEREGYSLVG IDPFRLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRVLSFIKGT KVLPRGKLSTRGVQIASNENMETMESSTLELRSRYWAIRTRSGGNTNQQR ASAGQISIQPTFSVQRNLPFDRTTIMAAFNGNTEGRTSDMRTEIIRMMES ARPEDVSFQGRGVFELSDEKAASPIVPSFDMSNEGSYFFGDNAEEYDN

(46) Specifically, the recombinant intranuclear protein having a concentration of 100 micrograms/milliliter was administered to the alpaca. After one week, the recombinant intranuclear protein having the same concentration was administered to the alpaca, again. In this way, the alpaca was immunized with the recombinant intranuclear protein five times for five weeks. After another week, blood of the alpaca was extracted. Then, mononuclear cells were acquired from the blood as below.

(47) A blood cell separation solution (available from COSMO BIO Co., Ltd., trade name: Lymphoprep) was added to a lymphocyte separation tube (available from Greiner Bio-One Co., Ltd., trade name: Leucosep). Then, the solution was subjected to centrifugation at a temperature of 20 degrees Celsius at 1,000×g for one minute.

(48) The blood extracted from the alpaca was treated with heparin. Then, an equivalent amount of phosphate buffered saline (hereinafter, referred to as “PBS”) was added to the thus-treated blood to obtain a sample solution. Then, the sample solution was added to the lymphocyte separation tube containing the blood cell separation solution.

(49) The lymphocyte separation tube was subjected to centrifugation at a temperature of 20 degrees Celsius at 800×g for thirty minutes.

(50) A fraction containing the mononuclear cells was collected. PBS three times in volume was added. The fraction was subjected to centrifugation at a temperature of 20 degrees Celsius at 300×g for five minutes. The precipitate was suspended with PBS gently. After the suspending, 10 microliters of the suspension was separated in order for the count of the number of cells. The remaining suspension was subjected to centrifugation at a temperature of 20 degrees Celsius at 300×g for five minutes.

(51) An RNA storage solution (trade name: RNAlater) having a volume of 2 milliliters was added to the precipitate. Then, the solution was suspended gently. The suspension was injected into two tubes each having a volume of 1.5 milliliters. Each tube included 1 milliliter of the suspension. The tube was stored at a temperature of −20 degrees Celsius. The suspension (5 microliters) separated for the count of the number of cells was mixed with a Turk's solution (15 microliters), and the number of the mononuclear cells was counted with a counting chamber.

(52) (Formation of cDNA Gene Library of VHH Antibody)

(53) Then, a total RNA was extracted from the mononuclear cells, and a cDNA gene library of the VHH antibody was formed in accordance with the following procedure. In the following procedure, RNase-free-grade reagents and instruments were used.

(54) A total RNA isolation reagent (trade name: TRIzol Reagent, 1 milliliter) was added to the mononuclear cell fraction. The reagent was mixed gently and left at room temperature for five minutes. Chloroform (200 microliters) was added to the reagent, and the reagent was shaken strongly for fifteen seconds. The reagent was left at rest at room temperature for two-three minutes. The reagent was subjected to centrifugation at not more than 12,000×g at a temperature of 4 degrees Celsius for 15 minutes.

(55) The supernatant was moved to a new tube. RNase-free water and chloroform (200 microliters, each) were added to the tube. In addition, 500 milliliters of isopropanol was added to the tube. The liquid contained in the tube was stirred with a vortex mixer. The liquid was left at rest at room temperature for ten minutes. Then, the liquid was subjected to centrifugation at not more than 12,000×g at a temperature of 4 degrees Celsius for fifteen minutes. The supernatant was removed, and the precipitate was rinsed with one milliliter of 75% ethanol. This solution was subjected to centrifugation at not more than 7,500×g at a temperature of four degrees Celsius for five minutes. The solution was dried to obtain total RNA. The obtained total RNA was dissolved in RNase-free water.

(56) In order to obtain cDNA from the total RNA, a kit including a reverse transcriptase was employed. The kit was available from Takara Bio Inc., as a trade name of PrimeScript II 1.sup.st strand cDNA Synthesis Kit. The Random 6 mer and Oligo dT primer included in the kit were used as primers. The cDNA was obtained in accordance with the standard protocol attached to the kit.

(57) The gene of the VHH antibody included in the alpaca was obtained from the cDNA by a PCR method. An enzyme for PCR was available from Takara Bio Inc., as a trade name of Ex-taq.

(58) The following reagents were mixed to obtain a mixture solution.

(59) TABLE-US-00002 10 × buffer 5 microliters dNTPs 4 microliters Primer F 2 microliters Primer R 2 microliters cDNA template 1 microliter Ex-taq 0.25 microliters

(60) The mixture solution was subjected to the following PCR method.

(61) First, the mixture solution was heated at a temperature of 95 degrees Celsius for two minutes. Then, the temperature of the mixture solution was varied in accordance with the following cycle:

(62) Ninety six degrees Celsius for thirty seconds:

(63) Fifty two degrees Celsius for thirty seconds; and

(64) Sixty eight degrees Celsius for forty seconds.

(65) This cycle was repeated thirty times.

(66) Finally, the mixture solution was heated at a temperature of sixty eight degrees Celsius for four minutes and stored at a temperature of four degrees Celsius.

(67) The following primers were used in the present PCR method.

(68) TABLE-US-00003 Primer 1: (SEQ ID NO: 9) 5′-GGTGGTCCTGGCTGC-3′ Primer 2: (SEQ ID NO: 10) 5′-ctgctcctcgcGGCCCAGCCGGCCatggcTSAGKTGCAGCTCGTGG AGTC-3′ Primer 3: (SEQ ID NO: 11) 5′-TGGGGTCTTCGCTGTGGTGCG-3′ Primer 4: (SEQ ID NO: 12) 5′-TTGTGGTTTTGGTGTCTTGGG-3′ Primer 5: (SEQ ID NO: 13) 5'-tttgCtctGCGGCCGCagaGGCCgTGGGGTCTTCGCTGTGGTG CG-3' Primer 6 (SEQ ID NO: 14) 5'-tttgCtctGCGGCCGCagaGGCCgaTTGTGGTTTTGGTGTCTTG GG-3'

(69) (Reference Literature: Biomed Environ Sci., 2012; 27(2): 118-121)

(70) Three PCR assays were conducted.

(71) In the first PCR assay, a primer set A composed of the cDNA, Primer 1 and Primer 3 and a primer set B composed of the cDNA, Primer 1 and Primer 4 were used.

(72) In the second PCR assay, a primer set C composed of the gene amplified with the primer set A, Primer 2, and Primer 3, and a primer set 1) composed of the gene amplified with the primer set B, Primer 2, and Primer 4 were used.

(73) In the third PCR assay, a primer set E composed of the gene amplified with the primer set C, Primer 2, and Primer 5, and a primer set F composed of the gene amplified with the primer set D, Primer 2, and Primer 6 were used. In this way, the gene library of the VHH antibody was formed. In other words, the gene library of the VHH antibody included the genes amplified with the primer sets E and F.

(74) (Formation of Phage Library)

(75) Next, a phage library was formed from the gene library of the VHH antibody in accordance with the following procedures.

(76) A plasmid Vector 1 (4057 bp, see FIG. 1A) derived from a commercially available plasmid pUC119 (for example, available from Takara Bio Inc.) was treated with a restriction enzyme SfiI. The restriction enzyme site SfiI (a) shown in FIG. 1A consists of the gene sequence represented by GGCCCAGCCGGCC (SEQ II) NO: 15). The restriction enzyme site SfiI (b) consists of the gene sequence represented by GGCCTCTGCGGCC (SEQ ID NO: 16). FIG. 1B shows a detailed vector map of the plasmid Vector 1.

(77) The plasmid Vector 1 consists of the following gene sequence.

(78) TABLE-US-00004 (SEQ ID NO: 17) gacgaaagggcctcgtgatacgcctatttttataggttaatgtcatgata ataatggtttcttagacgtcaggtggcacttttcggggaaatgtgcgcgg aacccctatttgtttatttttctaaatacattcaaatatgtatccgctca tgagacaataaccctgataaatgcttcaataatattgaaaaaggaagagt atgagtattcaacatttccgtgtcgcccttattcccttttttgcggcatt ttgccttcctgtttttgctcacccagaaacgctggtgaaagtaaaagatg ctgaagatcagttgggtgcacgagtgggttacatcgaactggatctcaac agcggtaagatccttgagagttttcgccccgaagaacgttttccaatgat gagcacttttaaagttctgctatgtggcgcggtattatcccgtattgacg ccgggcaagagcaactcggtcgccgcatacactattctcagaatgacttg gttgagtactcaccagtcacagaaaagcatcttacggatggcatgacagt aagagaattatgcagtgctgccataaccatgagtgataacactgcggcca acttacttctgacaacgatcggaggaccgaaggagctaaccgcttttttg cacaacatgggggatcatgtaactcgccttgatcgttgggaaccggagct gaatgaagccataccaaacgacgagcgtgacaccacgatgcctgtagcaa tggcaacaacgttgcgcaaactattaactggcgaactacttactctagct tcccggcaacaattaatagactggatggaggcggataaagttgcaggacc acttctgcgctcggcccttccggctggctggtttattgctgataaatctg gagccggtgagcgtgggtctcgcggtatcattgcagcactggggccagat ggtaagccctcccgtatcgtagttatctacacgacggggagtcaggcaac tatggatgaacgaaatagacagatcgctgagataggtgcctcactgatta agcattggtaactgtcagaccaagtttactcatatatactttagattgat ttaaaacttcatttttaatttaaaaggatctaggtgaagatcctttttga taatctcatgaccaaaatcccttaacgtgagttttcgttccactgagcgt cagaccccgtagaaaagatcaaaggatcttcttgagatcctttttttctg cgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagcggtggt ttgtttgccggatcaagagctaccaactctttttccgaaggtaactggct tcagcagagcgcagataccaaatactgtccttctagtgtagccgtagtta ggccaccacttcaagaactctgtagcaccgcctacatacctcgctctgct aatcctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccg ggttggactcaagacgatagttaccggataaggcgcagcggtcgggctga acggggggttcgtgcacacagcccagcttggagcgaacgacctacaccga actgagatacctacagcgtgagctatgagaaagcgccacgcttcccgaag ggagaaaggcggacaggtatccggtaagcggcagggtcggaacaggagag cgcacgagggagcttccagggggaaacgcctggtatctttatagtcctgt cgggtttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcag gggggcggagcctatggaaaaacgccagcaacgcggcctttttacggttc ctggccttttgctggccttttgctcacatgttctttcctgcgttatcccc tgattctgtggataaccgtattaccgcctttgagtgagctgataccgctc gccgcagccgaacgaccgagcgcagcgagtcagtgagcgaggaagcggaa gagcgcccaatacgcaaaccgcctctccccgcgcgttggccgattcatta atgcagctggcacgacaggtttcccgactggaaagcgggcagtgagcgca acgcaattaatgtgagttagctcactcattaggcaccccaggctttacac tttatgcttccggctcgtatgttgtgtggaattgtgagcggataacaatt tcacacaggaaacagctatgaccatgattacgccAAGCTTCGAAGGAGAC AGTCATAatgaaatacctgctgccgaccgctgctgctggtctgctgctcc tcgcGGCCCAGCCGGCCatggagcTCAAGATGACACAGACTACATCCTCC CTGTCAGCCTCTCTGGGAGACAGAGTCACCATCAGTTGCAGGGCAAGTCA GGACATTAGCGATTATTTAAACTGGTATCAGCAGAAACCAGATGGAACTG TTAAACTCCTGATCTATTACACATCAAGTTTACACTCAGGAGTCCCATCA AGGTTCAGTGGCGGTGGGTCTGGAACAGATTATTCTCTCACCATTAGCAA CCTGGAGCAAGAAGATATTGCCACTTACTTTTGCCAACAGGGTAATACGC TTCCGTGGACGTTTGGTGGAGGCACCAAGCTGGAAATCAAACGGGCTGAT GCTGCACCAACTgtaGGCCtctGCGGCCGCagaGcaaaaactcatctcag aagaggatctgaatggggccgcaTAGggttccggtgattttgattatgaa aagatggcaaacgctaataagggggctatgaccgaaaatgccgatgaaaa cgcgctacagtctgacgctaaaggcaaacttgattctgtcgctactgatt acggtgctgctatcgatggtttcattggtgacgtttccggccttgctaat ggtaatggtgctactggtgattttgctggctctaattcccaaatggctca agtcggtgacggtgataattcacctttaatgaataatttccgtcaatatt taccttccctccctcaatcggttgaatgtcgcccttttgtctttagcgct ggtaaaccatatgaattttctattgattgtgacaaaataaacttattccg tggtgtctttgcgtttcttttatatgttgccacctttatgtatgtatttt ctacgtttgctaacatactgcgtaataaggagtctTAATAAgaattcact ggccgtcgttttacaacgtcgtgactgggaaaaccctggcgttacccaac ttaatcgccttgcagcacatccccctttcgccagctggcgtaatagcgaa gaggcccgcaccgatcgcccttcccaacagttgcgcagcctgaatggcga atggcgcctgatgcggtattttctccttacgcatctgtgcggtatttcac accgCATATGaAAATTGTAAgcgttaatattttgttaaaattcgcgttaa atttttgttaaatcagctcattttttaaccaataggccgaaatcggcaaa atcccttataaatcaaaagaatagaccgagatagggttgagtgttgttcc agtttggaacaagagtccactattaaagaacgtggactccaacgtcaaag ggcgaaaaaccgtctatcagggcgatggcccactacgtgaaccatcaccc taatcaagttttttggggtcgaggtgccgtaaagcactaaatcggaaccc taaagggagcccccgatttagagcttgacggggaaagccggcgaacgtgg cgagaaaggaagggaagaaagcgaaaggagcgggcgctagggcgctggca agtgtagcggtcacgctgcgcgtaaccaccacacccgccgcgcttaatgc gccgctacaGGGCGCGTcccatATGgtgcactctcagtacaatctgctct gatgccgcatagttaagccagccccgacacccgccaacacccgctgacgc gccctgacgggcttgtctgctcccggcatccgcttacagacaagctgtga ccgtctccgggagctgcatgtgtcagaggttttcaccgtcatcaccgaaa cgcgcga

(79) Similarly, the gene library of the VHH antibody was treated with the restriction enzyme SfiI. In this way, VHH antibody gene fragments were obtained.

(80) The thus-treated plasmid Vector 1 was mixed with the VHH antibody gene fragments at a ratio of 1:2. An enzyme (available from Toyobo Co. Ltd., trade name: Ligation High ver. 2) was injected into the mixture solution. The mixture solution was left at rest at a temperature of 16 degrees Celsius for two hours. In this way, each of the VHH antibody gene fragments was ligated into the plasmid Vector 1.

(81) Coli bacteria (available from Takara Bio Inc., trade name: HST02) were transfected with the thus-ligated plasmid Vector 1.

(82) Then, the coli bacteria were incubated for fifteen hours on a 2YT plate culture medium containing ampicillin at a concentration of 100 micrograms/milliliter. In this way, obtained was a library of phages each of which displays a protein obtained from the gene fragment included in the gene library of the VHH antibody.

(83) After the incubation, a concentration of the library was calculated by counting the number of single colonies formed on the 2YT plate culture medium. As a result, the library of the phages had a concentration of 5×10.sup.2/milliliter.

(84) (Biopanning)

(85) VHH antibodies specifically binding to the intranuclear protein were obtained from the phage library in accordance with the following procedures.

(86) In order to extract the clones each capable of binding to the antigen from among the phages which expressed the VHH antibody, biopanning was conducted twice.

(87) Coli bacteria (HST02) into which the VHH antibody gene fragment included in the gene library of the VHH antibody was introduced were incubated at a temperature of 30 degrees Celsius in the 2YT AG culture medium containing 100 micrograms/milliliter of ampicillin and 1% glucose, until a value OD, indicating absorbance reached 1.0. The 2YT AG culture medium has a volume of 100 milliliters. In this way, the coli bacteria were proliferated.

(88) Helper phages (available from Invitrogen company, trade name: M13K07) were added to the coli bacteria culture medium in such a manner that the multiplicity of infection (MOI) was approximately 20.

(89) Then, the culture medium was warmed at a temperature of 37 degrees Celsius for about thirty minutes. Then, the culture medium was subjected to centrifugation at a rotation speed of 4,000 rpm for ten minutes to collect the coli bacteria. The coli bacteria were incubated overnight at a temperature of 30 degrees Celsius in a 2YTAK culture medium (i.e., a 2YT culture containing 100 micrograms/milliliter of ampicillin and 50 micrograms/milliliter of kanamycin), while subjected to centrifugation at 213 rpm. The 2YTAK culture medium has a volume of 100 milliliters.

(90) The incubation liquid (100 milliliters) containing the thus-incubated coli bacteria was injected into two centrifugation tubes (volume: 50 milliliters, each). The two centrifugation tubes were subjected to centrifugation at a rotation speed of 4,000 rpm for ten minutes. Then, the supernatants (20 milliliters, each) were collected.

(91) The supernatants (40 milliliters) were added to a 20% polyethylene glycol solution (10 milliliters) containing NaCl (2.5 M). Then, the mixture solution was mixed upside down. Subsequently, the mixture solution was cooled on ice for approximately one hour. The mixture solution was subjected to centrifugation at a rotation speed of 4,000 rpm for ten minutes. Then, the supernatant was removed. PBS containing 10% glycerol was injected toward the precipitate. Finally, the precipitate was loosened and dissolved. In this way, a library of phages each of which displays the VHH antibody was obtained.

(92) (Screening of VHH Antibody Capable of Specifically Binding to NP)

(93) (A) Immobilization of NP Antigen

(94) NP was mixed with PBS to prepare an NP solution. The concentration of NP was 2 micrograms/milliliter. The NP solution (2 milliliters) was injected into an immunotube (available from NUNC Co., Ltd.). The NP solution was left at rest in the immunotube overnight. In this way, NP was immobilized in the immunotube. Then, the inside of the immunotube was washed three times with PBS. The inside of the immunotube was filled with PBS which contained 3% skim milk (available from Wako Pure Chemical Industries, Ltd.). In this way, NP was blocked as an antigen in the immunotube. The immunotube was left at rest at room temperature for one hour. Subsequently, the inside of the immunotube was washed three times with PBS.

(95) (B) Panning

(96) The library of the phages each of which displays the VHH antibody (concentration: approximately 5E+11/milliliter) was mixed with 3 milliliters of PBS containing 3% skim milk to prepare a mixture solution. The mixture solution was injected into the immunotube in which the NP antigen was immobilized. A lid formed of a parafilm was attached to the immunotube. Then, the immunotube was rotated upside down in a rotator for ten minutes. The immunotube was left at rest at room temperature for one hour. The inside of the immunotube was washed ten times with PBS containing 0.05% Tween 20. Hereinafter, such PBS is referred to as “PBST”. The inside of the immunotube was filled with PBST. Subsequently, the immunotube was left at rest for ten minutes. Then, the inside of the immunotube was washed ten times with PBST.

(97) In order to extract phages each of which displays the VHH antibody bound to the NP antigen, a 100 mM trimethylamine solution (1 milliliter) was injected into the immunotube. A lid formed of a parafilm was attached to the immunotube. Then, the immunotube was rotated upside down in a rotator for ten minutes.

(98) In order to neutralize the solution, the solution was moved to a tube containing 1 mL of 0.5 M Tris/HCl (pH: 6.8). Again, the extraction of the phage was repeated using a 100 mM trimethylamine solution (1 milliliter). In this way, 3 mL of an extraction liquid was obtained.

(99) The extraction liquid (1 mL) was mixed with 9 mL of coli bacteria HST02. The mixture solution was left at rest for one hour at a temperature of 30 degrees Celsius.

(100) In order to count the number of colonies, 10 microliters of the mixture solution containing the coli bacteria HST02 was distributed onto a small plate including a 2TYA culture medium (10 milliliters/plate).

(101) The rest of the mixture solution was subjected to centrifugation. The supernatant was removed, and the precipitate was distributed onto a large plate including a 2TYA culture medium (40 milliliters/plate). These two plates were left at rest overnight at a temperature of 30 degrees Celsius. In this way, first panning was conducted.

(102) Second panning was conducted identically to the procedure of the first panning. In other words, the panning was repeated. In this way, the monoclonal phages on which the VHH antibody was displayed were purified.

(103) After the second panning, a colony of the coli bacteria was picked up with a toothpick. The picked-up colony was put on one well of 96-flat-bottom plate. This was repeated. One well contained 200 microliters of a 2YTAG culture medium.

(104) The solutions included in the wells were stirred at a rotation speed of 213 rpm at a temperature of 30 degrees Celsius.

(105) The solution (50 microliters) containing grown coli bacteria was collected. The collected solution was mixed with 50 microliters of a 2YTA culture medium included in a plate. The 2YTA culture medium contained helper phages such that the multiplicity of infection was set to be 20. The solution was left at rest at a temperature of 37 degrees Celsius for forty minutes.

(106) The plate including the 2YTA culture medium was subjected to centrifugation at 1,800 rpm for twenty minutes. The supernatant was removed. The precipitate contained the coli bacteria. The precipitate was mixed with 200 microliters of a 2YTAK culture medium. The mixture solution was left at rest overnight at a temperature of 30 degrees Celsius.

(107) The mixture solution was subjected to centrifugation at 1,800 rpm for twenty minutes. The supernatant containing the coli bacteria was collected.

(108) (C) Qualitative Evaluation of Phage-Displayed VHH Antibody and Antigen by ELISA

(109) An intranuclear protein solution having a concentration of 2 micrograms/milliliter was injected as an antigen into each of the wells of a 96-well plate (available from Thermo scientific company, trade name: maxisorp). The volume of the intranuclear protein solution in each well was 50 microliters. The 96-well plate was left overnight at a temperature of 4 degrees Celsius. In this way, the NP antigen was immobilized in each well.

(110) Each of the wells was washed three times with PBS. Then, PBS containing 3% skim milk (available from Wako Pure Chemical Industries, Ltd.) was injected into each well (200 microliters/well). The 96-well plate was left at room temperature for one hour. In this way, the intranuclear protein was blocked in each well. Subsequently, each well was washed three times with PBS.

(111) The monoclonal phages each of which displays the VHH antibody were injected into each well (50 microliters/well). Then, the 96-well plate was left at rest for one hour. In this way, the phages reacted with the NP antigen.

(112) Each well was washed three times with PBST. Then, an anti-M13 antibody (available from ABCAM company, trade name; ab50370, 10,000-fold dilution) was injected into each well (50 microliters/well). Then, each well was washed three times with PBST.

(113) A color-producing agent (available from Thermo Scientific, trade name: 1-step ultra TMB-ELISA) was injected into each well (50 microliters/well). The 96-well plate was left at rest for two minutes to cause the color-producing agent to react with the antibody.

(114) A sulfuric acid aqueous solution (normal, i.e., 1 N) was injected into each well at a concentration of 50 microliters/well to cease the reaction.

(115) The absorbance of the solution at a wavelength of 450 nanometers was measured.

(116) Fourteen wells each having good absorbance measurement result were selected. The DNA sequences included in the phages contained in the selected fourteen wells were analyzed by Greiner Company. The analysis results of the DNA sequences will be described below. The following one DNA sequence was found.

(117) TABLE-US-00005 (SEQ ID NO: 18) CAGTTGCAGCTCGTGGAGTCTGGGGGAGGCTTGGTGCAGGCTGGGGGGTC TCTGAGACTCTCCTGTGCAGCCTCTGGAAGCGCCTTCAGCCTCTATGCCA TGGGCTGGCACCGCCAGGCTCCAGGGAAGCAGCGCGAGTTGGTCGCATAT ATTACTAATGGTGACATCACAAACTATGCGGACTCCGTGCAGGGCCGTGT CATCATCTCCAGAGACAACGCCAAAAACACGGTGTATCTACACATGAACA GCCTGAAACCTGAGGACACAGCCGTCTATTATTGTTATGCAGTGGGGGGT CGGACCTTCTGGGGCCAGGGGACCCAGGTCACCGTCTCCTCA

(118) The protein synthesized from the DNA sequence represented by SEQ ID NO: 18 consists of the following amino acid sequence.

(119) TABLE-US-00006 (SEQ ID NO: 8) QLQLVESGGGLVQAGGSLRLSCAASGSAFSLYAMGWHRQAPGKQRELVAY ITNGDITNYADSVQGRVIISRDNAKNTVYLHMNSLKPEDTAVYYCYAVGG RTFWGQGTQVTVSS

(120) (Expression of Anti-NP VHH Antibody)

(121) A vector pRA2(+) was used as an expression vector (see FIG. 2). The vector pRA2(+) was purchased from Merck Millipore Company. Using In-Fusion HD Cloning Kit (available from Takara Bio Inc.), the VHH sequence was ligated into a vector pRA2(+). Hereinafter, the ligation process will be described in more detail.

(122) First, a VHH antibody gene fragment was amplified by the PCR method using the following two primers (SEQ ID NO: 19 and SEQ ID NO: 20) from the plasmid Vector 1 in which the VHH antibody gene fragment included in the gene library of the VHH antibody was ligated. In this way, the following one DNA (SEQ ID NO: 21) including a gene sequence coding for the amino acid sequence represented by the SEQ ID NO: 8 was obtained.

(123) TABLE-US-00007 Primer 1: (SEQ ID NO: 19) 5'-CAGCCGGCCATGGCTCAGTTGCAGCTCGTGGAGTCTGGG-3' Primer 2: (SEQ ID NO: 20) 5'-ATGGTGTGCGGCCGCTGAGGAGACGGTGACCTGGGTCC-3' (SEQ ID NO: 21) 5'-CAGCCGGCCATGGCTCAGTTGCAGCTCGTGGAGTCTGGGGGAGGCTT GGTGCAGGCTGGGGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGAAGCG CCTTCAGCCTCTATGCCATGGGCTGGCACCGCCAGGCTCCAGGGAAGCAG CGCGAGTTGGTCGCATATATTACTAATGGTGACATCACAAACTATGCGGA CTCCGTGCAGGGCCGTGTCATCATCTCCAGAGACAACGCCAAAAACACGG TGTATCTACACATGAACAGCCTGAAACCTGAGGACACAGCCGTCTATTAT TGTTATGCAGTGGGGGGTCGGACCTTCTGGGGCCAGGGGACCCAGGTCAC CGTCTCCTCAGCGGCCGCACACCAT-3'

(124) On the other hand, a part of the base sequence included in the vector pRA2 was amplified by a PCR method using the following two primers (SEQ ID NO: 22 and SEQ ID NO: 23). In this way, a DNA (SEQ ID NO: 25) was obtained.

(125) TABLE-US-00008 Primer 1: (SEQ ID NO: 22) 5′-GCGGCCGCACACCATCATCACCACCATTAATAG-3′ Primer 2: (SEQ ID NO: 23) 5′-AGCCATGGCCGGCTGGGCCGCGAGTAATAAC-3′ (SEQ ID NO: 25) GCGGCCGCACACCATCATCACCACCATTAATAGcactagtcaagaggatc cggctgctaacaaagcccgaaaggaagctgagttggctgctgccaccgct gagcaataactagcataaccccttggggcctctaaacgggtcttgagggg ttttttgctgaaaggaggaactatatccggatgaattccgtgtattctat agtgtcacctaaatcgtatgtgtatgatacataaggttatgtattaattg tagccgcgttctaacgacaatatgtacaagcctaattgtgtagcatctgg cttactgaagcagaccctatcatctctctcgtaaactgccgtcagagtcg gtttggttggacgaaccttctgagtttctggtaacgccgtcccgcacccg gaaatggtcagcgaaccaatcagcagggtcatcgctagccagatcctcta cgccggacgcatcgtggccggcatcaccggcgccacaggtgcggttgctg gcgcctatatcgccgacatcaccgatggggaagatcgggctcgccacttc gggctcatgagcgcttgtttcggcgtgggtatggtggcaggccccgtggc cgggggactgttgggcgccatctccttgcatgcaccattccttgcggcgg cggtgctcaacggcctcaacctactactgggctgcttcctaatgcaggag tcgcataagggagagcgtcgaatggtgcactctcagtacaatctgctctg atgccgcatagttaagccagccccgacacccgccaacacccgctgacgcg ccctgacgggcttgtctgctcccggcatccgcttacagacaagctgtgac cgtctccgggagctgcatgtgtcagaggttttcaccgtcatcaccgaaac gcgcgagacgaaagggcctcgtgatacgcctatttttataggttaatgtc atgataataatggtttcttagacgtcaggtggcacttttcggggaaatgt gcgcggaacccctatttgtttatttttctaaatacattcaaatatgtatc cgctcatgagacaataaccctgataaatgcttcaataatattgaaaaagg aagagtatgagtattcaacatttccgtgtcgcccttattcccttttttgc ggcattttgccttcctgtttttgctcacccagaaacgctggtgaaagtaa aagatgctgaagatcagttgggtgcacgagtgggttacatcgaactggat ctcaacagcggtaagatccttgagagttttcgccccgaagaacgttttcc aatgatgagcacttttaaagttctgctatgtggcgcggtattatcccgta ttgacgccgggcaagagcaactcggtcgccgcatacactattctcagaat gacttggttgagtactcaccagtcacagaaaagcatcttacggatggcat gacagtaagagaattatgcagtgctgccataaccatgagtgataacactg cggccaacttacttctgacaacgatcggaggaccgaaggagctaaccgct tttttgcacaacatgggggatcatgtaactcgccttgatcgttgggaacc ggagctgaatgaagccataccaaacgacgagcgtgacaccacgatgcctg tagcaatggcaacaacgttgcgcaaactattaactggcgaactacttact ctagcttcccggcaacaattaatagactggatggaggcggataaagttgc aggaccacttctgcgctcggcccttccggctggctggtttattgctgata aatctggagccggtgagcgtgggtctcgcggtatcattgcagcactgggg ccagatggtaagccctcccgtatcgtagttatctacacgacggggagtca ggcaactatggatgaacgaaatagacagatcgctgagataggtgcctcac tgattaagcattggtaactgtcagaccaagtttactcatatatactttag attgatttaaaacttcatttttaatttaaaaggatctaggtgaagatcct ttttgataatctcatgaccaaaatcccttaacgtgagttttcgttccact gagcgtcagaccccgtagaaaagatcaaaggatcttcttgagatcctttt tttctgcgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagc ggtggtttgtttgccggatcaagagctaccaactctttttccgaaggtaa ctggcttcagcagagcgcagataccaaatactgttcttctagtgtagccg tagttaggccaccacttcaagaactctgtagcaccgcctacatacctcgc tctgctaatcctgttaccagtggctgctgccagtggcgataagtcgtgtc ttaccgggttggactcaagacgatagttaccggataaggcgcagcggtcg ggctgaacggggggttcgtgcacacagcccagcttggagcgaacgaccta caccgaactgagatacctacagcgtgagctatgagaaagcgccacgcttc ccgaagggagaaaggcggacaggtatccggtaagcggcagggtcggaaca ggagagcgcacgagggagcttccagggggaaacgcctggtatctttatag tcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtgatgct cgtcaggggggcggagcctatggaaaaacgccagcaacgcggccttttta cggttcctggccttttgctggccttttgctcacatgttctttcctgcgtt atcccctgattctgtggataaccgtattaccgcctttgagtgagctgata ccgctcgccgcagccgaacgaccgagcgcagcgagtcagtgagcgaggaa gcggaagagcgcccaatacgcaaaccgcctctccccgcgcgttggccgat tcattaatgcagctggcttatcgaaattaatacgactcactatagggaga cccaagctttatttcaaggagacagtcataATGaaatacctattgcctac ggcagccgctggattgttattactcgcggcccagccggccatggct

(126) DNAs other than the following two DNAs (I) and (II) were fragmented with a restriction enzyme DpnI (available from TOYOBO). In other words, the following two DNAs (I) and (II) remained unchanged; however, the rest of the DNAs were fragmented.

(127) (I) the DNA represented by SEQ ID NO: 21, and

(128) (II) the DNA represented by SEQ ID NO: 25.

(129) The DNA represented by SEQ ID NO: 21 was fused with the DNA represented by the SEQ ID NO: 25 using In-Fusion HD Cloning Kit (available from Takara Bio Inc.). In this way, the VHH antibody gene fragment was ligated into the vector pRA2(+).

(130) The ligation solution (10 microliters) and coli bacteria JM109 (available from Takara Bio, 100 microliters) were mixed on ice. The mixture solution was left at rest on the ice for thirty minutes. Then, the mixture solution was heated at a temperature of 42 degrees Celsius for forty five seconds. Finally, the mixture solution was left at rest on the ice for three minutes. This procedure is known as a general heat shock method.

(131) After the incubation at a temperature of 37 degrees Celsius for one hour with shaking, the total amount of the mixture solution was distributed onto an LBA culture medium containing ampicillin at a concentration of 100 micrograms/milliliter. The LBA culture medium was left at rest overnight at a temperature of 37 degrees Celsius.

(132) Three colonies were selected from among the colonies formed on the LBA culture medium. The selected three colonies were incubated overnight in the LBA culture medium (3 milliliters).

(133) The plasmids contained in the incubated coli bacteria were extracted from the LBA culture medium using a plasmid extraction kit (available from Sigma, trade name: Gene Elute Plasmid Mini Kit). In order to confirm that the gene of the targeted VHH antibody was inserted in the plasmid, the sequence of the plasmid was analyzed by Greiner Company. For the analysis of the sequence, a general T7 promoter primer set was used.

(134) Selected were plasmids which were confirmed through the analysis of the sequence to have been formed as planned.

(135) Coli bacteria (Competent Cell BL21 (DE3) pLysS, available from Life Technologies Company) were transfected with the selected plasmids by a heat shock method.

(136) An LBA culture medium (1 milliliter) was injected into the solution containing the transfected coli bacteria. Then, the coli bacteria were recovered at a temperature of 37 degrees Celsius for one hour, while shaken at 213 rpm.

(137) Then, the coli bacteria solution was collected. The collected coli bacteria solution (1 milliliter) was distributed onto an LBA culture medium. The LBA culture medium was left at rest overnight at a temperature of 37 degrees Celsius.

(138) One colony was selected from among the colonies formed in the LBA culture medium. The selected colony was picked up with a toothpick. The picked-up colony was incubated in an LBA culture medium (3 milliliters) at a temperature of 37 degrees Celsius, while shaken at 213 rpm. In this way, a culture liquid was obtained.

(139) In addition, the culture liquid (3 milliliters) was mixed with an LBA culture medium (1,000 milliliters). Until the absorbance of the mixture solution at a wavelength of 600 nanometers reached 0.6, the mixture solution was shaken at 120 rpm at a temperature of 28 degrees Celsius.

(140) After the absorbance reached 0.6, an isopropylthiogalactoside solution (hereinafter, referred to as “IPTG solution”) was added to the mixture solution. The final concentration of the IPTG solution was 0.5 mM. The coli bacteria contained in the mixture solution were incubated at a temperature of 20 degrees Celsius overnight. In order to collect the thus-incubated coli bacteria, the mixture solution was subjected to centrifugation at 6,000 rpm at a temperature of 4 degrees Celsius for ten minutes.

(141) The collected coli bacteria were mixed with a mixture solvent containing 50 mM Tris-HC1, 500 mM NaCl, and 5 mM imidazole. The mixture solvent had a volume of 50 milliliters. The coli bacteria contained in the mixture solution were disintegrated with an ultrasonic wave.

(142) The disintegration liquid containing coli bacteria was subjected to centrifugation at 40,000 g at a temperature of 4 degrees Celsius for thirty minutes to obtain an eluate. The supernatant was collected. The collected supernatant was filtered through a 0.45-micrometer filter.

(143) The filtrate was purified with Ni-NTA-Agarose (available from QIAGEN) in accordance with recommended protocol. For the purification, an elution buffer having a total amount of 3 milliliters was used for 1 milliliter of Ni-NTA-Agarose.

(144) Furthermore, the eluate containing the anti-NP antibody was purified with a column chromatograph (available from General Electric Company, trade name: Akta purifier). In this way, a solution containing the anti-NP antibody was obtained.

(145) The anti-NP antibody contained in the thus-obtained solution was quantified with an absorption spectrometer (available from Scrum Inc., trade name: nanodrop) on the basis of the absorption measurement value at a wavelength of 280 nanometers. As a result, the concentration of the anti-NP antibody was 1.30 milligrams/milliliter.

(146) (D-1) Surface Plasmon Resonance Evaluation of Anti-NP Antibody Using Recombinant NP

(147) The anti-NP antibody was evaluated as below with a recombinant NP and a surface plasmon resonance evaluation device. The details of the surface plasmon resonance (hereinafter, referred to as “SPR”) will be described below.

(148) SPR evaluation device: T200 (available from GE Healthcare)

(149) Immobilization buffer: PBS containing 0.05% of Tween 20

(150) Running buffer: PBS containing 0.05% of Tween 20

(151) Sensor chip: CM5 (available from GE Healthcare)

(152) Immobilization reagents: N-hydroxysuccinimide (NHS) and ethyl (dimethylaminopropyl) carbodiimide (EDC)

(153) Anti-Flag antibody: Monoclonal ANTI-FLAG antibody (available from SIGMA)

(154) NP: recombinant nucleoprotein (NP) protein derived from influenza virus H1N1 to which a Flag tag was fused and which was prepared using baculovirus.

(155) The anti-Flag antibody was immobilized in accordance with the wizard included in the control software of the SPR evaluation device T200. For the immobilization of the anti-Flag antibody, an acetic acid solution having a pH of 5.0 was used.

(156) The anti-NP antibody consisting of the amino acid sequence represented by SEQ ID NO: 8 was used as an analyte. In the first to sixth analyses, the concentrations of the anti-NP antibody contained in the running buffer were adjusted to 0.78 nM, 1.56 nM, 3.125 nM, 6.25 nM, 12.5 nM, and 25 nM, respectively. First, the recombinant intranuclear proteins were captured with the anti-Flag antibodies. Then, the anti-NP antibodies were supplied. In this way, the anti-NP antibodies were evaluated. FIGS. 3A-3F are graphs showing an evaluation result outputted from the SPR evaluation device T200. The dissociation constant Kd was calculated using the evaluation software (available from GE Healthcare). As a result, the dissociation constant Kd was 1.09 nM.

(157) (D-2) Evaluation of Cross-reactivity to Other Influenza Virus Subtypes

(158) Next, in order to evaluate binding ability of the VHH antibody including the amino acid sequence represented by SEQ ID NO: 8 with nucleoproteins (namely, NPs) derived from a type-A influenza virus subtypes H1N1 (A/Hokkaido/11/2002), H1N1 (A/Hyogo/YS/2011), H1N1 (A/Hokkaido/6-5/2014), H3N2 (A/Hokkaido/M1/2014), H5N1 (A/duck/Hokkaido/Vac-3/2007), H7N7 (A/duck/Hokkaido/Vac-2/2004), and H7N9 (A/duck/Mongolia/119/2008), the binding ability to a virus solution containing the intranuclear proteins was evaluated by an ELISA measurement method.

(159) The virus solution including the intranuclear protein derived from the type-A influenza virus subtype H1N1 (A/Hokkaido/11/2002) was prepared. The virus solution was obtained from School/Faculty of Veterinary Medicine, Hokkaido University.

(160) Similarly, six virus solutions including the intranuclear proteins derived from the type-A influenza virus subtypes H1N1 (A/Hyogo/YS/2011), H1N1 (A/Hokkaido/6-5/2014), H3N2 (A/Hokkaido/M1/2014), H5N1 (A/duck/Hokkaido/Vac-3/2007), H7N7 (A/duck/Hokkaido/Vac-2/2004), and H7N9 (A/duck/Mongolia/119/2008) were prepared. The six virus solutions were obtained from School/Faculty of Veterinary Medicine, Hokkaido University.

(161) Furthermore, a virus solution including the intranuclear protein derived from the type-B influenza virus (B/Hokkaido/30-4/2014) was prepared. The virus solution was obtained from School/Faculty of Veterinary Medicine, Hokkaido University.

(162) A part of a solution A (concentration 10 micrograms/milliliter) containing the VHH antibody including the amino acid sequence represented by SEQ ID NO: 8 was diluted 4-fold with a PBS containing both 3% skim milk (available from Wako Pure Chemical Industries, Ltd.) and 0.05% Tween 20. Hereinafter, the PBS containing both 3% skim milk and 0.05% Tween 20 is referred to as “skim-milk-containing PBST”. In this way, a diluted solution B (concentration: 2.5 micrograms/milliliter) of the solution containing the VHH antibody including the amino acid sequence represented by SEQ ID NO: 8 was provided. This was repeated to provide a diluted solution C (concentration: 0.625 micrograms/milliliter), a diluted solution D (concentration: 0.15625 micrograms/milliliter), a diluted solution E (concentration: 0.0390625 micrograms/milliliter), a diluted solution F (concentration: 9.76562×10.sup.−4 micrograms/milliliter), and a diluted solution G (concentration: 2.44141×10.sup.−4 micrograms/milliliter).

(163) The virus solutions including the intranuclear proteins derived from the type-A influenza virus subtypes H1N1 (A/Hokkaido/11/2002), H1N1 (A/Hyogo/YS/2011), H1N1 (A/Hokkaido/6-5/2014), H3N2 (A/Hokkaido/M1/2014), H5N1 (A/duck/Hokkaido/Vac-3/2007), H7N7 (A/duck/Hokkaido/Vac-2/2004), H7N9 (A/duck/Mongolia/119/2008), and the type-B influenza virus (B/Hokkaido/30-4/2014) were injected into the wells of 96-well plate (Maxisorp, Nunc). Each of the wells contained 50 microliters of the solution. The 96-well plate was left at rest at room temperature for two hours to immobilize the virus in the wells.

(164) The skim-milk-containing PBST was injected into each well to block the virus. The volume of the PBST injected into each well was 200 microliters. The 96-well plate was left at rest at room temperature for three hours.

(165) PBST containing 0.05% Tween 20 was injected into each well to wash the wells. The PBST had a pH of 7.4. The volume of the PBST injected into each well was 200 microliters. This was repeated three times.

(166) Each of the diluted solutions of the VHH antibody including the amino acid sequence represented by SEQ ID NO: 8 included in the diluted solutions A-G was injected into each well. As a reference, the skim-milk-containing PBST was injected into another well. This well including the skim-milk-containing PBST only was used as a reference to remove a background in measurement. The volume of the solutions injected into each well was 50 microliters. The 96-well plate was left at rest at room temperature. In this way, the VHH antibodies included in the diluted solutions A-G were bound to the intranuclear protein contained in the wells. The 96-well plate was left at rest at room temperature for one hour.

(167) PBST containing 0.05% Tween 20 was injected into each well to wash the wells. The PBST had a pH of 7.4. The volume of the PBST injected into each well was 200 microliters. This was repeated five times.

(168) Labelled antibodies (available from Medical and Biological laboratories Co., Ltd, trade name: Anti-His-tag mAb-HRP-DirecT) were diluted 10,000-fold with PBST containing 0.05% Tween 20. The thus-diluted labelled antibodies were injected into each well (50 microliters/well). Then, the 96-well plate was left at rest for one hour.

(169) PBST containing 0.05% Tween 20 was injected into each well to wash the wells. The PBST had a pH of 7.4. The volume of the PBST injected into each well was 200 microliters. This was repeated five times.

(170) The color-producing agent (available from Thermo Scientific, trade name: 1-step ultra TMB-ELISA) was injected into each well (50 microliters/well). The 96-well plate was left at rest for thirty minutes to cause the color-producing agent to react with the antibody.

(171) A color-stopping agent (available from ScyTek laboratories, trade name: TMB Stop Buffer) containing sulfuric acid and hydrochloric acid at a low concentration was injected into each well at a concentration of 50 microliters/well to cease the reaction.

(172) The absorbance of the solution at a wavelength of 450 nanometers was measured. FIGS. 4A-4H are graphs showing the measurement results of the cross reaction of the VHH antibody including the amino acid sequence represented by SEQ ID NO: 8 with the type-A influenza virus subtypes H1N1 (A/Hokkaido/11/2002), H1N1 (A/Hyogo/YS/2011), H1N1 (A/Hokkaido/6-5/2014), H1N2 (A/Hokkaido, M1/2014), H5N1 (A/duck/Hokkaido/Vac-3/2007), H7N7 (A/duck/Hokkaido/Vac-2/2004), H7N9 (A/duck/Mongolia/19/2008), and the type-B influenza virus, respectively.

(173) As understood from FIGS. 4A-4H, the VHH antibody including the amino acid sequence represented by SEQ ID NO: 8 has high cross-reactivity with the intranuclear proteins derived from the type-A influenza virus subtypes H1N1 (A/Hokkaido/11/2002), H1N1 (A/Hyogo/YS/2011), H1N1 (A/Hokkaido/6-5/2014), H3N2 (A/Hokkaido/M1/2014), H5N1 (A/duck/Hokkaido/Vac-3/2007), H7N7 (A/duck/Hokkaido/Vac-2/2004), and H7N9 (A/duck/Mongolia/119/2008). On the other hand, the VHH antibody including the amino acid sequence represented by SEQ ID NO: 8 has low cross-reactivity with the type-B influenza virus.

Inventive Example 2

(174) Analysis of Antigen Binding Region with HDX-MS

(175) Preparation of Measurement Sample

(176) Purified Anti-NP

(177) The VHH antibody and the NP antigen were dialyzed with a phosphate buffered saline (PBS, pH 7.4) to replace a solvent. An antigen was prepared so as to be 1 mg/mL, and an antibody was added so as to have an equimolar amount to prepare an antigen-antibody complex solution. At the time of concentration, Amicon Ultra-4 Centrifugal Filter Units 3K (Millipore) was used, and aggregates were removed using Nanosep (SIGMA) from the concentrated sample.

(178) Deuteration Conditions

(179) In this study, 60 seconds, 600 seconds, 1800 seconds, 3600 seconds, 7200 seconds, 10800 seconds, and 14400 seconds are selected as a period for labeling with deuterium, and 4M Gdn-HCl, 0.5M TCEP, 200 mM citric acid, pH 2.5 was selected as a quenching solvent to stop deuteration. A deuterium solution was prepared by adding Deuterium Oxide 99.8 atom % D (Tokyo Kasei) to a mixture of reagents so as to have a composition of PBS (pH 7.4).

(180) Measurement Method

(181) HDX-MS measurement was performed with an apparatus owned by Thermo Fisher SCIENTIFIC. The deuterated sample was passed through a pepsin enzyme-immobilized column, and MS measurement was performed immediately after the fragmentation treatment. MS results were analyzed using HDExaminer. A mass spectrometer: Q Exactive Plus (Thermo Fisher Scientific), LC pump: UltiMate 3000 RSnano (Thermo Fisher Scientific), and Auto Sampler: HDx-3 PAL (LEAP Technologies) were used for the MS and autosampler devices. As columns, a digestion column: Poroszyme Immobilized Pepsin Cartridge, 2.1×30 mm (ThermoScientific), a desalting column: Acclaim PepMap300 C18 5 um, 1.0 mm×15 mm (ThermoScientic), and an analysis column: Hypersil Gold column, 50×1 mm, 1.9 um (ThermoScientific) were used.

(182) Results

(183) FIG. 5 shows the results of an antigen binding region analysis of HDX-MS provided by subtracting the deuterium exchange rate of the complex from the deuterium exchange rate of the monomer. Peptides each having a large difference of the deuterium exchange rate have been shown. The difference was positively large with regard to the peptide consisting of the 205th-231st amino acid sequence of SEQ ID NO: 24 and the peptide consisting of the 217th-231st amino acid sequence of SEQ ID NO: 24. The difference was negatively large with regard to the peptide consisting of the 207th-219th amino acid sequence of SEQ ID NO: 24 and the peptide consisting of the 231st-258th amino acid sequence of SEQ ID NO: 24. From the above, it was suggested that the peptide consisting of the 205th-231st amino acid sequence of SEQ ID NO: 24 contains an epitope recognized by the antibody. It was also suggested that the peptide consisting of the 220th-231st amino acid sequence in SEQ ID NO: 24 contains an epitope recognized by the antibody. Therefore, the 205th-231st amino acid sequence of SEQ ID NO: 24 or the 220th-231st amino acid sequence in SEQ ID NO: 24 would be a sequence including the epitope of anti-NP VHH antibody capable of binding to the NP antigen.

INDUSTRIAL APPLICABILITY

(184) The present disclosure provides an antibody capable of binding to an intranuclear protein of an influenza virus and the application thereof.