NON-TOXIC PROTEASE HAVING IMPROVED PRODUCTIVITY
20220251531 · 2022-08-11
Inventors
- Young Doug SOHN (Gyeonggi-do, KR)
- Ho-Jun KIM (Seoul, KR)
- Ui Jung KWON (Gyeonggi-do, KR)
- Jong-Tak KIM (Seoul, KR)
- Kyoung Soo Kim (Gyeonggi-do, KR)
Cpc classification
A61P21/00
HUMAN NECESSITIES
C07K2319/20
CHEMISTRY; METALLURGY
C07K2319/10
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
C12P21/02
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to a mutated non-toxic protease in which the amino acid cysteine (Cys) at position 430 of a non-toxic protease represented by the amino acid sequence of SEQ ID NO: 1 is substituted with an amino acid other than cysteine. According to the present invention, it is possible to recover a refolded non-toxic protease from an insoluble fraction from which the non-toxic protease was almost impossible to recover in the prior art, and thus it is possible to produce the non-toxic protease with significantly improved productivity.
Claims
1. A mutated non-toxic protease in which an amino acid cysteine (Cys) at position 430 of a non-toxic protease represented by the amino acid sequence of SEQ ID NO: 1 is substituted with an amino acid selected from the group consisting of glycine (Gly), alanine (Ala) and serine (Ser).
2. A fusion non-toxic protease in which the mutated non-toxic protease of claim 1 is fused with any one or more peptides selected from the group consisting of: i) a cell penetrating peptide; ii) a belt domain fragment peptide; and iii) a cell targeting peptide.
3. (canceled)
4. The fusion non-toxic proteinase of claim 2, wherein the cell penetrating peptide is represented by the amino acid sequence of SEQ ID NO: 3, the belt domain fragment peptide is represented by the amino acid sequence of SEQ ID NO: 5, and the cell targeting peptide is represented by the amino acid sequence of SEQ ID NO: 7.
5. The fusion non-toxic proteinase of claim 2, wherein the any one peptide is fused directly or via a linker to the non-toxic protease.
6. The fusion non-toxic proteinase of claim 5, wherein the linker is a peptide linker represented by (Gly).sub.N wherein N is an integer ranging from 3 to 10.
7. The fusion non-toxic proteinase of claim 2, further comprising a cleavable peptide sequence by a protease for cleavage between a C-terminus of the non-toxic protease and an N-terminus of the peptide fused with the non-toxic protease.
8. The fusion non-toxic proteinase of claim 7, wherein the cleavable peptide sequence is represented by the amino acid sequence of SEQ ID NO: 27.
9. A mutant gene encoding the mutated non-toxic protease of claim 1.
10. The mutant gene of claim 9, which is represented by a nucleotide sequence selected from the group consisting of SEQ ID NOs: 30, 32 and 34.
11. A gene construct comprising: the mutant gene of claim 9; and any one or more nucleic acids selected from the group consisting of i) a nucleic acid encoding a cell penetrating peptide; ii) a nucleic acid encoding a belt domain fragment peptide; and iii) a nucleic acid encoding a cell targeting peptide.
12. The gene construct of claim 11, wherein the nucleic acid encoding the cell penetrating peptide is represented by the nucleotide sequence of SEQ ID NO: 4, the nucleic acid encoding the belt domain fragment peptide is represented by the nucleotide sequence of SEQ ID NO: 6, and the nucleic acid encoding the cell targeting peptide is represented by the nucleotide sequence of SEQ ID NO: 8.
13. The gene construct of claim 11, further comprising a nucleic acid encoding a linker peptide between the mutant gene encoding the mutated non-toxic protease and the any one or more nucleic acids.
14. The gene construct of claim 13, wherein the nucleic acid encoding the linker peptide is represented by the nucleotide sequence of SEQ ID NO: 26.
15. The gene construct of claim 11, further comprising a nucleic acid encoding a peptide sequence cleavable by a cleavage protease between the mutant gene encoding the mutated non-toxic protease and the one or more nucleic acids.
16-20. (canceled)
21. A pharmaceutical composition for treating Dystonia containing the non-toxic protease of claim 1 as an active ingredient.
22. The pharmaceutical composition of claim 21, wherein the Dystonia is selected from the group consisting of facial spasm, eyelid spasm, torticollis, blepharospasm, spasmodic torticollis, cervical dystonia, oromandibular dystonia, spasmodic dysphonia, migraine, anal pruritus, and hyperhidrosis.
23. The pharmaceutical composition of claim 22, which is for transdermal administration.
24. A hyaluronic acid microneedle patch containing the non-toxic protease of claim 1.
25. The hyaluronic acid microneedle patch of claim 24, which is for treatment or alleviation of a symptom selected from the group consisting of facial spasm, eyelid spasm, torticollis, blepharospasm, spasmodic torticollis, cervical dystonia, oromandibular dystonia, spasmodic dysphonia, migraine, anal pruritus, and hyperhidrosis.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
DETAILED DESCRIPTION AND PREFERRED EMBODIMENTS OF THE INVENTION
[0065] Unless otherwise defined, all technical and scientific terms used in the present specification have the same meanings as commonly understood by those skilled in the art to which the present disclosure pertains. In general, the nomenclature used in the present specification is well known and commonly used in the art.
[0066] In the present invention, it has been found that, when a mutation at the amino acid cysteine at position 430 of a wild-type protease is induced in order to solve the problem associated with the decrease in productivity resulting from protein aggregation which frequently occurs during purification of the wild-type non-toxic protease in a process of producing the non-toxic protease using a recombinant microorganism, protein aggregation resulting from inclusion body formation is inhibited while the protease activity is maintained, and thus the non-toxic protease contained in an insoluble fraction can be recovered even by a simple refolding process alone, and even when various functional peptides are fused to the mutated non-toxic protease, the fusion mutated non-toxic protease can be produced with high productivity.
[0067] Therefore, in one aspect, the present invention is directed to a mutated non-toxic protease in which the amino acid cysteine at position 430 of a non-toxic protease represented by the amino acid sequence of SEQ ID NO: 1 is substituted with an amino acid other than cysteine.
[0068] In the present invention, the amino acid cysteine at position 430 of the non-toxic protease is substituted with any amino acid other than cysteine so as not to form an inappropriate disulfide bond with another cysteine. The amino acid substituting for the cysteine at position 430 is not limited, but the cysteine (Cys) may preferably be substituted with glycine (Gly), alanine (Ala) or serine (Ser).
[0069] In another aspect, the present invention is directed to a fusion non-toxic proteinase in which the mutated non-toxic protease is fused with any one or more peptides selected from the group consisting of:
[0070] i) a cell penetrating peptide;
[0071] ii) a belt domain fragment peptide; and
[0072] iii) a cell targeting peptide.
[0073] In the present invention, the cell penetrating peptide may be represented by the amino acid sequence of SEQ ID NO: 3, the belt domain fragment peptide may be represented by the amino acid sequence of SEQ ID NO: 5, and the cell targeting peptide may be represented by the amino acid sequence of SEQ ID NO: 7, but the present invention is not limited thereto. Preferably, the fusion non-toxic protease is for expression in E. coli.
[0074] In still another aspect, the present invention is directed to a fusion non-toxic proteinase in which the mutated non-toxic protease is fused with any one or more peptides selected from the group consisting of:
[0075] i) a yeast secretion signal peptide;
[0076] ii) a cell penetrating peptide; and
[0077] ii) a cell targeting peptide. Preferably, the fusion non-toxic protease is for expression in yeast.
[0078] In the present invention, the yeast secretion signal peptide may be represented by the amino acid sequence of SEQ ID NO: 46, the cell penetrating peptide may be represented by the amino acid sequence of SEQ ID NO: 3, and the cell targeting peptide may be represented by the amino acid sequence of SEQ ID NO: 7, but the present invention is not limited thereto.
[0079] In the present invention, when the non-toxic protease constituting the fusion non-toxic protease is fused with another peptide at its N-terminus, the fusion may be performed after removal of the amino acid methionine at position 1.
[0080] In the present invention, a tag peptide for purification may further be fused to the mutated non-toxic protease or the fusion non-toxic protease. The tag peptide for purification may be selected from the group consisting of glutathione-S-transferase (GST), C-myc tag, a chitin-binding domain, streptavidin binding protein (SBP), a cellulose-binding domain, a calmodulin-binding peptide, S-tag, Strep-tag II, FLA, protein A, protein G, histidine affinity tag (HAT), poly-His, thioredoxin, pelB leader, and maltose binding protein (MBP), but is not limited thereto. It is possible use any tag peptide for purification that is used in a process of expressing and purifying a protein in a microorganism in the art. It will be apparent to those skilled in the art that the peptide for purification may be cleaved according to a method known in the art after the completion of purification, and a mutated non-toxic protease or fusion non-toxic protease from which the tag peptide for purification has been detached may be used for its original purpose.
[0081] In the present invention, any one of the peptides (i.e., a peptide for fusion or purification) may be fused directly or via a linker to the non-toxic protease, and the linker sequence comprises about 3 to 20 amino acids, more preferably about 3 to 10 amino acids. The linker sequence is preferably flexible so that the non-toxic protease is not maintained in an undesirable conformation. The linker sequence may be used, for example, to space the non-toxic protease moiety apart from the fused peptide. Specifically, when the non-toxic protease is fused with two or more peptides selected from the group consisting of a cell penetrating peptide, a belt domain fragment peptide, a cell targeting peptide, a yeast secretion signal peptide, and a tag peptide for purification, the peptide linker sequence may be appropriately placed as needed between the non-toxic protease and the peptide and/or between any two or more selected peptides to provide molecular flexibility. In order to provide flexibility, the linker preferably predominantly comprises amino acids having small side chains, such as glycine, alanine and serine. Preferably, at least about 80 or 90 percent of the linker sequence comprises a glycine, alanine or serine residue, in particular a glycine or serine residue. One suitable linker sequence may be a peptide linker, preferably represented by (Gly).sub.N (wherein N is an integer ranging from 3 to 10), but is not limited thereto.
[0082] The present invention may further comprise a peptide sequence cleavable by a protease for cleavage between the C-terminus of the non-toxic protease and the N-terminus of a peptide selected from the group consisting of a cell penetrating peptide, a belt domain fragment peptide, a cell targeting peptide, a yeast secretion signal peptide, and a tag peptide for purification.
[0083] In the present invention, the cleavable peptide sequence may be LVPRGS, which is one of the cleavage sequences of the thrombin-like enzyme batroxobin, but is not limited thereto. In one embodiment, the cleavable peptide sequence is derived from the cleavage sequence of human fibrinogen alpha-chain, which is one of the cleavage sequences of the thrombin-like enzyme batroxobin, which is a protein cleaving enzyme. When the peptide fused with a non-toxic protease is cleaved by the cleavage sequence, the non-toxic protease may be linked to the cleaved peptide by a disulfide bond to form a heterodimer.
[0084] However, any proteases that may cleave the peptide fused with the non-toxic protease include, without limitation, trypsin, pepsin, Lys-C endoproteinase, Lys-N endoproteinase, arginyl, endopeptidase, plasmin, omptin and clostridial proteases, as described in EP2524963. In one embodiment, the protease for cleavage is trypsin or Lys-C endoproteinase. In one embodiment, the protease is a protease that cleaves a non-toxic protease non-native (i.e. exogenous) cleavage site. Non-native proteases that may be utilized include, but are not limited to, enterokinase (DDDDKθ) (SEQ ID NO: 50), factor Xa (IEGR↓ (SEQ ID NO: 51)/IDGR↓) (SEQ ID NO: 52), TEV (Tobacco Etch Virus) (ENLYFQ↓G) (SEQ ID NO: 53), thrombin (LVPR↓GS) (SEQ ID NO: 54), and precleavage (LEVLFQ↓GP) (SEQ ID NO: 55), (↓ indicates a cleavage site). In the present invention, the cell penetrating peptide may be selected from the group consisting of Protein-derived Penetration (RQIKIWFQNRRMKWKK) (SEQ ID NO: 56), Tat peptide (GRKKRRQRRRPPQ) (SEQ ID NO: 57), pVEC (LLIILRRRIRKQAHAHSK) (SEQ ID NO: 58), chimeric transportan (GWTLNSAGYLLGKINLKALAALAKKIL) (SEQ ID NO: 59), MPG (GALFLGFLGAAGSTMGAWSQPKKKRKV) (SEQ ID NO: 60), Pep-1 (KETWWETWWTEWSQPKKKRKV) (SEQ ID NO: 61), synthetic Polyarginines ((R)n; 6<n<12), MAP (KLALKLALKALKAALKLA) (SEQ ID NO: 62), and R.sub.6W.sub.3 (RRWWRRWRR) (SEQ ID NO: 63), but is not limited thereto (see C. Bechara et al. FEBS Letter 587 (2013) 1693-1702).
[0085] In one embodiment of the present invention, the cell targeting peptide may be NH2-Thr-Tyr-Arg-Ser-Arg-Lys-Tyr-(Thror Ser) -Ser-Trp-Tyr-COOH [TYRSRKY(S/T)SWY], which is a peptide derived from the amino acids at positions 105 to 115 of human basic fibroblast growth factor, but is not limited thereto. It will be obvious to those skilled in the art that any peptides used as targeting moieties for conventional non-toxic proteases, such as lectin wheat germ agglutinin, nerve growth factor (NGF), epidermal growth factor, an antibody fragment, or a growth hormone releasing hormone (GHRH) ligand (see Elena Fonfria et al., Toxins (Basel). 2018 Jul; 10(7): 278.) may be used in fusion with the non-toxic protease.
[0086] In still another aspect, the present invention is directed to a mutant gene encoding the mutated non-toxic protease.
[0087] In the present invention, the mutant gene may be represented by a nucleotide sequence selected from the group consisting of SEQ ID NOs: 30, 32 and 34.
[0088] In yet another aspect, the present invention is directed to a gene construct comprising: the mutant gene; and any one or more nucleic acids selected from the group consisting of
[0089] i) a nucleic acid encoding a cell penetrating peptide;
[0090] ii) a nucleic acid encoding a belt domain fragment peptide; and
[0091] iii) a nucleic acid encoding a cell targeting peptide.
[0092] In the present invention, the nucleic acid encoding the cell penetrating peptide may be represented by the nucleotide sequence of SEQ ID NO: 4, the nucleic acid encoding the belt domain fragment peptide may be represented by the nucleotide sequence of SEQ ID NO: 6, and the nucleic acid encoding the cell targeting peptide may be represented by the nucleotide sequence of SEQ ID NO: 8, but the present invention is not limited thereto.
[0093] In another aspect, the present invention is directed to a gene construct comprising: the mutant gene; and any one or more nucleic acids selected from the group consisting of
[0094] i) a nucleic acid encoding a yeast secretion signal peptide;
[0095] ii) a nucleic acid encoding a cell penetrating peptide; and
[0096] iii) a nucleic acid encoding a cell targeting peptide.
[0097] In the present invention, the nucleic acid encoding the yeast secretion signal peptide may be represented by the nucleotide sequence of SEQ ID NO: 47, the nucleic acid encoding the cell penetrating peptide may be represented by the nucleotide sequence of SEQ ID NO: 4, and the nucleic acid encoding the cell targeting peptide may be represented by the nucleotide sequence of SEQ ID NO: 8, but the present invention is not limited thereto.
[0098] In the present invention, the mutant gene or gene construct may further comprise a nucleic acid encoding a tag peptide for purification. The tag peptide for purification may be selected from the group consisting of glutathione-S-transferase (GST), C-myc tag, a chitin-binding domain, streptavidin binding protein (SBP), a cellulose-binding domain, a calmodulin-binding peptide, S-tag, Strep-tag II, FLA, protein A, protein G, histidine affinity tag (HAT), poly-His, thioredoxin, pelB leader, and maltose binding protein (MBP), but is not limited thereto. It is possible to use any tag peptide for purification that is used in a process of expressing and purifying a protein in a microorganism in the art.
[0099] In the present invention, the gene construct may further comprise a nucleic acid encoding the linker peptide that connects the peptide to the non-toxic protease, wherein the nucleic acid encoding the linker peptide may be represented by the nucleotide sequence of SEQ ID NO: 26.
[0100] The present invention may further comprise a nucleic acid encoding a peptide sequence cleavable by a cleavage protease between the C-terminus of the non-toxic protease and the N-terminus of a peptide selected from the group consisting of a cell penetrating peptide, a belt domain fragment peptide, a cell targeting peptide, a yeast secretion signal peptide, and a tag peptide for purification. The nucleic acid encoding the cleavable peptide sequence may be represented by the nucleotide sequence of SEQ ID NO: 28, but is not limited thereto.
[0101] The present invention encompasses fragments and variants of polypeptides (proteins) and genes (nucleic acids) provided as specific sequences as long as they maintain their original structural and/or functional characteristics. That is, these fragments and variants may have a sequence homology of at least 90%, more preferably at least 95%, at least 97% or at least 99% to the sequences provided in the present invention.
[0102] In another aspect, the present invention is directed to a recombinant vector having the mutant gene introduced therein.
[0103] In the present invention, as the recombinant vector, there may be used without limitation any vector known in the art that may be introduced into bacterial cells, yeast cells, mammalian cells, insect cells, plant cells, or amphibian cells and used for overexpression of recombinant proteins. Preferably, there may be used a recombinant vector that may be introduced into bacterial cells or yeast cells and used for overexpression of recombinant proteins. Preferably, the pET22b(+) (Novagen, Merk Millipore) vector may be used for expression in E. coli and the pPIC9 vector may be used for expression in yeast. However, it will be obvious to those skilled in the art that vectors usable in the present invention are not limited to these vectors, and vectors known in the art may be applied for the expression of the mutant non-toxic protease or fusion non-toxic protease of the present invention.
[0104] In another aspect, the present invention is directed to a recombinant microorganism having the recombinant vector introduced therein.
[0105] In the present invention, the recombinant microorganism may be bacteria or yeast, but is not limited thereto.
[0106] In another aspect, the present invention is directed to a method for producing a mutated non-toxic protease or a fusion non-toxic protease, the method comprising steps of:
[0107] (a) producing the mutated non-toxic protease or the fusion non-toxic protease by culturing the recombinant microorganism;
[0108] (b) disrupting the recombinant microorganism; and
[0109] (c) purifying the mutated non-toxic protease or the fusion non-toxic protease from the disrupted recombinant microorganism.
[0110] In the present invention, step (a) may be performed in two steps: seed culture followed by main culture (i.e., culture for fermentation).
[0111] In the present invention, in step (a), the recombinant microorganism may be cultured at 30 to 38° C., and then when the OD.sub.600 of the recombinant microorganism reaches 0.2 to 0.4, the culture temperature may be lowered to 16 to 20° C. and the recombinant microorganism may be further cultured. Preferably, in the main culture step in step (a), the recombinant microorganism may be cultured at 36 to 38° C., more preferably 36.5 to 37.5° C., and then when the OD.sub.600 of the recombinant microorganism reaches 0.25 to 0.35, the culture temperature may be 17 to 19° C. and the recombinant microorganism may be further cultured. In this case, protein expression may be induced by adding 0.4 to 0.6 mM IPTG to the culture medium when the OD.sub.600 reaches 0.5 to 0.7. Through this process, recovery of the mutated non-toxic protease or the fusion non-toxic protease according to the present invention from a soluble fraction is significantly increased. That is, in the initial stage, culture is performed at a high temperature in order to rapidly increase the amount of the recombinant microorganism, and then when the recombinant microorganism reaches a certain amount, the culture temperature of the recombinant microorganism is lowered to slow the metabolism of the recombinant microorganism. In addition, expression of a non-toxic protease is gradually induced by adding a small amount of IPTG, so that the refolding efficiency of the non-toxic protease is increased, and thus most of the non-toxic protease may be included in the soluble fraction. This is demonstrated by the results obtained in the present invention.
[0112] The effect of increasing the expression level of the protease in the soluble fraction is particularly pronounced in the case of the mutated protease C430G derived in the present invention. This is believed to be because, in the case of a wild-type mutant protease, a disulfide bond between cysteines is induced, and in the case of C430S and C430A, which are other mutated proteases, some non-specific disulfide bonds are induced.
[0113] In the present invention, step (c) may comprise separating the disrupted recombinant microorganism into a soluble fraction and an insoluble fraction by centrifugation, and independently purifying the mutated non-toxic protease or the fusion non-toxic protease from each fraction.
[0114] In the present invention, step (c) may comprise separating the disrupted recombinant microorganism into a soluble fraction and an insoluble fraction by centrifugation, and purifying the mutated non-toxic protease or the fusion non-toxic protease from the soluble fraction.
[0115] In the present invention, suitable medium and culture conditions that are used to culture the recombinant microorganism may be those known in the art. For example, the recombinant microorganism may be inoculated and cultured in a suitable medium for transformed E. coli or yeast, and then expression of the protein may be induced under suitable conditions. For example, expression of the protein in E. coli may be induced by supplying isopropyl-β-D-thiogalactoside, and expression of the protein in isopropyl-β or methanol-assimilating yeast may be induced by supplying methyl alcohol. After completion of the step of inducing protein expression by culture, the culture or culture medium may be recovered, and “pure recombinant protein” may be recovered therefrom. As used herein, the term “pure recombinant protein” means that the recombinant protein does not contain 5% or more, preferably 1% or more of any other proteins derived from the host cell, other than the recombinant protein of the present invention and a protein derived from the DNA sequence encoding the same.
[0116] Purification of the recombinant protein expressed in the transformed microorganism may be performed by various methods known in the art. Usually, the cell lysate or culture may be centrifuged to remove cell debris, culture impurities, etc., and then subjected to precipitation, for example, salting out (ammonium sulfate precipitation and sodium phosphate precipitation), solvent precipitation (protein fraction precipitation using acetone, ethanol, isopropyl alcohol, etc.) and the like, and subjected to dialysis, electrophoresis, and various types of column chromatography. As the types of chromatography, techniques such as ion exchange chromatography, gel-filtration chromatography, HPLC, reverse phase HPLC, adsorption chromatography, affinity column chromatography and ultrafiltration may be used alone or in combination.
[0117] In the present invention, the term “non-toxic protease” is meant to include a peptide that has significantly reduced toxicity due to removal of the heavy chain domain from the natural botulinum toxin type A and has the natural botulinum toxin type A light-chain domain having protease activity, as well as a variant of the peptide.
[0118] In another aspect, the present invention is directed to a pharmaceutical composition for treating Dystonia containing the mutated or fusion non-toxic protease as an active ingredient.
[0119] In the present invention, the pharmaceutical composition may be for transdermal administration, but is not limited thereto.
[0120] In another aspect, the present invention is directed to a method for alleviating or treating symptoms of Dystonia, the method comprising a step of administering the mutated or fusion non-toxic protease to a subject in need of alleviation or treatment of symptoms of Dystonia.
[0121] In another aspect, the present invention is directed to the use of the mutated or fusion non-toxic protease for the manufacture of a medicament for use in the alleviation or treatment of symptoms of Dystonia.
[0122] In another aspect, the present invention is directed to the use of the above-described mutated or fusion non-toxic protease for use in a method for alleviating or treating symptoms of Dystonia.
[0123] In the present invention, the muscular dystonia may be selected from the group consisting of facial spasm, eyelid spasm, torticollis, blepharospasm, spasmodic torticollis, cervical dystonia, oromandibular dystonia, spasmodic dysphonia, migraine, anal pruritus, and hyperhidrosis, but is not limited thereto.
[0124] In another aspect, the present invention is directed to a hyaluronic acid microneedle patch containing the mutated or fusion non-toxic protease.
[0125] In the present invention, the hyaluronic acid microneedle patch may be used for the treatment or alleviation of a symptom selected from the group consisting of facial spasm, eyelid spasm, torticollis, blepharospasm, spasmodic torticollis, cervical dystonia, oromandibular dystonia, spasmodic dysphonia, migraine, anal pruritus, and hyperhidrosis, but is not limited thereto.
[0126] As used herein, the term “treating” means reversing, alleviating, inhibiting the progression of, or preventing a disorder or disease to which the term applies, or one or more symptoms of the disorder or disease, unless otherwise stated. As used herein, the term “treatment” refers to the act of treating when ‘treating’ is defined as above. As used herein, the term “treatment” refers to the act of treating when the term “treating” is defined as above. Accordingly, treatment or therapy of the disease in a mammal may include one or more of the following:
[0127] (1) inhibiting the development of the disease;
[0128] (2) preventing the spread of the disease;
[0129] (3) relieving the disease;
[0130] (4) preventing the recurrence of the disease; and
[0131] (5) palliating symptoms of the disease.
[0132] As used herein, the term “effective amount” means an amount that is high enough to deliver the desired benefit, but low enough to avoid serious side effects within the scope of medical judgment. The amount of the non-toxic protease that is administered into the body by the composition of the present invention may be appropriately adjusted in consideration of the route of administration and the for administration.
[0133] The composition of the present invention may be administered to the subject once daily, once every several days, once every several months, or once or more every several years. Unit dosage means physically discrete units suitable for unit administration to human subjects and other mammals, each unit comprising a suitable pharmaceutical carrier and a predetermined amount of the protease of the present invention that exhibits a therapeutic effect. However, the dosage may vary depending on the severity of the patient's disease and the active ingredient and auxiliary active ingredient used. In addition, the total daily dosage may be divided into several times and continuously administered as needed. Accordingly, the above dosage range is not intended to limit the scope of the present invention in any way.
[0134] As used herein, the term “pharmaceutically acceptable” refers to a composition which is physiologically acceptable and, when administered to humans, does not cause allergic reactions such as gastrointestinal disorders and dizziness, or similar reactions.
[0135] The pharmaceutical composition of the present invention may be formulated using a method known in the art so as to provide quick, sustained or delayed release of the active ingredient after administration to mammals. The dosage forms may be powders, granules, tablets, emulsions, syrups, aerosols, soft or hard gelatin capsules, sterile injection solutions, sterile powders, or patches. In addition, the composition for preventing or treating a disease according to the present invention may be administered through several routes, including oral, transdermal, subcutaneous, intravenous and intramuscular routes. The dosage of the active ingredient may be suitably selected depending on various factors such as the route of administration, and patient's age, sex, weight and severity, and the active ingredient may be administered in combination with a known compound having the effect of preventing, alleviating or treating the symptoms of the disease.
[0136] Hereinafter, the present invention will be described in more detail with reference to examples. It will be obvious to those skilled in the art that these examples serve only to illustrate the present invention, and the scope of the present invention is not limited by these examples.
EXAMPLE 1. CONSTRUCTION OF VECTORS FOR EXPRESSION OF MUTATED NON-TOXIC PROTEASES AND FUSION NON-TOXIC PROTEASES
[0137] As shown in
[0138] Based on the synthesized nucleotide sequences, BTX-LC and PEP1-(ΔM)BTX-L-His were cloned by restriction enzymes (Ndel and XhoI) into the multiple cloning site (MCS) downstream of the T7 promoter-lac operator of the expression vector pET22b for E. coli. Thereafter, using the restriction enzymes EcoRI and XhoI, recombinant vectors capable of expressing various non-toxic proteases shown in Table 1 below, including the following non-toxic proteases, were constructed: PEP1-(Δ)BTX-L-His (E.coli codon optimization; theoretical pI/Mw: 8.66/55003.59 Da) capable of improving expression efficiency in E. coli; a mutated non-toxic protease in which the amino acid cysteine (Cys) at position 430 of the wind-type non-toxic protease is substituted with each of glycine (Gly), alanine (Ala) and serine (Ser); and a PEP1-(ΔM)BTX-L-BFGFRP-His (theoretical pI/Mw: 8.95/56436.13) fusion non-toxic protease. Table 2 below shows the sequences (gene cassettes for cloning of mutated non-toxic proteases) used in cloning for a point mutation at the amino acid at position 430 of the wild-type protease.
TABLE-US-00001 TABLE 1 Amino acid sequence Nucleotide sequence BTX-LC MQFVNKQFNYKDPVNGVDIAYIKIPNVG 5′- QMQPVKAFKIHNKIWVIPERDTFTNPEEG atgcaatttgttaataaacaatttaattataaagatcctgtaaatggtgttgatat DLNPPPEAKQVPVSYYDSTYLSTDNEKDN tgcttatataaaaattccaaatgtaggacaaatgcaaccagtaaaagctttta YLKGVTKLFERIYSTDLGRMLLTSIVRGIP aaattcataataaaatatgggttattccagaaagagatacatttacaaatcct FWGGSTIDTELKVIDTNCINVIQPDGSYRS gaagaaggagatttaaatccaccaccagaagcaaaacaagttccagtttca EELNLVIIGPSADIIQFECKSFGHEVLNLTR tattatgattcaacatatttaagtacagataatgaaaaagataattatttaaagg NGYGSTQYIRFSPDFTFGFEESLEVDTNPL gagttacaaaattatttgagagaatttattcaactgatcttggaagaatgttgtt LGAGKFATDPAVTLAHELIHAGHRLYGIA aacatcaatagtaaggggaataccattttggggtggaagtacaatagatac INPNRVFKVNTNAYYEMSGLEVSFEELRT agaattaaaagttattgatactaattgtattaatgtgatacaaccagatggtag FGGHDAKFIDSLQENEFRLYYYNKFKDIA ttatagatcagaagaacttaatctagtaataataggaccctcagctgatattat STLNKAKSIVGTTASLQYMKNVFKEKYLL acagtttgaatgtaaaagctttggacatgaagttttgaatcttacgcgaaatg SEDTSGKFSVDKLKFDKLYKMLTEIYTED gttatggctctactcaatacattagatttagcccagattttacatttggttttgag NFVKFFKVLNRKTYLNFDKAVFKINIVPK gagtcacttgaagttgatacaaatcctcttttaggtgcaggcaaatttgctac VNYTIYDGFNLRNTNLAANFNGQNTEINN agatccagcagtaacattagcacatgaacttatacatgctggacatagattat MNFTKLKNFTGLFEFYKLLCVRGIITSKTK atggaatagcaattaatccaaatagggtttttaaagtaaatactaatgcctatt SLDKGYNK (SEQ ID NO: 1) atgaaatgagtgggttagaagtaagctttgaggaacttagaacatttgggg gacatgatgcaaagtttatagatagtttacaggaaaacgaatttcgtctatatt attataataagtttaaagatatagcaagtacacttaataaagctaaatcaatag taggtactactgcttcattacagtatatgaaaaatgtttttaaagagaaatatct cctatctgaagatacatctggaaaattttcggtagataaattaaaatttgataa gttatacaaaatgttaacagagatttacacagaggataattttgttaagtttttt aaagtacttaacagaaaaacatatttgaattttgataaagccgtatttaagata aatatagtacctaaggtaaattacacaatatatgatggatttaatttaagaaat acaaatttagcagcaaactttaatggtcaaaatacagaaattaataatatgaa ttttactaaactaaaaaattttactggattgtttgaattttataagttgctatgtgt aagagggataataacttctaaaactaaatcattagataaaggatacaataag- 3′ (SEQ ID NO: 2) PEP1 MKETWWETWWTEWSQPKKKRKV (SEQ 5′- ID NO: 3) atgaaggaaacttggtgggaaacttggtggactgaatggtctcaaccaaag aagaagagaaaggtt-3′ (SEQ ID NO: 4) Belt ALNDLC (SEQ ID NO: 5) Gcgctgaacgatctgtgc (SEQ ID NO: 6) BFGFRP TYRSRKYXSWY (SEQ ID NO: 7) 5′-ACCTATCGCAGCCGCAAATATASC (X stands for S or T.) AGCTGGTAT-3′ (SEQ ID NO: 8) (ASC stands for AGC or ACC.) PEP1- MKETWWETWWTEWSQPKKKRKVQFVN 5′- (ΔM) KQFNYKDPVNGVDIAYIKIPNVGQMQPV atgaaggaaacttggtgggaaacttggtggactgaatggtctcaaccaaag BTX-L-His KAFKIHNKIWVIPERDTFTNPEEGDLNPPP aagaagagaaaggttcaatttgttaataaacaatttaattataaagatcctgta EAKQVPVSYYDSTYLSTDNEKDNYLKGV aatggtgttgatattgcttatataaaaattccaaatgtaggacaaatgcaacc TKLFERIYSTDLGRMLLTSIVRGIPFWGGS agtaaaagcttttaaaattcataataaaatatgggttattccagaaagagata TIDTELKVIDTNCINVIQPDGSYRSEELNL catttacaaatcctgaagaaggagatttaaatccaccaccagaagcaaaac VIIGPSADIIQFECKSFGHEVLNLTRNGYGS aagttccagtttcatattatgattcaacatatttaagtacagataatgaaaaag TQYIRFSPDFTFGFEESLEVDTNPLLGAGK ataattatttaaagggagttacaaaattatttgagagaatttattcaactgatctt FATDPAVTLAHELIHAGHRLYGIAINPNR ggaagaatgttgttaacatcaatagtaaggggaataccattttggggtggaa VFKVNTNAYYEMSGLEVSFEELRTFGGH gtacaatagatacagaattaaaagttattgatactaattgtattaatgtgatac DAKFIDSLQENEFRLYYYNKFKDIASTLN aaccagatggtagttatagatcagaagaacttaatctagtaataataggacc KAKSIVGTTASLQYMKNVFKEKYLLSEDT ctcagctgatattatacagtttgaatgtaaaagctttggacatgaagttttgaa SGKESVDKLKEDKLYKMLTEIYTEDNEVK tcttacgcgaaatggttatggctctactcaatacattagatttagcccagatttt FEKVLNRKTYLNEDKAVFKINIVPKVNYTI acatttggttttgaggagtcacttgaagttgatacaaatcctcttttaggtgca YDGENLRNTNLAANENGQNTEINNMNFT ggcaaatttgctacagatccagcagtaacattagcacatgaacttatacatg KLKNFTGLFEFYKLLCVRGIITSKTKSLDK ctggacatagattatatggaatagcaattaatccaaatagggtttttaaagta GYNKHHHHHH (SEQ ID NO: 9) aatactaatgcctattatgaaatgagtgggttagaagtaagctttgaggaact tagaacatttgggggacatgatgcaaagtttatagatagtttacaggaaaac gaatttcgtctatattattataataagtttaaagatatagcaagtacacttaata aagctaaatcaatagtaggtactactgcttcattacagtatatgaaaaatgttt ttaaagagaaatatctcctatctgaagatacatctggaaaattttcggtagata aattaaaatttgataagttatacaaaatgttaacagagatttacacagaggat aattttgttaagttttttaaagtacttaacagaaaaacatatttgaattttgataaa gccgtatttaagataaatatagtacctaaggtaaattacacaatatatgatgg atttaatttaagaaatacaaatttagcagcaaactttaatggtcaaaatacaga aattaataatatgaattttactaaactaaaaaattttactggattgtttgaatttta taagttgctatgtgtaagagggataataacttctaaaactaaatcattagataa aggatacaataagcatcaccatcaccatcactaa-3′ (SEQ ID NO: 10) PEP1- MKETWWETWWTEWSQPKKKRKVQFVN 5′- (ΔM) KQFNYKDPVNGVDIAYIKIPNVGQMQPV catatgaaggaaacttggtgggaaacttggtggaccgaatggtctcaacca BTX-L- KAFKIHNKIWVIPERDTFTNPEEGDLNPPP aagaagaagcgcaaggttcaatttgttaataaacaatttaattataaagatcc His EAKQVPVSYYDSTYLSTDNEKDNYLKGV agtaaatggtgtcgacattgcttatatcaaaattccaaatgtaggccaaatgc (E. coli TKLFERIYSTDLGRMLLTSIVRGIPFWGGS aaccagtaaaagcttttaaaattcataataaaatctgggttattccagaacgc codon TIDTELKVIDTNCINVIQPDGSYRSEELNL gatacctttaccaatccggaagaaggtgatctgaatccaccaccagaagca opti- VIIGPSADIIQFECKSFGHEVLNLTRNGYGS aaacaagttccagttagctattatgatagcacctatctgagcaccgataatga mization) TQYIRFSPDFTFGFEESLEVDTNPLLGAGK aaaagataattatctgaagggcgttaccaaactgtttgagcgcatttatagca FATDPAVTLAHELIHAGHRLYGIAINPNR ctgatctgggtcgcatgctgctgaccagcatcgtacgcggtatcccattttg VFKVNTNAYYEMSGLEVSFEELRTFGGH gggtggtagcaccatcgataccgaactgaaagttattgatactaattgtatta DAKFIDSLQENEFRLYYYNKFKDIASTLN atgtgatccaaccagatggtagctatcgcagcgaagaactgaatctggtaa KAKSIVGTTASLQYMKNVFKEKYLLSEDT tcatcggtccgagcgctgatattatccagtttgaatgtaaaagctttggtcat SGKFSVDKLKFDKLYKMLTEIYTEDNFVK gaagttctgaatctgacccgtaatggttatggcagcacccaatacattcgctt FFKVLNRKTYLNFDKAVFKINIVPKVNYTI tagcccagattttacctttggttagaggagagcctggaagttgataccaatc YDGFNLRNTNLAANFNGQNTEINNMNFT cgctgctgggtgcaggcaaatttgctaccgatccagcagtaaccctggca KLKNFTGLFEFYKLLCVRGHTSKTKSLDK catgaactgatacatgctggccatcgcctgtatggtatcgcaattaatccaa GYNKHHHHHH atcgcgtttttaaagtaaataccaatgcctattatgaaatgagcggtctggaa (SEQ ID NO: 11) gtaagctttgaggaactgcgcacctttggtggtcatgatgcaaagtttatcga tagcctgcaggaaaacgaatttcgtctgtattattataataagtttaaagatat cgcaagcaccctgaataaagctaaaagcatcgtaggtaccaccgctagcc tgcagtatatgaaaaatgtttttaaagagaaatatctgctgtctgaagatacct ctggcaaatttagcgtagataaactgaaatttgataagctgtacaaaatgctg accgagatttacaccgaggataattttgttaagttttttaaagtactgaaccgc aaaacctatctgaattttgataaagccgtatttaagatcaatatcgtaccgaa ggtaaattacaccatctatgatggttttaatctgcgcaataccaatctggcag caaactttaatggtcaaaataccgaaattaataatatgaattttaccaaactga aaaattttaccggtctgtttgaattctataagctgctgTGTgtacgcggtat catcaccagcaaaaccaaaagcctggataaaggctacaataagcatcacc atcaccatcactaataactcgag-3′ (SEQ ID NO: 12) PEP1- MKETWWETWWTEWSQPKKKRKVQFVN 5′- (ΔM) KQFNYKDPVNGVDIAYIKIPNVGQMQPV catatgaaggaaacttggtgggaaacttggtggaccgaatggtctcaacca BTX-L KAFKIHNKIWVIPERDTFTNPEEGDLNPPP aagaagaagcgcaaggttcaatttgttaataaacaatttaattataaagatcc (C430G)- EAKQVPVSYYDSTYLSTDNEKDNYLKGV agtaaatggtgtcgacattgcttatatcaaaattccaaatgtaggccaaatgc His TKLFERIYSTDLGRMLLTSIVRGIPFWGGS aaccagtaaaagcttttaaaattcataataaaatctgggttattccagaacgc TIDTELKVIDTNCINVIQPDGSYRSEELNL gatacctttaccaatccggaagaaggtgatctgaatccaccaccagaagca VIIGPSADIIQFECKSFGHEVLNLTRNGYGS aaacaagttccagttagctattatgatagcacctatctgagcaccgataatga TQYIRFSPDFTFGFEESLEVDTNPLLGAGK aaaagataattatctgaagggcgttaccaaactgtttgagcgcatttatagca FATDPAVTLAHELIHAGHRLYGIAINPNR ctgatctgggtcgcatgctgctgaccagcatcgtacgcggtatcccattttg VFKVNTNAYYEMSGLEVSFEELRTFGGH gggtggtagcaccatcgataccgaactgaaagttattgatactaattgtatta DAKFIDSLQENEFRLYYYNKFKDIASTLN atgtgatccaaccagatggtagctatcgcagcgaagaactgaatctggtaa KAKSIVGTTASLQYMKNVFKEKYLLSEDT tcatcggtccgagcgctgatattatccagtagaatgtaaaagctttggtcat SGKFSVDKLKFDKLYKMLTEIYTEDNFVK gaagttctgaatctgacccgtaatggttatggcagcacccaatacattcgctt FFKVLNRKTYLNFDKAVFKINIVPKVNYTI tagcccagatatacctaggattgaggagagcctggaagttgataccaatc YDGFNLRNTNLAANFNGQNTEINNMNFT cgctgctgggtgcaggcaaatttgctaccgatccagcagtaaccctggca KLKNFTGLFEFYKLLGVRGIITSKTKSLDK catgaactgatacatgctggccatcgcctgtatggtatcgcaattaatccaa GYNKHHHHHH (SEQ ID NO: 13) atcgcgtttttaaagtaaataccaatgcctattatgaaatgagcggtctggaa gtaagctttgaggaactgcgcacctttggtggtcatgatgcaaagtttatcga tagcctgcaggaaaacgaatttcgtctgtattattataataagtttaaagatat cgcaagcaccctgaataaagctaaaagcatcgtaggtaccaccgctagcc tgcagtatatgaaaaatgtttttaaagagaaatatctgctgtctgaagatacct ctggcaaatttagcgtagataaactgaaatttgataagctgtacaaaatgctg accgagatttacaccgaggataattttgttaagttttttaaagtactgaaccgc aaaacctatctgaattttgataaagccgtatttaagatcaatatcgtaccgaa ggtaaattacaccatctatgatggttttaatctgcgcaataccaatctggcag caaactttaatggtcaaaataccgaaattaataatatgaattttaccaaactga aaaattttaccggtctgtttgaattctataagctgctgGGCgtacgcggtat catcaccagcaaaaccaaaagcctggataaaggctacaataagcatcacc atcaccatcactaataactcgag-3′ (SEQ ID NO: 14) PEP1- MKETWWETWWTEWSQPKKKRKVQFVN 5′- (ΔM) KQFNYKDPVNGVDIAYIKIPNVGQMQPV catatgaaggaaacttggtgggaaacttggtggaccgaatggtctcaacca BTX-L KAFKIHNKIWVIPERDTFTNPEEGDLNPPP aagaagaagcgcaaggttcaatttgttaataaacaatttaattataaagatcc (C430A)- EAKQVPVSYYDSTYLSTDNEKDNYLKGV agtaaatggtgtcgacattgcttatatcaaaattccaaatgtaggccaaatgc His TKLFERIYSTDLGRMLLTSIVRGIPFWGGS aaccagtaaaagcttttaaaattcataataaaatctgggttattccagaacgc TIDTELKVIDTNCINVIQPDGSYRSEELNL gatacctttaccaatccggaagaaggtgatctgaatccaccaccagaagca VIIGPSADIIQFECKSFGHEVLNLTRNGYGS aaacaagttccagttagctattatgatagcacctatctgagcaccgataatga TQYIRFSPDFTEGFEESLEVDTNPLLGAGK aaaagataattatctgaagggcgttaccaaactgtttgagcgcatttatagca FATDPAVTLAHELIHAGHRLYGIAINPNR ctgatctgggtcgcatgctgctgaccagcatcgtacgcggtatcccattttg VFKVNTNAYYEMSGLEVSFEELRTFGGH gggtggtagcaccatcgataccgaactgaaagttattgatactaattgtatta DAKFIDSLQENEFRLYYYNKFKDIASTLN atgtgatccaaccagatggtagctatcgcagcgaagaactgaatctggtaa KAKSIVGTTASLQYMKNVFKEKYLLSEDT tcatcggtccgagcgctgatattatccagtagaatgtaaaagctttggtcat SGKESVDKLKEDKLYKMLTEIYTEDNEVK gaagttctgaatctgacccgtaatggttatggcagcacccaatacattcgctt FEKVLNRKTYLNEDKAVFKINIVPKVNYTI tagcccagatatacctaggattgaggagagcctggaagttgataccaatc YDGENLRNTNLAANENGQNTEINNMNFT cgctgctgggtgcaggcaaatttgctaccgatccagcagtaaccctggca KLKNFTGLFEFYKLLAVRGHTSKTKSLDK catgaactgatacatgctggccatcgcctgtatggtatcgcaattaatccaa GYNKHHHHHH (SEQ ID NO: 15) atcgcgtttttaaagtaaataccaatgcctattatgaaatgagcggtctggaa gtaagctttgaggaactgcgcacctttggtggtcatgatgcaaagtttatcga tagcctgcaggaaaacgaatttcgtctgtattattataataagtttaaagatat cgcaagcaccctgaataaagctaaaagcatcgtaggtaccaccgctagcc tgcagtatatgaaaaatgtttttaaagagaaatatctgctgtctgaagatacct ctggcaaatttagcgtagataaactgaaatttgataagctgtacaaaatgctg accgagatttacaccgaggataattttgttaagttttttaaagtactgaaccgc aaaacctatctgaattttgataaagccgtatttaagatcaatatcgtaccgaa ggtaaattacaccatctatgatggttttaatctgcgcaataccaatctggcag caaactttaatggtcaaaataccgaaattaataatatgaattttaccaaactga aaaattttaccggtctgtttgaattctataagctgctgGCGgtacgcggtat catcaccagcaaaaccaaaagcctggataaaggctacaataagcatcacc atcaccatcactaataactcgag-3′ (SEQ ID NO: 16) PEP1- MKETWWETWWTEWSQPKKKRKVQFVN 5′- (ΔM) KQFNYKDPVNGVDIAYIKIPNVGQMQPV catatgaaggaaacttggtgggaaacttggtggaccgaatggtctcaacca BTX-L KAFKIHNKIWVIPERDTFTNPEEGDLNPPP aagaagaagcgcaaggttcaatttgttaataaacaatttaattataaagatcc (C430S)- EAKQVPVSYYDSTYLSTDNEKDNYLKGV agtaaatggtgtcgacattgcttatatcaaaattccaaatgtaggccaaatgc His TKLFERIYSTDLGRMLLTSIVRGIPFWGGS aaccagtaaaagcttttaaaattcataataaaatctgggttattccagaacgc TIDTELKVIDTNCINVIQPDGSYRSEELNL gatacctttaccaatccggaagaaggtgatctgaatccaccaccagaagca VIIGPSADIIQFECKSFGHEVLNLTRNGYGS aaacaagttccagttagctattatgatagcacctatctgagcaccgataatga TQYIRFSPDFTEGFEESLEVDTNPLLGAGK aaaagataattatctgaagggcgttaccaaactgtttgagcgcatttatagca FATDPAVTLAHELIHAGHRLYGIAINPNR ctgatctgggtcgcatgctgctgaccagcatcgtacgcggtatcccattttg VFKVNTNAYYEMSGLEVSFEELRTFGGH gggtggtagcaccatcgataccgaactgaaagttattgatactaattgtatta DAKFIDSLQENEFRLYYYNKFKDIASTLN atgtgatccaaccagatggtagctatcgcagcgaagaactgaatctggtaa KAKSIVGTTASLQYMKNVFKEKYLLSEDT tcatcggtccgagcgctgatattatccagtagaatgtaaaagctttggtcat SGKESVDKLKEDKLYKMLTEIYTEDNEVK gaagttctgaatctgacccgtaatggttatggcagcacccaatacattcgctt FEKVLNRKTYLNEDKAVFKINIVPKVNYTI tagcccagattttacctaggattgaggagagcctggaagttgataccaatc YDGENLRNTNLAANENGQNTEINNMNFT cgctgctgggtgcaggcaaatttgctaccgatccagcagtaaccctggca KLKNFTGLFEFYKLLSVRGIITSKTKSLDK catgaactgatacatgctggccatcgcctgtatggtatcgcaattaatccaa GYNKHHHHHH (SEQ ID NO: 17) atcgcgtttttaaagtaaataccaatgcctattatgaaatgagcggtctggaa gtaagctttgaggaactgcgcacctttggtggtcatgatgcaaagtttatcga tagcctgcaggaaaacgaatttcgtctgtattattataataagtttaaagatat cgcaagcaccctgaataaagctaaaagcatcgtaggtaccaccgctagcc tgcagtatatgaaaaatgtttttaaagagaaatatctgctgtctgaagatacct ctggcaaatttagcgtagataaactgaaatttgataagctgtacaaaatgctg accgagatttacaccgaggataattttgttaagttttttaaagtactgaaccgc aaaacctatctgaattttgataaagccgtatttaagatcaatatcgtaccgaa ggtaaattacaccatctatgatggttttaatctgcgcaataccaatctggcag caaactttaatggtcaaaataccgaaattaataatatgaattttaccaaactga aaaattttaccggtctgtttgaattctataagctgctgAGCgtacgcggtat catcaccagcaaaaccaaaagcctggataaaggctacaataagcatcacc atcaccatcactaataactcgag-3′ (SEQ ID NO: 18) PEP1- MKETWWETWWTEWSQPKKKRKVQFVN 5′- (ΔM) KQFNYKDPVNGVDIAYIKIPNVGQMQPV catatgaaggaaacttggtgggaaacttggtggaccgaatggtctcaacca BTX-L KAFKIHNKIWVIPERDTFTNPEEGDLNPPP aagaagaagcgcaaggttcaatttgttaataaacaatttaattataaagatcc (C430G)- EAKQVPVSYYDSTYLSTDNEKDNYLKGV agtaaatggtgtcgacattgcttatatcaaaattccaaatgtaggccaaatgc BFGFRP- TKLFERIYSTDLGRMLLTSIVRGIPFWGGS aaccagtaaaagcttttaaaattcataataaaatctgggttattccagaacgc His TIDTELKVIDTNCINVIQPDGSYRSEELNL gatacctttaccaatccggaagaaggtgatctgaatccaccaccagaagca VIIGPSADIIQFECKSFGHEVLNLTRNGYGS aaacaagttccagttagctattatgatagcacctatctgagcaccgataatga TQYIRFSPDFTEGFEESLEVDTNPLLGAGK aaaagataattatctgaagggcgttaccaaactgtttgagcgcatttatagca FATDPAVTLAHELIHAGHRLYGIAINPNR ctgatctgggtcgcatgctgctgaccagcatcgtacgcggtatcccattttg VFKVNTNAYYEMSGLEVSFEELRTFGGH gggtggtagcaccatcgataccgaactgaaagttattgatactaattgtatta DAKFIDSLQENEFRLYYYNKFKDIASTLN atgtgatccaaccagatggtagctatcgcagcgaagaactgaatctggtaa KAKSIVGTTASLQYMKNVFKEKYLLSEDT tcatcggtccgagcgctgatattatccagtttgaatgtaaaagattggtcat SGKFSVDKLKFDKLYKMLTEIYTEDNFVK gaagttctgaatctgacccgtaatggttatggcagcacccaatacattcgctt FFKVLNRKTYLNFDKAVFKINIVPKVNYTI tagcccagattttacctttggattgaggagagcctggaagttgataccaatc YDGFNLRNTNLAANFNGQNTEINNMNFT cgctgctgggtgcaggcaaatttgctaccgatccagcagtaaccctggca KLKNFTGLFEFYKLLGVRGIITSKTKSLDK catgaactgatacatgctggccatcgcctgtatggtatcgcaattaatccaa GYNKTYRSRKYXSWYHHHHHH (SEQ ID atcgcgtttttaaagtaaataccaatgcctattatgaaatgagcggtctggaa NO: 19) gtaagctttgaggaactgcgcacctttggtggtcatgatgcaaagtttatcga (X stands for S or T.) tagcctgcaggaaaacgaatttcgtctgtattattataataagtttaaagatat cgcaagcaccctgaataaagctaaaagcatcgtaggtaccaccgctagcc tgcagtatatgaaaaatgtttttaaagagaaatatctgctgtctgaagatacct ctggcaaatttagcgtagataaactgaaatttgataagctgtacaaaatgctg accgagatttacaccgaggataattttgttaagttttttaaagtactgaaccgc aaaacctatctgaattttgataaagccgtatttaagatcaatatcgtaccgaa ggtaaattacaccatctatgatggttttaatctgcgcaataccaatctggcag caaactttaatggtcaaaataccgaaattaataatatgaattttaccaaactga aaaattttaccggtctgtttgaattctataagctgctgGGCgTACGCG GTATCATCACCAGCAAAACCAAAAGCCTGGA TAAAGGCTACAATAAGACCTATCGCAGCCGC AAATATASCAGCTGGTATCATCACCATCACCA TCACTAATAACTCGAG-3′ (SEQ ID NO: 20) (ASC stands for AGC or ACC.) PEP1- MKETWWETWWTEWSQPKKKRKVQFVN 5′- (ΔM) KQFNYKDPVNGVDIAYIKIPNVGQMQPV catatgaaggaaacttggtgggaaacttggtggaccgaatggtctcaacca BTX-L KAFKIHNKIWVIPERDTFTNPEEGDLNPPP aagaagaagcgcaaggttcaatttgttaataaacaatttaattataaagatcc (C430A)- EAKQVPVSYYDSTYLSTDNEKDNYLKGV agtaaatggtgtcgacattgcttatatcaaaattccaaatgtaggccaaatgc BFGFRP- TKLFERIYSTDLGRMLLTSIVRGIPFWGGS aaccagtaaaagcttttaaaattcataataaaatctgggttattccagaacgc His TIDTELKVIDTNCINVIQPDGSYRSEELNL gatacctttaccaatccggaagaaggtgatctgaatccaccaccagaagca VIIGPSADIIQFECKSFGHEVLNLTRNGYGS aaacaagttccagttagctattatgatagcacctatctgagcaccgataatga TQYIRFSPDFTFGFEESLEVDTNPLLGAGK aaaagataattatctgaagggcgttaccaaactgtttgagcgcatttatagca FATDPAVTLAHELIHAGHRLYGIAINPNR ctgatctgggtcgcatgctgctgaccagcatcgtacgcggtatcccattttg VFKVNTNAYYEMSGLEVSFEELRTFGGH gggtggtagcaccatcgataccgaactgaaagttattgatactaattgtatta DAKFIDSLQENEFRLYYYNKFKDIASTLN atgtgatccaaccagatggtagctatcgcagcgaagaactgaatctggtaa KAKSIVGTTASLQYMKNVFKEKYLLSEDT tcatcggtccgagcgctgatattatccagtttgaatgtaaaagattggtcat SGKFSVDKLKFDKLYKMLTEIYTEDNFVK gaagttctgaatctgacccgtaatggttatggcagcacccaatacattcgctt FFKVLNRKTYLNFDKAVFKINIVPKVNYTI tagcccagattttacctttggattgaggagagcctggaagttgataccaatc YDGFNLRNTNLAANFNGQNTEINNMNFT cgctgctgggtgcaggcaaatttgctaccgatccagcagtaaccctggca KLKNFTGLFEFYKLLAVRGIITSKTKSLDK catgaactgatacatgctggccatcgcctgtatggtatcgcaattaatccaa GYNKTYRSRKYXSWYHHHHHH (SEQ ID atcgcgtttttaaagtaaataccaatgcctattatgaaatgagcggtctggaa NO: 21) gtaagctttgaggaactgcgcacctttggtggtcatgatgcaaagtttatcga (X stands for S or T.) tagcctgcaggaaaacgaatttcgtctgtattattataataagtttaaagatat cgcaagcaccctgaataaagctaaaagcatcgtaggtaccaccgctagcc tgcagtatatgaaaaatgtttttaaagagaaatatctgctgtctgaagatacct ctggcaaatttagcgtagataaactgaaatttgataagctgtacaaaatgctg accgagatttacaccgaggataattttgttaagttttttaaagtactgaaccgc aaaacctatctgaattttgataaagccgtatttaagatcaatatcgtaccgaa ggtaaattacaccatctatgatggttttaatctgcgcaataccaatctggcag caaactttaatggtcaaaataccgaaattaataatatgaattttaccaaactga aaaattttaccggtctgtttgaattctataagctgctgGCGgTACGCG GTATCATCACCAGCAAAACCAAAAGCCTGGA TAAAGGCTACAATAAGACCTATCGCAGCCGC AAATATASCAGCTGGTATCATCACCATCACCA TCACTAATAACTCGAG-3′ (SEQ ID NO: 22) (ASC stands for AGC or ACC.) PEP1- MKETWWETWWTEWSQPKKKRKVQFVN 5′- (AM) KQFNYKDPVNGVDIAYIKIPNVGQMQPV catatgaaggaaacttggtgggaaacttggtggaccgaatggtctcaacca BTX-L KAFKIHNKIWVIPERDTFTNPEEGDLNPPP aagaagaagcgcaaggttcaatttgttaataaacaatttaattataaagatcc (C430S)- EAKQVPVSYYDSTYLSTDNEKDNYLKGV agtaaatggtgtcgacattgcttatatcaaaattccaaatgtaggccaaatgc BFGFRP- TKLFERIYSTDLGRMLLTSIVRGIPFWGGS aaccagtaaaagcttttaaaattcataataaaatctgggttattccagaacgc His TIDTELKVIDTNCINVIQPDGSYRSEELNL gatacctttaccaatccggaagaaggtgatctgaatccaccaccagaagca VIIGPSADIIQFECKSFGHEVLNLTRNGYGS aaacaagttccagttagctattatgatagcacctatctgagcaccgataatga TQYIRFSPDFTFGFEESLEVDTNPLLGAGK aaaagataattatctgaagggcgttaccaaactgtttgagcgcatttatagca FATDPAVTLAHELIHAGHRLYGIAINPNR ctgatctgggtcgcatgctgctgaccagcatcgtacgcggtatcccattttg VFKVNTNAYYEMSGLEVSFEELRTFGGH gggtggtagcaccatcgataccgaactgaaagttattgatactaattgtatta DAKFIDSLQENEFRLYYYNKFKDIASTLN atgtgatccaaccagatggtagctatcgcagcgaagaactgaatctggtaa KAKSIVGTTASLQYMKNVFKEKYLLSEDT tcatcggtccgagcgctgatattatccagtttgaatgtaaaagattggtcat SGKFSVDKLKFDKLYKMLTEIYTEDNFVK gaagttctgaatctgacccgtaatggttatggcagcacccaatacattcgctt FFKVLNRKTYLNFDKAVFKINIVPKVNYTI tagcccagattttacctttggattgaggagagcctggaagttgataccaatc YDGFNLRNTNLAANFNGQNTEINNMNFT cgctgctgggtgcaggcaaatttgctaccgatccagcagtaaccctggca KLKNFTGLFEFYKLLSVRGIITSKTKSLDK catgaactgatacatgctggccatcgcctgtatggtatcgcaattaatccaa GYNKTYRSRKYXSWYHHHHHH (SEQ ID atcgcgtttttaaagtaaataccaatgcctattatgaaatgagcggtctggaa NO: 23) gtaagctttgaggaactgcgcacctttggtggtcatgatgcaaagtttatcga (X stands for S or T.) tagcctgcaggaaaacgaatttcgtctgtattattataataagtttaaagatat cgcaagcaccctgaataaagctaaaagcatcgtaggtaccaccgctagcc tgcagtatatgaaaaatgtttttaaagagaaatatctgctgtctgaagatacct ctggcaaatttagcgtagataaactgaaatttgataagctgtacaaaatgctg accgagatttacaccgaggataattttgttaagttttttaaagtactgaaccgc aaaacctatctgaattttgataaagccgtatttaagatcaatatcgtaccgaa ggtaaattacaccatctatgatggttttaatctgcgcaataccaatctggcag caaactttaatggtcaaaataccgaaattaataatatgaattttaccaaactga aaaattttaccggtctgtttgaattctataagctgctgAGCgTACGCG GTATCATCACCAGCAAAACCAAAAGCCTGGA TAAAGGCTACAATAAGACCTATCGCAGCCGC AAATATASCAGCTGGTATCATCACCATCACCA TCACTAATAACTCGAG-3′ (SEQ ID NO: 24) (ASC stands for AGC or ACC.) Linker GGGG (SEQ ID NO: 25) GGTGGTGGTGGT (SEQ ID NO: 26) Cleavage LVPRGS (SEQ ID NO: 27) CTGGTACCACGCGGTAGC (SEQ ID NO: 28) Peptide BTX-L MQFVNKQFNYKDPVNGVDIAYIKIPNVG 5′- (C430G) QMQPVKAFKIHNKIWVIPERDTFTNPEEG atgcaatttgttaataaacaatttaattataaagatccagtaaatggtgtcgac DLNPPPEAKQVPVSYYDSTYLSTDNEKDN attgcttatatcaaaattccaaatgtaggccaaatgcaaccagtaaaagcttt YLKGVTKLFERIYSTDLGRMLLTSIVRGIP taaaattcataataaaatctgggttattccagaacgcgatacctttaccaatcc FWGGSTIDTELKVIDTNCINVIQPDGSYRS ggaagaaggtgatctgaatccaccaccagaagcaaaacaagttccagtta EELNLVIIGPSADIIQFECKSFGHEVLNLTR gctattatgatagcacctatctgagcaccgataatgaaaaagataattatctg NGYGSTQYIRFSPDFTEGFEESLEVDTNPL aagggcgttaccaaactgtttgagcgcatttatagcactgatctgggtcgca LGAGKFATDPAVTLAHELIHAGHRLYGIA tgctgctgaccagcatcgtacgcggtatcccattttggggtggtagcaccat INPNRVFKVNTNAYYEMSGLEVSFEELRT cgataccgaactgaaagttattgatactaattgtattaatgtgatccaaccag FGGHDAKFIDSLQENEFRLYYYNKFKDIA atggtagctatcgcagcgaagaactgaatctggtaatcatcggtccgagcg STLNKAKSIVGTTASLQYMKNVFKEKYLL ctgatattatccagtttgaatgtaaaagctttggtcatgaagttctgaatctga SEDTSGKESVDKLKEDKLYKMLTEIYTED cccgtaatggttatggcagcacccaatacattcgctttagcccagattttacc NFVKFFKVLNRKTYLNFDKAVFKINIVPK tttggttttgaggagagcctggaagttgataccaatccgctgctgggtgcag VNYTIYDGFNLRNTNLAANFNGQNTEINN gcaaatttgctaccgatccagcagtaaccctggcacatgaactgatacatg MNFTKLKNFTGLFEFYKLLGVRGIITSKT ctggccatcgcctgtatggtatcgcaattaatccaaatcgcgtttttaaagta KSLDKGYNK aataccaatgcctattatgaaatgagcggtctggaagtaagctttgaggaac (SEQ ID NO: 29) tgcgcacctttggtggtcatgatgcaaagtttatcgatagcctgcaggaaaa cgaatttcgtctgtattattataataagtttaaagatatcgcaagcaccctgaa taaagctaaaagcatcgtaggtaccaccgctagcctgcagtatatgaaaaa tgtttttaaagagaaatatctgctgtctgaagatacctctggcaaatttagcgt agataaactgaaatttgataagctgtacaaaatgctgaccgagatttacacc gaggataattttgttaagttttttaaagtactgaaccgcaaaacctatctgaatt ttgataaagccgtatttaagatcaatatcgtaccgaaggtaaattacaccatc tatgatggattaatctgcgcaataccaatctggcagcaaactttaatggtca aaataccgaaattaataatatgaattttaccaaactgaaaaattttaccggtct gtttgaattctataagctgctgGGCgtacgcggtatcatcaccagcaaaa ccaaaagcctggataaaggctacaataag-3′ (SEQ ID NO: 30) BTX-L MQFVNKQFNYKDPVNGVDIAYIKIPNVG 5′- (C430A) QMQPVKAFKIHNKIWVIPERDTFTNPEEG atgcaatttgttaataaacaatttaattataaagatccagtaaatggtgtcgac DLNPPPEAKQVPVSYYDSTYLSTDNEKDN attgcttatatcaaaattccaaatgtaggccaaatgcaaccagtaaaagcttt YLKGVTKLFERIYSTDLGRMLLTSIVRGIP taaaattcataataaaatctgggttattccagaacgcgataccataccaatcc FWGGSTIDTELKVIDTNCINVIQPDGSYRS ggaagaaggtgatctgaatccaccaccagaagcaaaacaagttccagtta EELNLVIIGPSADIIQFECKSFGHEVLNLTR gctattatgatagcacctatctgagcaccgataatgaaaaagataattatctg NGYGSTQYIRFSPDFTFGFEESLEVDTNPL aagggcgttaccaaactgtttgagcgcatttatagcactgatctgggtcgca LGAGKFATDPAVTLAHELIHAGHRLYGIA tgctgctgaccagcatcgtacgcggtatcccattttggggtggtagcaccat INPNRVFKVNTNAYYEMSGLEVSFEELRT cgataccgaactgaaagttattgatactaattgtattaatgtgatccaaccag FGGHDAKFIDSLQENEFRLYYYNKFKDIA atggtagctatcgcagcgaagaactgaatctggtaatcatcggtccgagcg STLNKAKSIVGTTASLQYMKNVFKEKYLL ctgatattatccagtttgaatgtaaaagctttggtcatgaagttctgaatctga SEDTSGKFSVDKLKFDKLYKMLTEIYTED cccgtaatggttatggcagcacccaatacattcgctttagcccagattttacc NFVKFFKVLNRKTYLNFDKAVFKINIVPK tttggttttgaggagagcctggaagttgataccaatccgctgctgggtgcag VNYTIYDGFNLRNTNLAANFNGQNTEINN gcaaatttgctaccgatccagcagtaaccctggcacatgaactgatacatg MNFTKLKNFTGLFEFYKLLAVRGIITSKTK ctggccatcgcctgtatggtatcgcaattaatccaaatcgcgtttttaaagta SLDKGYNK aataccaatgcctattatgaaatgagcggtctggaagtaagctttgaggaac (SEQ ID NO: 31) tgcgcacctttggtggtcatgatgcaaagtttatcgatagcctgcaggaaaa cgaatttcgtctgtattattataataagtttaaagatatcgcaagcaccctgaa taaagctaaaagcatcgtaggtaccaccgctagcctgcagtatatgaaaaa tgtttttaaagagaaatatctgctgtctgaagatacctctggcaaatttagcgt agataaactgaaatttgataagctgtacaaaatgctgaccgagatttacacc gaggataattttgttaagttttttaaagtactgaaccgcaaaacctatctgaatt ttgataaagccgtatttaagatcaatatcgtaccgaaggtaaattacaccatc tatgatggattaatctgcgcaataccaatctggcagcaaactttaatggtca aaataccgaaattaataatatgaattttaccaaactgaaaaattttaccggtct gtttgaattctataagctgctgGCGgtacgcggtatcatcaccagcaaaa ccaaaagcctggataaaggctacaataag-3′ (SEQ ID NO: 32) BTX-L MQFVNKQFNYKDPVNGVDIAYIKIPNVG 5′- (C430S QMQPVKAFKIHNKIWVIPERDTFTNPEEG atgcaatttgttaataaacaatttaattataaagatccagtaaatggtgtcgac DLNPPPEAKQVPVSYYDSTYLSTDNEKDN attgcttatatcaaaattccaaatgtaggccaaatgcaaccagtaaaagcttt YLKGVTKLFERIYSTDLGRMLLTSIVRGIP taaaattcataataaaatctgggttattccagaacgcgataccataccaatcc FWGGSTIDTELKVIDTNCINVIQPDGSYRS ggaagaaggtgatctgaatccaccaccagaagcaaaacaagttccagtta EELNLVIIGPSADIIQFECKSFGHEVLNLTR gctattatgatagcacctatctgagcaccgataatgaaaaagataattatctg NGYGSTQYIRFSPDFTFGFEESLEVDTNPL aagggcgttaccaaactgtttgagcgcatttatagcactgatctgggtcgca LGAGKFATDPAVTLAHELIHAGHRLYGIA tgctgctgaccagcatcgtacgcggtatcccattttggggtggtagcaccat INPNRVFKVNTNAYYEMSGLEVSFEELRT cgataccgaactgaaagttattgatactaattgtattaatgtgatccaaccag FGGHDAKFIDSLQENEFRLYYYNKFKDIA atggtagctatcgcagcgaagaactgaatctggtaatcatcggtccgagcg STLNKAKSIVGTTASLQYMKNVFKEKYLL ctgatattatccagtttgaatgtaaaagctttggtcatgaagttctgaatctga SEDTSGKFSVDKLKFDKLYKMLTEIYTED cccgtaatggttatggcagcacccaatacattcgctttagcccagattttacc NFVKFFKVLNRKTYLNFDKAVFKINIVPK tttggttttgaggagagcctggaagttgataccaatccgctgctgggtgcag VNYTIYDGFNLRNTNLAANFNGQNTEINN gcaaatttgctaccgatccagcagtaaccctggcacatgaactgatacatg MNFTKLKNFTGLFEFYKLLSVRGIITSKTK ctggccatcgcctgtatggtatcgcaattaatccaaatcgcgtttttaaagta SLDKGYNK aataccaatgcctattatgaaatgagcggtctggaagtaagctttgaggaac (SEQ ID NO:33) tgcgcacctttggtggtcatgatgcaaagtttatcgatagcctgcaggaaaa cgaatttcgtctgtattattataataagtttaaagatatcgcaagcaccctgaa taaagctaaaagcatcgtaggtaccaccgctagcctgcagtatatgaaaaa tgtttttaaagagaaatatctgctgtctgaagatacctctggcaaatttagcgt agataaactgaaatttgataagctgtacaaaatgctgaccgagatttacacc gaggataattttgttaagttttttaaagtactgaaccgcaaaacctatctgaatt ttgataaagccgtatttaagatcaatatcgtaccgaaggtaaattacaccatc tatgatggattaatctgcgcaataccaatctggcagcaaactttaatggtca aaataccgaaattaataatatgaattttaccaaactgaaaaattttaccggtct gtttgaattctataagctgctgAGCgtacgcggtatcatcaccagcaaaa ccaaaagcctggataaaggctacaataag-3′ (SEQ ID NO: 34)
TABLE-US-00002 TABLE 2 Mutation Sequence C430G GAATTCTATAAGCTGCTGGGCGTACGCGGTATCATCACCAGCAAAACCAAAAG CCTGGATAAAGGCTACAATAAGCATCACCATCACCATCACTAATAACTCGAG (SEQ ID NO: 35) C430A GAATTCTATAAGCTGCTGGCGGTACGCCGGTATCATCACCAGCAAAACCAAAAG CCTGGATAAAGGCTACAATAAGCATCACCATCACCATCACTAATAACTCGAG (SEQ ID NO: 36) C430S GAATTCTATAAGCTGCTGAGCGTACGCGGTATCATCACCAGCAAAACCAAAAG CCTGGATAAAGGCTACAATAAGCATCACCATCACCATCACTAATAACTCGAG (SEQ ID NO: 37) C430G- GAATTCTATAAGCTGCTGGGCGTACGCGGTATCATCACCAGCAAAACCAAAAG BFGRP CCTGGATAAAGGCTACAATAAGACCTATCGCAGCCGCAAATATASCAGCTGGT ATCATCACCATCACCATCACTAATAACTCGAG-3′ (ASC stands for AGC or ACC.) C430A- GAATTCTATAAGCTGCTGGCGGTACGCGGTATCATCACCAGCAAAACCAAAAG BFGRP CCTGGATAAAGGCTACAATAAGACCTATCGCAGCCGCAAATATASCAGCTGGT ATCATCACCATCACCATCACTAATAACTCGAG-3′ (ASC stands for AGC or ACC.) C430S- GAATTCTATAAGCTGCTGAGCGTACGCGGTATCATCACCAGCAAAACCAAAAG BFGRP CCTGGATAAAGGCTACAATAAGACCTATCGCAGCCGCAAATATASCAGCTGGT ATCATCACCATCACCATCACTAATAACTCGAG-3′ (ASC stands for AGC or ACC.) Belt GAATTCTATAAGCTGCTGTGTGTACGCGGTATCATCACCAGCAAAACCAAAAGCCT GGATAAAGGCTACAATAAGGCGCTGAACGATCTGTGCCATCACCATCACCATCAC TAATAACTCGAG (SEQ ID NO: 41)
EXAMPLE 2. EXPRESSION OF NON-TOXIC PROTEASE IN E. coli
[0139] Each of the expression vectors for E. coli constructed in Example 1 was transformed into an E. coli BL21 (DE3) strain as a host for gene expression to construct recombinant E.coli strains. LB culture medium was inoculated with the ampicillin-resistant colonies and culturing was performed with shaking at 37° C. When the absorbance at 600 nm reached 0.6 to 0.7, 0.5 mM IPTG was added to the culture medium, and then expression of the non-toxic protease was induced at 18 to 25° C. depending on the conditions. Next, the cells were cultured for 6 to 12 hours, and recombinant E. coli cells were harvested by centrifugation (at 3,000 rpm for 20 minutes).
[0140] The harvested E. coli cells were suspended in a 25% sucrose solution (containing 50 mM Tris HCl, pH 7.8, 0.1 mM EDTA), and 0.2 mg/ml of lysozyme was added thereto, followed by incubation at 4° C. for 1.5 hours. Next, a 1.5-fold volume of lysis buffer (20 mM Tris HCl, pH7.8, 0.2 M NaCl, 1% DCA, 1.6% NP-40 (or 1% SDS), 2 mM EDTA, 0.5 mM DTT) was added to the suspension, and then the cells were lysed using ultrasound at 4° C. The protein was quantified and loaded on SDS-PAGE gel, followed by Coomassie blue staining.
[0141] As a result, as shown in
EXAMPLE 3. PURIFICATION OF NON-TOXIC PROTEASE
[0142] To purify the non-toxic proteases, each of the recombinant E. coli strains was cultured according to the method of Example 2, and then the E. coli cells were harvested by centrifugation (at 3,000 rpm for 20 minutes). 1 g of the harvested cells were suspended in a cell suspending solution (50 mM Tris HCl, pH 7.8, 0.1 mM EDTA, 25% sucrose), and 0.2 mg/ml of lysozyme was added thereto, followed by incubation at 4° C. for 1.5 hours. Then, a 1.5-fold volume (3 ml) of lysis buffer (20 mM Tris HCl, pH 7.8, 0.2 M NaCl, 1% DCA, 1.6% NP-40(or 1% SDS), 2 mM EDTA, 0.5 mM DTT) was added to the suspension, and the cells were disrupted using an ultrasonic disruptor until the viscosity of the cell lysate disappeared when viewed with the naked eye. The cell lysate was separated into a soluble fraction and an insoluble fraction by centrifugation at 12,000 rpm and 4° C. for 15 minutes.
[0143] As a result of observing the fractions by Coomassie blue staining or Western blotting after SDS-PAGE, it was confirmed that a significant portion of each of the wild-type and mutated non-toxic proteases was present in the insoluble fractions.
[0144] The non-toxic protease present in the soluble fraction was loaded onto a Ni.sup.2++-IDA affinity column (iminodiacetic acid). The column was washed with a 10-fold volume of binding buffer (50 mM potassium phosphate buffer (pH 8.0) +300 mM NaCl +1 mM PMSF +1 mM β-mercaptoethanol) and a 6-fold volume of washing buffer (50 mM potassium phosphate buffer (pH 8.0) +300 mM NaCl +1mM PMSF +1 mM β-mercaptoethanol +10 mM imidazole), and then eluted stepwise with elution buffers (50 mM potassium phosphate buffer (pH 8.0) +300 mM NaCl +1 mM PMSF +1 mM β-mercaptoethanol) containing 200, 300 or 500 mM imidazole.
[0145] Meanwhile, after the soluble fraction was isolated, the non-toxic protease precipitate of the insoluble fraction was washed three times with 5 ml of the same volume as the supernatant (washing buffer, 2 to 4 M urea, 0.5% Triton X100, mM EDTA, 1 mM DTT) and the supernatant was removed. Meanwhile, after the soluble fraction was isolated, the non-toxic protease precipitate of the insoluble fraction was washed three times with 5 ml (the same volume as that of the supernatant) of washing buffer (2 to 4 M urea, 0.5% Triton X100, 1 mM EDTA, 1 mM DTT), and then the supernatant was removed. The recovered precipitate was denatured with 1 ml of urea solution (8 M urea, 20 mM Tris HCl, pH 7.8, 20 μM DTT), and then transferred to a dialysis membrane (molecular weight cutoff: 12,000, Sigma, cat no: D-0530, USA) and subjected to refolding by dialysis three times with a volume 100 times the volume of the urea solution of dialysis buffer (0.08 mM NaCl, 20mM Tris HCl, pH 7.8, 0.03% tween 20), and 10 to 20 μM ZnCl.sub.2 was added thereto as needed. The resulting material was loaded onto a Ni.sup.2+-IDA affinity column (iminodiacetic acid), and the column was washed stepwise with a 10-fold volume of binding buffer (50 mM potassium phosphate buffer (pH 8.0) +300 mM NaCl +1 mM PMSF +1 mM β-mercaptoethanol) and a 6-fold volume of washing buffer (50 mM potassium phosphate buffer (pH 8.0) +300 mM NaCl +1 mM PMSF +1 mM β-mercaptoethanol +10mM imidazole), and then eluted stepwise with elution buffers (50 mM potassium phosphate buffer (pH 8.0)+300 mM NaCl+1 mM PMSF+1 mM β-mercaptoethanol) containing each of 200, 300 and 500 mM imidazole. The fractions were combined and desalted with a PD-10 column (GE Healthcare, USA). Protein concentration was measured by BCA protein assay using bovine serum albumin as a standard.
[0146] As a result, as shown in
EXAMPLE 4. ANALYSIS OF FOLDING/REFOLDING EFFICIENCIES OF NON-TOXIC PROTEASES
[0147] As a result of performing the purification and refolding process on the insoluble fraction in Example 3, as shown in
[0148] Meanwhile, after centrifugation at 12,000 rpm for 15 minutes, the content (%) of the non-toxic protease in each of the soluble fraction and the insoluble fraction (pellet fraction, aggregation) was analyzed by Coomassie blue staining after SDS-PAGE. As a result, as shown in
EXAMPLE 5. ANALYSIS OF ENZYMATIC ACTIVITY Of NON-TOXIC PROTEASE
[0149] In order to analyze the enzymatic activities of the non-toxic proteases and variants thereof according to the present invention, a substrate for analyzing the cleavage by the non-toxic protease was synthesized. As the substrate, the ANNEXIN V protein fused to the C-terminus of SNAP25 was used for expression (Table 3), and a nucleotide sequence encoding the SNAP25-ANNEXIN V fusion protein was cloned into a pET22b (+) expression vector which was then transformed into an E. coli BL21 (DE3) strain. The transformed E. coli strain was cultured with shaking in LB medium at 37° C., and when it reached an O.D.sub.600 of 0.6 to 0.7, 0.5 to 1 mM IPTG was added thereto, and the strain was cultured for 6 hours to induce protein expression. After the cells were disrupted with an ultrasonic disruptor, only the soluble fraction (supernatant) was recovered and purification was performed using his-6 tag contained in SNAP25-ANNEXIN V in a manner similar to the method of Example 3. As a result, as shown in
[0150] In order to confirm whether all of the non-toxic proteases purified according to the present invention retain the same enzymatic activity as the wild-type non-toxic protease, cleavage of the purified non-toxic proteases was tested using the purified SANP25-ANNEXIN V as a substrate. To this end, the prepared SNAP25-ANNEXiN V and the non-toxic protease were mixed together at a ratio of 20:1 (w/w) (substrate (SNAP25-ANNEXINV): enzyme (protease)) in an enzymatic reaction solution (100 mM HEPES pH 7.4, 1 mM NaCl, 20 μM ZnCl.sub.2, mM DTT 2) and subjected to enzymatic reaction at 37° C. for 5 hours. As a result of analyzing the samples after completion of the reaction, it was confirmed that all of the non-toxic proteases according to the present invention cleaved 50-kDa SNAP25-ANNEXiN V to form 36-kDa and 14-kDa protein bands. This demonstrated that the mutated non-toxic proteases with improved productivity maintained their enzyme activity without changes.
TABLE-US-00003 TABLE 3 Amino acid sequence Nucleotide sequence His-SNAP25- MGGSHHHHHHENLYFQGSGGNKLKSSD 5′- ANNEXIN V AYKKAWGNNQDGVVASQPARVVDERE catATGGGCGGCAGCCATCATCATCATCA QMAISGGFIRRVTNDARENEMDENLEQV TCATGAAAACCTGTATTTTCAGGGCTCT SGIIGNLRHMALDMGNEIDTQNRQIDRIM GGCGGCAACAAGCTGAAATCTAGCGAT EKADSNKTRIDEANQRATKMLGSGAQV GCTTACAAAAAAGCCTGGGGCAATAATC LRGTVTDFPGFDERADAETLRKAMKGL AGGACGGCGTGGTGGCCAGCCAGCCTGC GTDEESILTLLTSRSNAQRQEISAAFKTLF TCGTGTAGTGGACGAACGTGAGCAGATG GRDLLDDLKSELTGKFEKLIVALMKPSR GCCATCAGCGGCGGCTTCATCCGTCGTG LYDAYELKHALKGAGTNEKVLTEIIASR TAACCAATGATGCCCGTGAAAATGAAAT TPEELRAIKQVYEEEYGSSLEDDVVGDTS GGATGAAAACCTGGAGCAGGTGAGCGG GYYQRMLVVLLQANRDPDAGIDEAQVE CATCATCGGCAACCTGCGTCACATGGCC QDAQALFQAGELKWGTDEEKFITIFGTRS CTGGATATGGGCAATGAGATCGATACCC VSHLRKVEDKYMTISGFQIEETIDRETSG AGAATCGTCAGATCGACCGTATCATGGA NLEQLLLAVVKSIRSIPAYLAETLYYAMK GAAGGCTGATTCCAACAAAACCCGTATC GAGTDDHTLIRVMVSRSEIDLENIRKEFR GATGAGGCCAACCAACGTGCAACCAAG KNFATSLYSMIKGDTSGDYKKALLLLCG ATGCTGGGCAGCGGCGCACAGGTTCTGC EDD (SEQ ID NO: 42) GTGGCACTGTGACCGACTTCCCTGGCTT TGATGAGCGTGCTGATGCAGAAACCCTG CGTAAGGCTATGAAAGGCCTGGGCACCG ATGAGGAGAGCATCCTGACCCTGCTGAC CTCCCGTAGCAATGCTCAGCGTCAGGAA ATCTCTGCAGCTTTTAAGACCCTGTTTGG CCGTGATCTGCTGGATGACCTGAAATCC GAACTGACCGGCAAATTTGAAAAACTGA TCGTGGCTCTGATGAAACCTTCTCGTCTG TATGATGCTTATGAACTGAAACATGCCC TGAAGGGCGCTGGCACCAATGAAAAAG TACTGACCGAAATCATTGCTTCTCGTAC CCCTGAAGAACTGCGTGCCATCAAACAA GTTTATGAAGAAGAATATGGCTCTAGCC TGGAAGATGACGTGGTGGGCGACACTTC TGGCTACTACCAGCGTATGCTGGTGGTT CTGCTGCAGGCTAACCGTGACCCTGATG CTGGCATCGATGAAGCTCAAGTTGAACA AGATGCTCAGGCTCTGTTTCAGGCTGGC GAACTGAAATGGGGCACCGATGAAGAA AAGTTTATCACCATCTTTGGCACCCGTA GCGTGTCTCATCTGAGAAAGGTGTTTGA CAAGTACATGACCATCTCTGGCTTTCAA ATCGAGGAAACCATCGACCGTGAGACTT CTGGCAATCTGGAGCAACTGCTGCTGGC TGTTGTGAAATCTATCCGTAGCATCCCT GCCTACCTGGCAGAGACCCTGTATTATG CTATGAAGGGCGCTGGCACCGATGATCA TACCCTGATCCGTGTCATGGTTTCCCGTA GCGAGATCGATCTGTTTAACATCCGTAA GGAGTTTCGTAAGAATTTTGCCACCTCT CTGTATTCCATGATCAAGGGCGATACCT CTGGCGACTATAAGAAAGCTCTGCTGCT GCTGTGTGGCGAAGATGACTAActcgag-3′ (SEQ ID NO: 43)
EXAMPLE 6. EXPRESSION OF NON-TOXIC PROTEASE IN YEAST
[0151] In another embodiment, to express a non-toxic protease in yeast, the sequence shown in Table 4 below was subcloned by restriction enzymes (BamHI and NotI) downstream of the AOX1 promoter of pPIC9. Meanwhile, his 6-tag was introduced for purification of the non-toxic protease, and a TEV cleavage enzyme peptide sequence was added in order to remove his 6-tag after purification, thereby constructing a vector for expression in Pichia pastoris.
[0152] A Pichia pastoris strain was transformed with the vector and cultured in histidine-deficient medium. Then, the formed colonies were cultured in the methanol-assimilating yeast medium BM (buffered minimal medium: 100 mM potassium phosphate, pH 6.0 1.34% yeast nitrogen base, 4×10.sup.−5% biotin) by supplying glycerol (1%) as a carbon source, and then the carbon source was replaced with methanol (0.5%), thus inducing expression of the non-toxic protease. The culture medium was recovered, and the expressed non-toxic protease was purified therefrom using His-Tag and subjected to Western blotting with a botulinum light-chain antibody (cat no. PA5-48053 (ThermoFisher Scientific, USA). Meanwhile, since a non-toxic protease with an increased molecular weight due to glycosylation is expressed in yeast, the non-target protease was aglycosylated by reaction with the enzyme PNGaseF (cat no. P0704S, New England Bio Lab USA), which cuts sugar chains from the protein, according to the manufacturer's instructions. Then, the non-target protease was subjected to SDS-PAGE and then to Western blotting with a botulinum light-chain antibody.
[0153] As a result, as shown in
TABLE-US-00004 TABLE 4 Amino acid sequence Nucleotide sequence SMF- MRFPSIFTAVLFAASSALAAPVNTTTED 5- (ΔM)BTX- ETAQIPAEAVIGYSDLEGDFDVAVLPFS atgagatttccatctatttttactgcagttttgtttgcagcatcttctgca L-PEP1- NSTNNGLLFINTTIASIAAKEEGVSLEK ttggcagcaccagttaacactactactgaagatgaaactgcacaaattcc TEV-His RQFVNKQFNYKDPVNGVDIAYIKIPNV agcagaagcagttattggttactctgatttggaaggtgattttgatgttg GQMQPVKAFKIHNKIWVIPERDTFTNP ctgttttgccattttctaactctactaataacggtttgttgtttattaata EEGDLNPPPEAKQVPVSYYDSTYLSTD ctactattgcatctattgcagcaaaggaagaaggtgtttctttggaaaaaa NEKDNYLKGVTKLFERIYSTDLGRMLL gacagtttgttaacaagcaattcaattacaaagatccagttaatggtgttg TSIVRGIPFWGGSTIDTELKVIDTNCINV acattgcttatattaaaattccaaacgttggtcagatgcagccagttaaa IQPDGSYRSEELNLVIIGPSADIIQFECKS gctttcaagatccataacaaaatttgggttatcccagagagagacactt FGHEVLNLTRNGYGSTQYIRFSPDFTEG tcactaatccagaggaaggtgatttgaacccaccaccagaagcaaaa FEESLEVDTNPLLGAGKFATDPAVTLA caggttccagttagttattatgacagtacttatctttccactgataacgag HELIHAGHRLYGIAINPNRVFKVNTNA aaagataactatttgaaaggtgttactaagctgtttgaaagaatttacag YYEMSGLEVSFEELRTFGGHDAKFIDS tactgacttgggaagaatgttgctgacttcaattgttagaggaattccat LQENEFRLYYYNKFKDIASTLNKAKSI tttggggtggatctactattgacactgaattgaaagttatcgatactaatt VGTTASLQYMKNVFKEKYLLSEDTSG gtattaacgttatccaaccagacggttcctacagatctgaggagcttaa KFSVDKLKFDKLYKMLTEIYTEDNFVK cttggttattattggtccatccgctgacattattcaatttgagtgtaagtc FFKVLNRKTYLNFDKAVFKINIVPKVN attcggacatgaggttttgaacctgactcgtaatggttatggttccactca YTIYDGFNLRNTNLAANFNGQNTEINN atatattagattttccccagattttacttttggtttcgaggaaagtttg MNFTKLKNFTGLFEFYKLLCVRGIITSK gaggttgatactaacccattgctgggtgcaggtaagtttgctactgatcca TKSLDKGYNKKETWWETWWTEW gcagttactcttgctcatgagctgatccatgcaggtcatagattgtatggt SQPKKKRKVENLYFQSNHHHHHH attgcaattaatccaaaccgtgtttttaaagttaatactaatgcttattat (SEQ ID NO: 44) gaaatgtcaggtttggaagtttctttcgaagagttgagaactttcggagg acatgatgctaagttcattgactctttgcaggaaaacgagttccgtctgt actactataacaagttcaaggacatcgcatctactttgaacaaggcaa agtcaattgttggtactactgcttcactgcaatatatgaagaacgttttca aggagaagtacttgttgtccgaggatactagtggtaaattctctgttga caaattgaagttcgacaaattgtacaaaatgctgactgagatctatact gaagacaacttcgttaagttttttaaagttctgaacagaaagacttatttg aactttgataaggctgtttttaagattaacattgttccaaaggttaactat actatttatgacggtttcaatctgagaaacactaatcttgcagctaatttc aatggtcagaatactgagattaataatatgaacttcactaagttgaaaaat tttactggtttgtttgaattttacaagttgttgtgtgttcgtggaattatt acttccaagactaaatctttggataagggttacaacaaaaaggaaacttgg tgggaaacttggtggactgaatggtctcaaccaaagaagaagagaa aggttgagaacctg tacttccaatccaatcatcaccatcaccatcacta a-3′ (SEQ ID NO: 45) SMF MRFPSIFTAVLFAASSALAAPVNTTTED 5′- ETAQIPAEAVIGYSDLEGDFDVAVLPFS atgagatttccatctatttttactgcagttttgtttgcagcatcttctgca NSTNNGLLFINTTIASIAAKEEGVSLEK ttggcagcaccagttaacactactactgaagatgaaactgcacaaattcc R (SEQ ID NO: 46) agcagaagcagttattggttactctgatttggaaggtgattttgatgttg ctgttttgccattttctaactctactaataacggtttgttgtttattaata ctactattgcatctattgcagcaaaggaagaaggtgttTctttggaaaaaa ga-3′ (SEQ ID NO: 47) TEV ENLYFQSN (SEQ ID NO: 48) 5′-gagaacctgtacttccaatccaat-3′ (SEQ ID NO: 49)
EXAMPLE 7. MASSIVE FERMENTATION AND PURIFICATION OF NON-TOXIC PROTEASE
[0154] It was attempted to ferment and purify large amounts of the recombinant E. coli strains constructed in Example 2. To this end, the stock solution of each recombinant strain was inoculated into LB medium supplemented with ampicillin and was cultured with shaking overnight at 37° C. and 200 rpm (seed culture). 3 to 4 L of LB medium supplemented with 50 μg/ml of ampicillin was placed in a 7-L jar fermenter, and 50 ppm of an Antifoam B emulsion was added thereto. Then, 30 mL of the strain cultured overnight was inoculated into the medium and fermented at 37° C. at an impeller speed of 250 rpm under an air pressure corresponding to 2 L/min of filtered air. When the strain reached an OD.sub.600 of 0.3, the internal temperature of the fermenter was lowered with a cooler of the fermenter and the strain was cultured. When the strain reached an OD.sub.600 of 0.6 to 0.7, 0.5 mM IPTG was added and the strain was cultured overnight (16 to 18 hours) at 18° C.
[0155] 200 ml of lysis buffer (50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 10% glycerol) was added to the cell pellet (about 5 g by wet weight) of 1L of the fermentation culture medium, and the cells were completely suspended. A buffer for cell disruption (1 mM PMSF, 1 mM β-ME (beta-mercaptoethanol), 0.1% Triton-X 100) was added to the cell suspension, and the cells were sonicated five times using a Sonics Vibra-cell sonicator for 4 min at pulse on/off of 4 sec/8 sec and at power of 65%. The cell lysate was divided into a supernatant and a cell lysate precipitate by centrifugation at 4° C. at 12,000 rpm for 30 minutes.
[0156] Meanwhile, a Ni-IDA column (Workbeads™ 40 Ni-IDA, 40-650-001, Bio-Works, Sweden) was packed and the column was equilibrated with a 10-fold volume of equilibration buffer (50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 10% glycerol, 0.1% TritonX-100, 1 mM PMSF, 1 mM β-ME). Ni-IDA resin was added to the centrifuged supernatant containing the soluble protein to induce a binding reaction with his-tag of the non-toxic protease at 4° C. for 2 hours, and was loaded into the column. The column was washed with a 20-fold volume of washing buffer A (50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 10% glycerol, 1 mM β-ME), and then washed with a 20-fold volume of washing buffer (50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 50 mM imidazole, 10% glycerol, 1 mM β-ME). The column was eluted stepwise with 1.5-fold volumes of elution buffers (100/200/300/500/700 mM imidazole, 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 10% glycerol, 1 mM β-ME). EDTA was added to each eluted fraction to a final concentration of 1 mM. The purity of each eluted fraction was analyzed by SDS-PAGE, and the high-purity eluted fractions obtained using the elution buffers containing 500 to 700 mM imidazole were combined, transferred to a dialysis membrane (molecular weight cut-off: 10-30 kDa), and dialyzed using PBS buffer to remove other chemical components, and the purified non-toxic protease was recovered. For cryopreservation, the non-toxic protease was dialyzed with PBS buffer containing 10% glycerol (
[0157] As a result, as shown in
[0158] This effect of increasing the efficiency of expression purification of the mutated non-toxic protease in and from the soluble protein was higher than that for the wild-type non-toxic protease, even when the BFGFRP domain of the fibroblastic growth factor was fused to the mutated non-toxic protease. Thus, it could be seen that, even when another peptide is fused to the non-toxic peptide to the mutated non-toxic protease, the efficiency of expression and efficiency of purification of the mutated non-toxic protease is maintained. Specifically, the fusion non-toxic protease obtained by substituting cysteine at position of the non-toxic protease with glycine and fusing BFGFRP to the non-toxic protease was recovered at a concentration of 15 to 80 mg/L.
EXAMPLE 8. EXAMINATION OF SINGLE DOSE TOXICITY OF NON-TOXIC PROTEASES
[0159] In order to confirm whether the toxicity of the non-toxic protease to be used in the present invention is reduced, the single dose toxicity thereof was evaluated in mice. An experiment was conducted using the wild-type non-toxic protease represented by SEQ ID NO: 1 of the present invention, and a “test for single dose administration of intraperitoneal administration of test substance in mice” was performed by the animal testing institution KPC (212-9, Opo-ro, Opo-eup, Gwangju-si, Gyeonggi-do, Korea).
[0160] As experimental animals, ICR mice were purchased from ORIENTBIO Inc. (Korea). The experiment was carried out using 35 6-week-old male mice, and animals that were not abnormal in appearance were brought into the breeding area and acclimatized in the animal room where the test was conducted, for 7 days. After 7 days of quarantine and acclimatization, healthy animals were selected by checking their health and suitability for testing. For drinking water, tap water was sterilized with a filter water sterilizer, irradiated with UV light, and freely fed using a drinking water bottle (250 mL) made of polycarbonate. The animals were allowed to freely access the rodent feed for laboratory animals provided by Cargill Agri Purina, Inc.
TABLE-US-00005 TABLE 5 Number Administration Test of route and Observation group Drug Dose (mg/kg) Volume animals frequency period G1 Vehicle n/a 0.25 mL G2 Test 1 μg/mouse 0.25 Ml Five mice Intraperitoneal 4 days after substance per group injection, administration G4 Test 10 μg/mouse 0.25 mL single substance G4 Test 40 μg/mouse 0.25 mL substance G5 Test 100 μg/mouse 0.25 mL substance G6 Test 110 μg/mouse 0.25 mL substance G7 Test 120 μg/mouse 0.25 mL substance
[0161] As shown in Table 5 above, as the test substance, the wild-type non-toxic protease from which the heavy chain has been removed was purified according to the present invention and intraperitoneally injected into ICR mice (average body weight 34 g, n=5 for each concentration) at a dose of 1 to 120 μg/mouse. As a result, as shown in Table 6, it was confirmed that all the mice survived. Here, the dose (120 μg/mouse) for test group G7 corresponds to about 3.6 mg/kg mouse body weight. It is known that the median lethal dose (LD50) of natural botulinum toxin type A is about 0.3 ng/kg in rodent mice, and about 1 ng/kg in humans, which corresponds to a lethal dose of 1 μg for a 70-kg adult (Annu. Rev. Microbiol. 1999. 53:551-75, Eric A. Johnson, CLOSTRIDIAL TOXINS AS THERAPEUTIC AGENTS: Benefits of Nature's Most Toxic Proteins). Therefore, it was confirmed that the toxicity of the wild-type non-toxic protease used in the present invention decreased by 1.2×10.sup.7 times compared to the reported median lethal dose (LD50) (0.3 ng/kg) of the natural botulinum toxin type A in mice, and that the mutated non-toxic protease of the present invention also had a significantly reduced median lethal dose (LD50) in mice, which is similar to that of the wild-type non-toxic protease.
TABLE-US-00006 TABLE 6 Summary: Incidence of mortality and daily observations Clinical Days Group Sex N Mortality observations 1 2 3 4 5 G1 Male 5 0% No clinical 5 5 5 5 5 (Vehicle) sign G2 Male 5 0% No clinical 5 5 5 5 5 (1 μg//mouse) sign G3 Male 5 0% No clinical 5 5 5 5 5 (10 μg/mouse) sign G4 Male 5 0% No clinical 5 5 5 5 5 (50 μg/mouse) sign G5 Male 5 0% No clinical 5 5 5 5 5 (100 μg/mouse) sign G6 Male 5 0% No clinical 5 5 5 5 5 (110 μg/mouse) sign G7 Male 5 0% No clinical 5 5 5 5 5 (120 μg/mouse) sign
[0162] Although the present invention has been described above with reference to the embodiments, it is to be understood that the present invention is not necessarily limited to the embodiments, and various modifications are possible without departing from the scope and spirit of the present invention. Accordingly, the scope of the present invention should be construed to include all embodiments falling within the scope of the claims appended hereto.
INDUSTRIAL APPLICABILITY
[0163] The present invention has advantages in that it is possible to inhibit aggregation into inclusion bodies, which generally occurs in the process of producing wild-type non-toxic protease using a recombinant microorganism, and thus it is possible to obtain active mutated non-toxic proteases from both a soluble fraction and an insoluble fraction, which are formed by disrupting the recombinant microorganism, even by a simple dialysis/refolding process alone, and accordingly, it is possible to produce non-toxic proteases in high yield.
SEQUENCE LIST FREE TEXT
[0164] An electronic file is attached.