POLYPEPTIDE DERIVATIVE AND PREPARATION METHOD THEREOF

20220211857 · 2022-07-07

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided are a polypeptide derivative and a preparation method thereof. Specifically, a polypeptide derivative is provided. Experimental results show that the polypeptide derivative has a significantly prolonged half-life while maintaining biological activity. The preparation method of the polypeptide derivative and its use in therapy are also disclosed.

    Claims

    1. A polypeptide derivative, which comprises: (a) a polypeptide; and (b) a modified group L linked to a lysine site of the polypeptide as shown in Formula I, ##STR00039## wherein a wavy line represents a link position with the lysine site, and m is an integer of 0-8; a, b, c, d, e and f are independent integers selected from 0 to 10; n is an integer from 14 to 16.

    2. The polypeptide derivative of claim 1, wherein the group L is selected from the group consisting of: ##STR00040##

    3. The polypeptide derivative of claim 1, wherein the polypeptide is selected from the group consisting of: an insulin, GLP-1, PTH, and combinations thereof.

    4. The polypeptide derivative of claim 1, wherein an A chain of the insulin has a sequence as shown in SEQ ID NO: 1 or 2; and/or a B chain of the insulin has a sequence as shown in SEQ ID NO: 3, 4, 5 or 6; and/or the GLP-1 has a sequence as shown in any one of SEQ ID NO: 7-9; and/or the PTH has a sequence as shown in SEQ ID NO: 10.

    5. A pharmaceutical composition which comprises the polypeptide derivative of claim 1, and a pharmaceutically acceptable carrier.

    6. Use of the polypeptide derivative of claim 1 for preparing drugs or preparations for preventing and/or treating osteoporosis, diabetes, hyperglycemia and other diseases which benefit from reducing blood glucose.

    7. A method for preparing a polypeptide derivative, which comprises the following steps: (1) cultivating a strain containing an insulin coding sequence in the presence of a group X-lysine, a pyrrolysyl-tRNA synthetase and a homologous associated tRNA thereof, wherein a lysine coding sequence of the polypeptide in the coding sequence is replaced with TAG (encoding a lysine derivative), thereby producing the polypeptide derivative which comprises: (a) a polypeptide chain; and (b) a modified group L linked to a lysine site of the polypeptide, and the modified group L is the group X as defined in claim 1; and optionally (2) separating the polypeptide derivative from fermentation products.

    8. A plasmid system comprising: (1) a first expression cassette containing a first coding sequence for encoding a target protein, wherein the first coding sequence contains a codon for introducing a predetermined modified amino acid, and the codon is UAG (amber), UAA (ochre), or UGA (opal); and (2) a second expression cassette containing a second nucleic acid sequence for encoding an aminoacyl-tRNA synthetase, wherein the aminoacyl-tRNA synthetase is a mutant protein of claim 1; wherein the system further includes a third expression cassette, which contains a third coding sequence for encoding an artificial tRNA which contains an anticodon corresponding to the codon; and the aminoacyl-tRNA synthetase specifically catalyzes the artificial tRNA to form an “artificial tRNA-Xa” complex, wherein Xa is a predetermined modified amino acid in aminoacyl form.

    9. A method for preparing a polypeptide derivative, which comprises the following steps: (1) cultivating a strain containing a polypeptide coding sequence in the presence of a compound of Formula III, a pyrrolysyl-tRNA synthetase and a homologous associated tRNA thereof, wherein a lysine coding sequence of the polypeptide in the coding sequence is replaced with TAG (encoding a lysine derivative), thereby producing a compound of Formula IV; and ##STR00041## (2) undertaking a reaction between the compound of Formula IV and a compound of Formula V in an inert solvent, thereby producing the polypeptide derivative, ##STR00042## wherein a, b, c, d, e and f are independent integers selected from 0 to 10; n is an integer from 14 to 16 in Formula V.

    10. An intermediate, which comprises: (a) a polypeptide, wherein the polypeptide is an insulin, GLP-1, or PTH; and (b) a modified group L linked to a lysine site of the polypeptide, and the modified group L is a group as shown in Formula A, ##STR00043## wherein a wavy line represents a link position with the lysine site, and m is an integer of 0-8.

    Description

    DETAILED DESCRIPTION

    [0093] After extensive and intensive research, the inventors have unexpectedly obtained a polypeptide derivative. Experimental results show that the polypeptide derivative has a significantly prolonged half-life while maintaining biological activity. The present invention further provides a pharmaceutical use of the polypeptide derivative and its functions of treating or preventing diabetes, promoting the osteogenesis of bone cells, and the like. On this basis, the inventors have completed the present invention.

    [0094] Ideal effects of long-acting insulins are achieved by rebuilding basic insulin secretion in diabetic patients via insulin injections as few as possible. Chemical modification is one of the ways of obtaining long-acting insulins. Structure of chemical modifiers must be stable, non-toxic, and non-antigenic and have a suitable molecular weight. Specific chemical modification of the present invention can prolong half-life of insulins and reduce their antigenicity while maintaining biological activity thereof. A modified insulin derivative of the present invention is a polymer compound with good biocompatibility which is non-toxic to human bodies, and water solubility of drugs has increased. It can also reduce its clearance rate in glomerular and increase half-life of drugs when circulating in vivo, thereby obtain a long-term effect. Insulins, GLP-1, and PTH proteins containing a butynyloxycarbonyl-lysine of the present invention are linked to fatty acid acyl compounds by a click reaction to obtain a series of GLP-1 derivatives and PTH derivatives which have significantly prolonged half-lives.

    Terms

    [0095] Before illustrating the present invention, it should be understood that the present invention is not limited to the specific methods and experimental conditions as described herein due to variability of the methods and conditions. It should also be understood that the terms used herein are only to illustrate specific embodiments, not to limit the scope of the present invention which is only limited by appended claims.

    [0096] As used herein, the term “about” may refer to a value varies from the recited value by no more than 1% when used for referring to a specifically recited value. For example, as used herein, the expression “about 100” includes all values between 99 and 101 (such as 99.1, 99.2, 99.3, 99.4, etc.).

    [0097] As used herein, the terms “contain” or “comprise (or include)” can be open, semi-closed, and closed. In other words, the terms also include “substantially consisting of” or “consisting of”.

    [0098] GLP-1

    [0099] GLP-1 is a glucose-dependent incretin polypeptide hormone which stimulates insulin secretion to avoid hypoglycemia. The characteristic of promoting insulin secretion which is glucose-dependent avoids risks of hypoglycemia that often exist in treatments of diabetes. With these physiological functions, the development of GLP-1 has broad prospects in being a treatment drug of type 2 diabetes thereof. GLP-1 usually functions on a GLP-1 receptor (i.e., GLP-1R) which is on a membrane of pancreatic islet β cells for promoting the secretion of insulin. However, although natural GLP-1 has many advantages in the treatment of diabetes, it is rapidly degraded in vivo by dipeptidyl peptidase-IV (i.e., DPP-IV), and it is rapidly filtered and metabolized by kidney. Thus, we need to modify the natural GLP-1 to screen out GLP-1 analogues which can resist DPP-IV degradation and can avoid rapid filtration and metabolism by kidney.

    [0100] GLP-1 has functions of glucose-dependent incretin secretion; preventing a degeneration of pancreatic β cells and stimulating β cells to proliferate and differentiate; inducing a transcription of pre-insulin genes and promoting pre-insulin biosynthesis; increasing insulin sensitivity; increase a secretion of somatostatin and inhibiting a production of insulin and glucagon (which is also glucose-dependent).

    [0101] Parathyroid Hormone (PTH)

    [0102] Parathyroid hormone (PTH) is a single-chain polypeptide protein containing 84 amino acids, which is secreted by parathyroid gland. It is one of the most important peptide hormones that regulate a metabolism of calcium and phosphorus and bone turnover. Main physiological functions of hPTH (i.e., human PTH) are promoting an osteogenesis of bone cells, stimulating a reabsorption of calcium and a secretion of phosphorus in kidney, and bone reconstruction. A main disadvantage of PTH is that hPTH molecule does not comprise cysteine and is very unstable in vivo. PTHI has a small molecular weight and is easily filtered by glomerulus, so its half-life in vivo is short. The half-life of subcutaneous administration or intramuscular injection is generally about 12 hours. In order to achieve therapeutic effects, it is generally necessary to take high-dose medications frequently (i.e., subcutaneous injection once a day for several months). However, a frequent drug administration and a long treatment period make it difficult to bear for patients, and can cause headaches, vomiting, fever and other adverse reactions clinically, thereby causing poor patient compliance. Therefore, there is an urgent need for long-acting preparations of PTH or the like, which can be modified by parathyroid hormones to extend their half-lives.

    [0103] Fatty Acid Acyl Compounds

    [0104] Polypeptides (such as insulins, GLP-1, and PTH) containing a butynyloxycarbonyl-lysine of the present invention are linked to fatty acid acyl compounds by a click reaction to obtain a series of polypeptide derivatives which have significantly prolonged half-lives.

    [0105] A fatty acid acyl compound of the present invention comprises 14-18 carbons, and its structure is shown in the following Formula V or Formula VIII:

    ##STR00026##

    [0106] wherein a, b, c, d, e and f are independent integers selected from 0 to 10; n is an integer from 14 to 16.

    [0107] In another preferred embodiment, the fatty acid acyl compound is selected from the group consisting of: L0-GFA, L2-GFA, L3-GFA, L4-GFA, L5-GFA, or L6-GFA.

    ##STR00027##

    [0108] In another preferred embodiment, the fatty acid acyl compound is selected from the group consisting of: L0-GFA16, L2-GFA16, L3-GFA16, L4-GFA16, L5-GFA16, or L6-GFA16.

    ##STR00028##

    [0109] Polypeptide Derivatives

    [0110] As used herein, terms “a polypeptide analog”, “a polypeptide derivative” and “a derivative of the present invention” are used interchangeably and all refer to the polypeptide derivative according to the first aspect of the present invention.

    [0111] In the present invention, it further provides a polypeptide derivative according to the first aspect of the present invention.

    [0112] Specifically, the polypeptide derivative comprise: [0113] (a) a polypeptide chain; and [0114] (b) a modified group L linked to a lysine site of the polypeptide, and the modified group L is the group X as shown in Formula I,

    ##STR00029##

    [0115] wherein a wavy line represents a link position with the lysine site, and m is an integer of 0-8; a, b, c, d, e and f are independent integers selected from 0 to 10; n is an integer from 14 to 16.

    [0116] In another preferred embodiment, the polypeptide derivative comprises an insulin derivative, a GLP-1 derivative, a PTH derivative, and combinations thereof.

    [0117] In another preferred embodiment, an A chain of the insulin has a sequence as shown in SEQ ID NO: 1 or 2.

    [0118] In another preferred embodiment, a B chain of the insulin has a sequence as shown in SEQ ID NO: 3, 4, 5 or 6.

    TABLE-US-00001 (SEQ ID NO: 1) GIVEQCCTSICSLYQLENYCN (SEQ ID NO: 2) GIVEQCCTSICSLYQLENYCG (SEQ ID NO: 3) FVNQHLCGSHLVEALYLVCGERGFFYTPKT (SEQ ID NO: 4) FVNQHLCGSHLVEALYLVCGERGFFYTPK (SEQ ID NO: 5) FVNQHLCGSHLVEALYLVCGERGFFYTKPT (SEQ ID NO: 6) FVNQHLCGSHLVEALYLVCGERGFFYTDKT

    [0119] In another preferred embodiment, the GLP-1 has the sequence as shown in any one of SEQ ID NO: 7-9.

    TABLE-US-00002 (SEQ ID NO: 7) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (SEQ ID NO: 8) HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (SEQ ID NO: 9) HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (wherein X is 2-aminoisobutyric acid (Aib))

    [0120] In another preferred embodiment, the PTH has the sequence as shown in SEQ ID NO: 10.

    TABLE-US-00003 (SEQ ID NO.: 10) SVSEIQLMHNLGRHLNSMERVEWLRKRLQDVHNF

    [0121] In the present invention, an insulin derivative comprises an insulin, an insulin precursor and a variant of insulin. The variant of insulin is different from any naturally-occurring insulin, but can still perform a function which is similar to a human insulin by blood glucose control in the human body. Through genetic engineering of an underlying DNA, an amino acid sequence of the insulin can be changed, thereby changing its absorption, distribution, metabolism and secretion properties. Improvements comprise insulin analogues which are more easily absorbed by an injection site, thus they function faster than subcutaneously injected natural insulins. They are intended to supply a drug level of insulins (i.e., prandial insulin) required for mealtimes, while those insulin analogs released slowly between 8 hours and 24 hours are intended to provide a basal level of insulins (i.e., basal insulin) during the day, especially at night. Quick-acting insulin analogues comprise insulin lispro (Eli Lilly and Company) and insulin aspart (Novo Nordisk Company), while long-acting insulin analogues comprise NPH insulin, insulin glulisine (Sanofi Aventis Company), insulin detemir (Novo Nordisk Company) and insulin glargine (Sanofi Aventis Company).

    [0122] As used herein, the term “variant” comprise any variant in which (a) one or more amino acid residues are replaced by a natural or unnatural amino acid residue; (b) the order of two or more amino acid residues is reversed; (c) (a) and (b) exist simultaneously; (d) a spacer group is between any two amino acid residues; (e) one or more amino acid residues are in peptoid form; (f) (NCC) main chain in one or more amino acid residues of the peptide is modified, or any combination of (a) to (f). Preferably, the variant is one of (a), (b) or (c).

    [0123] More preferably, one or two amino acid residues are replaced by one or more other amino acid residues. And more preferably, one amino acid residue is replaced by another amino acid residue. Preferably, the substitution is homologous.

    [0124] Homologous substitutions may occur (terms “substitution” and “replacement” used herein refer to the exchange of existing amino acid residues with optional residues), that is, homogeneous substitutions, such as substitutions between basic residues and basic residues, substitutions between acidic residues and acidic residues, substitutions between polar residues and polar residues, etc. Non-homologous substitutions may also occur, that is, one kind of residue is replaced by another kind, or substitutions alternatively comprise unnatural amino acids such as ornithine, 2-aminobutyric acid-ornithine, norleucine-ornithine, pyridyl-alanine, thienyl-alanine, naphthyl-alanine and phenyl-glycine. More details are listed in the following table. More than one amino acid residue can be modified at the same time. As used herein, amino acids are classified according to the following categories: basic: H, K, R; acidic: D, E; non-polar: A, F, G, I, L, M, P, V, W; polar: C, N, Q, S, T, Y.

    [0125] In addition to amino acid spacer groups (such as glycine or a β-alanine residue), suitable spacer groups which can be inserted between any two amino acid residues in a carrier comprise: alkyl groups such as methyl, ethyl, or propyl. Another variant form, that is, type (e) which comprises one or more amino acid residues in peptoid form can be understood by those skilled in the art. To avoid any doubt, “peptoid form” is used herein indicating that an α-C substituent is located on an N atom of the residue rather than on the variant amino acid residues of α-C. The preparation of peptides in peptoid form is known in the art, for example, Simon R J et al., PNAS (1992) 89(20), 9367-9371 and Horwell D C, Trends Biotechnol. (1995) 13(4), 132-134. The type (f) modification can be performed by a method described in International Publication PCT/GB99/01855. Amino acid variants (preferably of type (a) or (b)) preferably occur independently at any position. As mentioned above, more than one homologous or non-homologous replacement may occur at the same time. Other variants can be obtained by reversing the sequence of some amino acid residues within the sequence. In one embodiment, the replacement amino acid residue is selected from alanine, arginine, asparagine, aspartic acid, cysteine, glutamate, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine and valine.

    [0126] Polypeptide derivatives of the present invention may exist in the form of salts or esters thereof, especially pharmaceutically acceptable salts or esters.

    [0127] Pharmaceutically acceptable salts of the compounds of the present invention comprise suitable acid addition salts or basic salts thereof. Suitable pharmaceutically acceptable salts can be found in the review by Berge et al. J Pharm Sci, 66, 1-19 (1977). They can be combined with strong inorganic acids, e.g. mineral acids (such as sulfuric acids, phosphoric acids or hydrohalic acids); with strong organic carboxylic acids, such as unsubstituted or substituted (e.g. substituted by halogen) alkyl carboxylic acids (e.g. acetic acids) with 1 to 4 carbon atoms; with saturated or unsaturated dicarboxylic acids, such as oxalic acids, malonic acids, succinic acids, maleic acids, fumaric acids, phthalic acids or terephthalic acids; with hydroxycarboxylic acids, such as ascorbic acids, glycolic acids, lactic acids, malic acids, tartaric acids or citric acids; with amino acids, such as aspartic acids or glutamates; with benzoic acids; or with organic sulfonic acids, such as unsubstituted or substituted (e.g. substituted by halogen) (C1-C4)-alkyl- or aryl-sulfonic acids (e.g. methanesulfonic acid or p-toluenesulfonic acid) to form salts.

    [0128] The present invention further comprises solvate forms of the derivatives of the present invention. The terms used in claims comprise these forms. The present invention further relates to various crystal forms, polymorphs and (anhydrous) hydrated forms of the analogs of the present invention. Pharmaceutical industry has established a way that chemical compounds can be separated in any of such forms via slightly changing a purification method and/or separation method of a solvent used in a synthetic preparation of the compound.

    [0129] The present invention further comprises prodrug forms of the derivatives of the invention. Such prodrugs are generally the derivatives of the invention, in which one or more suitable groups are modified so that the modification can be reversed when prodrugs are administered in a human or mammalian subject. Although a second agent may also be administered together with such prodrugs to complete the reversal in vivo, such reversal is usually performed by enzymes which are naturally present in the subject. Examples of such modifications comprise esters (such as any of those described above), wherein the reversal can be performed by an esterase. Other systems are known to those skilled in the art.

    [0130] Compared with the prior art, the present invention mainly has the following advantages:

    [0131] (1) Compared with the prior art, insulin derivatives and GLP-1 derivatives of the present invention have a longer-lasting, stable and long-term blood glucose lowering effect, and their half-lives are significantly prolonged.

    [0132] (2) The insulin derivatives and GLP-1 derivatives of the present invention will not cause hypoglycemia, and can reduce injection times with slight side effects.

    [0133] (3) Compared with the prior art, PTH derivatives of the present invention have a longer-lasting and stable drug effect, and its half-life is significantly prolonged.

    [0134] (4) The PTH derivatives of the present invention can reduce injection times with slight side effects.

    [0135] (5) A preparation method of the present invention which has few by-products, high yield, low cost, and simple process is suitable for large-scale production. There is no need for cyanogen bromide cleavage, oxidative sulfite hydrolysis and related purification steps, and no need to use high concentrations of mercaptans or hydrophobic adsorption resins. The method has few purification steps and low production cost.

    [0136] The present invention will be further illustrated below with reference to the specific examples. It should be understood that these examples are only to illustrate the invention, not to limit the scope of the invention. The experimental methods with no specific conditions described in the following examples are generally performed under the conventional conditions (e.g., the conditions described by Sambrook et al., Molecular Cloning: Laboratory Guide (New York: Cold Spring Harbor Laboratory Press, 1989), or according to the manufacturer's instructions. Unless indicated otherwise, all percentage and parts are calculated by weight. Unless otherwise stated, the experimental materials and reagents used in the following examples are commercially available.

    Example 1 Synthesis of Recombinant Insulin Proteins Containing a Butynyloxycarbonyl-Lysine

    [0137] A DNA fragment encoding a recombinant insulin protein which contained a butynyloxycarbonyl-lysine which contained an amino acid sequence as shown in SEQ ID NO: 11 was chemically synthesized, wherein the coding sequence of 80th lysine (K) was replaced by TAG (which encoded a lysine derivative). Then the DNA fragment which encoded the complete amino acid sequence as shown in SEQ ID NO: 11 was cloned into a modified pBAD-HisA vector. The obtained plasmid was used for the expression of the recombinant insulin protein, which contained the structure of a butynyloxycarbonyl-lysine. The plasmid and an enzyme plasmid pEvol-pylRs-pylT were transformed into E. coli Top10 strain together. The transformant solution was cultured on LB agar medium containing 25 μg/mL kanamycin and 17 μg/mL chloramphenicol at 37° C. overnight. A single colony was picked and cultured in an LB liquid medium containing 25 μg/mL kanamycin and 17 μg/mL chloramphenicol on a constant temperature shaker at 37° C. at 220 rpm overnight. Then, the overnight culture was inoculated into 100 mL TB liquid medium containing 25 μg/mL kanamycin and 17 μg/mL chloramphenicol, and cultured at 37° C. until OD.sub.600 reached 2-4. 25% arabinose solution was added to the medium at a final concentration of 0.25%, and 0.1 M butynyloxycarbonyl-lysine solution was added at a final concentration of 5 mM to induce the expression of a fusion protein. The culture solution was cultured for 16-20 hours, and then collected by centrifugation (10000 rpm, 5 min, 4° C.).

    [0138] The amino acid sequence of SEQ ID NO: 11:

    [0139] MVSKGEELFTGVTYKTRAEVKFEGDDDDDKTLVNRIELKGIDFENLYFQGRFV NQHLCGSHLVEALYLVCGERGFFYTPKTRGIVEQCCTSICSLYQLENYCN, wherein the 80th K was a lysine to which a butynyloxycarbonyl group was covalently attached.

    [0140] The fusion proteins were expressed in the form of insoluble “inclusion bodies”. In order to release the inclusion bodies, the E. coli cells were disrupted with a high-pressure homogenizer. Cell debris and soluble E. coli host proteins were removed by centrifugation at 5000 g. The inclusion bodies were washed with a solution containing Tween 80, EDTA, and NaCl, and then washed with pure water 1-2 times. The washed inclusion bodies were dissolved in 7.5M urea, which contained 2-10 mM β-mercaptoethanol with a pH of 10.5-11.5, so that the concentration of a total protein after a dissolution reached 10-25 mg/mL. The sample was diluted 5-10 times, maintained between 4-8° C., and routinely folded for 14-30 hours under the pH condition of 10.5-11.7. An enzyme digestion was performed with trypsin and carboxypeptidase B for 10-20 hours at 18-25° C., and the pH value was maintained between 8.0-9.5. Then 0.45M ammonium sulfate was added to terminate the enzyme digestion. Reversed-phase HPLC analysis results showed that a yield of the enzyme digestion step was higher than 90%. An insulin analog obtained after the enzyme digestion with trypsin and carboxypeptidase B was named butynyloxycarbonyl-lysine-human insulin. The sample was clarified by membrane filtration. After initial purification by hydrophobic chromatography with 0.45M ammonium sulfate as buffer A and pure water as buffer B, a crude extract of butynyloxycarbonyl-lysine-human insulin was obtained with a purity of 90% confirmed by electrophoresis. After a purification by reverse-phase polymer packings and reverse-phase C8 packings, butynyloxycarbonyl-lysine-human insulin with a purity higher than 99% was finally obtained.

    ##STR00030##

    Example 2 Synthesis of L0-GFA16-Insulins (n is 14)

    [0141] Since a fatty acid acyl compound had an azide group, an insulin protein with a terminal alkyne was introduced using the principle of “click chemistry”, and the alkyne reacted with the azide to generate a 1,2,3-triazole ring, forming a cross-link. 4 μL of copper sulfate (50 μM) was added to a clean 1.5 mL centrifuge tube, then 3 μL of BTTAA (300 μM) was added and 10 μL of a compound IV (N-(butynyloxycarbonyl)-lysine-human insulin protein) (approximately 5 μM) which was prepared in Example 1 was added in order. At this time, the solution could be diluted to an appropriate volume or protein concentration. To this solution, 1 μL of L0-GFA16 (1 mM) was added, and 2 μL of sodium ascorbate (2.5 mM) was added to initiate the reaction. After about 1 hour at room temperature, 5 μL of SDS-PAGE sample buffer was added and heated to 100° C. for 10 minutes. An analysis of the solution was completed by 12% SDS-PAGE. A gel was recovered, then analyzed by gel imaging and fluorescence analysis, and then stained with Coomassie brilliant blue.

    ##STR00031##

    Example 3 Synthesis of L2-GFA16-Insulins, L3-GFA16-Insulins, L4-GFA16-Insulins, L5-GFA16-Insulins and L6-GFA16-Insulins (n is 14)

    [0142] 4 μL of copper sulfate (50 μM) was added to a clean 1.5 mL centrifuge tube, then 3 μL of BTTAA (300 μM) was added and 10 μL of a compound IV (N-(butynyloxycarbonyl)-lysine-human insulin protein) (approximately 5 μM) which was prepared in Example 1 was added in order. At this time, it may be necessary to add water to dilute the solution to a proper volume or protein concentration. To this solution, 1 μL of L2-GFA16 (1 mM) was added, and 2 μL of sodium ascorbate (2.5 mM) was added to initiate the reaction. After about 1 hour at room temperature, 5 μL of SDS-PAGE sample buffer was added and heated to 100° C. for 10 minutes. An analysis of the solution was completed by 12% SDS-PAGE. A gel was recovered, then analyzed by gel imaging and fluorescence analysis, and then stained with Coomassie brilliant blue.

    ##STR00032##

    [0143] Similarly, the compound IV prepared in Example 1 and L3-GFA16, L4-GFA16, L5-GFA16, and L6-GFA16 were respectively used to complete a click reaction to obtain the following products, and their structures were shown below.

    ##STR00033##

    Example 4 Pharmacokinetics Studies of Insulin Derivatives of the Present Invention in Rats

    [0144] The experiment comprised a reference substance group and a test substance group. Recombinant human insulins and L6-GFA16-insulins were injected subcutaneously with a single administration of 0.45 mg/kg, respectively. Animals in each group were collected blood at 15 min, 30 min, 1 h, 2 h, 3 h, 5 h, 7 h, 12 h, and 24 h after administration. LC-MS/MS analysis method was used to detect contents of different insulin analogues. A metabolic kinetic data analysis software WinNonlin 7.0 was used to compile statistics of plasma concentration data, and a non-compartmental model method (NCA) was used to calculate pharmacokinetic parameters (Table 1). Results in Table 1 indicated that peak times of drugs in each group of animals were similar, i.e., 0.5-1 hour. Half-lives of L6-GFA16-insulins were 3-4 times that of recombinant human insulins. Exposure time of the drugs in vivo was prolonged and exposure doses were increased.

    TABLE-US-00004 TABLE 1 Main pharmacokinetic parameters in each group of animals Rat Dose(mg/ Cmax(ng/ AUC0-t(ng .Math. AUC0-∞(ng .Math. t1/2 Cl(mL/ Group number kg) Kel(1/h) Tmax(h) mL) h/mL) h/mL) (h) V(mL/kg) h/kg) Reference 1 0.45 1.47 0.5 234 303 307 0.471 995 1465 substance 2 0.45 1.46 1 293 498 509 0.475 606 885 3 0.45 1.23 1 201 359 373 0.564 980 1205 Test 4 0.45 0.38 1 178 778 788 1.81 149 571 substance 1 5 0.45 20.409 0.5 171 677 683 1.69 51611 659 6 0.45 0.454 1 192 826 831 1.53 1192 541

    [0145] Experiments above were repeated in the same way, except that L0-GFA16-insulins, L2-GFA16-insulins, L3-GFA16-insulins, L4-GFA16-insulins, and L5-GFA16-insulins of the present invention were used. Results showed that half-lives of the insulin derivatives of the present invention were significantly prolonged while maintaining biological activity.

    [0146] Example 5 Synthesis of GLP-1 proteins containing a butynyloxycarbonyl-lysine A DNA fragment encoding a GLP-1 protein, which contained a butynyloxycarbonyl-lysine which contained an amino acid sequence as shown in SEQ ID NO: 12 was chemically synthesized, wherein the coding sequence of 70th lysine (K) was replaced by TAG (which encoded a lysine derivative). Then the DNA fragment which encoded the complete amino acid sequence as shown in SEQ ID NO: 12 was cloned into a modified pBAD-HisA vector. The obtained plasmid was used for the expression of the recombinant GLP-1 protein, which contained the structure of a butynyloxycarbonyl-lysine. The plasmid and an enzyme plasmid pEvol-pylRs-pylT were transformed into E. coli Top10 strain together. The transformant solution was cultured on LB agar medium containing 25 μg/mL kanamycin and 17 μg/mL chloramphenicol at 37° C. overnight. A single colony was picked and cultured in an LB liquid medium containing 25 μg/mL kanamycin and 17 μg/mL chloramphenicol on a constant temperature shaker at 37° C. at 220 rpm overnight. Then, the overnight culture was inoculated into 100 mL TB liquid medium containing 25 μg/mL kanamycin and 17 μg/mL chloramphenicol, and cultured at 37° C. until OD600 reached 2-4. 25% arabinose solution was added to the medium at a final concentration of 0.25%, and 0.1 M butynyloxycarbonyl-lysine solution was added at a final concentration of 5 mM to induce the expression of a fusion protein. The culture solution was cultured for 16-20 hours, and then collected by centrifugation (10000 rpm, 5 min, 4° C.).

    [0147] The amino acid sequence of SEQ ID NO: 12:

    [0148] MVSKGEELFTGVTYKTRAEVKFEGDTLVNRIELKGIDFENLYFQGDDDDKHAE GTFTSDVSSYLEGQAAKEFIAWLVKGRG, wherein the 70th K was a lysine to which a butynyloxycarbonyl group was covalently attached.

    [0149] The fusion proteins were expressed in the form of insoluble “inclusion bodies”. In order to release the inclusion bodies, the E. coli cells were disrupted with a high-pressure homogenizer. Cell debris and soluble E. coli host proteins were removed by centrifugation at 5000 g. The inclusion bodies were washed with a solution containing Tween 80, EDTA, and NaCl, and then washed with pure water 1-2 times. The washed inclusion bodies were dissolved in 7.5M urea, which contained 2-10 mM β-mercaptoethanol with a pH of 10.5-11.5, so that the concentration of a total protein after a dissolution reached 10-25 mg/mL. The sample was diluted 5-10 times, maintained between 4-8° C., and routinely folded for 14-30 hours under the pH condition of 10.5-11.7. After a clarification of a refolding solution, the fusion protein was separated and purified with weak anion packings under the pH condition of 9.0, and a purity of a target protein reached 80% confirmed by electrophoresis. The sample was eluted with high salt. After desalting, an enzyme digestion was performed with enterokinase for 10-20 hours at 25° C., and the pH value was maintained between 8.0-9.0. Reversed-phase HPLC analysis results showed that a yield of the enzyme digestion step was higher than 90%. A GLP-1 analog obtained after the enzyme digestion with enterokinase was named butynyloxycarbonyl-lysine-GLP-1. After the enzyme digestion, it was purified by hydrophobic packings to extract butynyloxycarbonyl-lysine-GLP-1, and the purity thereof confirmed by electrophoresis reached 90%.

    ##STR00034##

    Example 6 Synthesis of L0-GFA16-GLP-1 (n is 14)

    [0150] Since a fatty acid acyl compound had an azide group, a GLP-1 protein with a terminal alkyne was introduced using the principle of “click chemistry”, and the alkyne reacted with the azide to generate a 1,2,3-triazole ring, forming a cross-link. 4 μL of copper sulfate (50 μM) was added to a clean 1.5 mL centrifuge tube, then 3 μL of BTTAA (300 μM) was added and 10 μL of a compound IV (N-(butynyloxycarbonyl)-lysine-GLP-1 protein) (approximately 5 μM) which was prepared in Example 5 was added in order. At this time, the solution could be diluted to an appropriate volume or protein concentration. To this solution, 1 μL of L0-GFA16 (1 mM) was added, and 2 μL of sodium ascorbate (2.5 mM) was added to initiate the reaction. After about 1 hour at room temperature, 5 μL of SDS-PAGE sample buffer was added and heated to 100° C. for 10 minutes. An analysis of the solution was completed by 12% SDS-PAGE. A gel was recovered, then analyzed by gel imaging and fluorescence analysis, and then stained with Coomassie brilliant blue.

    ##STR00035##

    Example 7 Synthesis of L2-GFA16-GLP-1, L3-GFA16-GLP-1, L4-GFA16-GLP-1, L5-GFA16-GLP-1 and L6-GFA16-GLP-1 (n is 14)

    [0151] 4 μL of copper sulfate (50 μM) was added to a clean 1.5 mL centrifuge tube, then 3 μL of BTTAA (300 μM) was added and 10 μL of a compound IV (N-(butynyloxycarbonyl)-lysine-GLP-1 protein) (approximately 5 μM) which was prepared in Example 5 was added in order. At this time, it may be necessary to add water to dilute the solution to a proper volume or protein concentration. To this solution, 1 μL of L2-GFA16 (1 mM) was added, and 2 μL of sodium ascorbate (2.5 mM) was added to initiate the reaction. After about 1 hour at room temperature, 5 μL of SDS-PAGE sample buffer was added and heated to 100° C. for 10 minutes. An analysis of the solution was completed by 12% SDS-PAGE. A gel was recovered, then analyzed by gel imaging and fluorescence analysis, and then stained with Coomassie brilliant blue.

    ##STR00036##

    [0152] Similarly, the compound IV prepared in Example 5 and L3-GFA16, L4-GFA16, L5-GFA16, and L6-GFA16 were respectively used to complete a click reaction to obtain the following products, and their structures were shown below.

    ##STR00037##

    Example 8 Pharmacokinetics Studies of GLP-1 Derivatives of the Present Invention in Rats

    [0153] The experiment comprised a reference substance group and a test substance group. GLP-1 and L6-GFA16-GLP-1 were injected subcutaneously with a single administration of 0.5 mg/kg, respectively. Animals in each group were collected blood at 15 min, 30 min, 1 h, 2 h, 3 h, 5 h, 7 h, 12 h, and 24 h after administration. LC-MS/MS analysis method was used to detect contents of different GLP-1 analogues. A metabolic kinetic data analysis software WinNonlin 7.0 was used to compile statistics of plasma concentration data, and a non-compartmental model method (NCA) was used to calculate pharmacokinetic parameters (Table 2).

    [0154] Results in Table 2 indicated that peak times of drugs in each group of animals were similar, i.e., 4.8 min. Exposure time of L6-GFA16-GLP-1 in vivo was prolonged and exposure doses were increased significantly.

    TABLE-US-00005 TABLE 2 Main pharmacokinetic parameters in each group of animals AUC0- AUC0- Num- Cmax(pg/ t(h*pg/ ∞(h*pg/ ber Group t1/2(h) (Tmax(h) mL) mL) mL) 1 Reference — 0.083333 445 63 — substance 2 Reference — 0.083333 355 51 — substance 3 Reference — 0.083333 300 47 — substance 4 Test 28.50 0.083333 430 1128 11613 substance 5 Test 21.40 0.083333 375 906 7079 substance 6 Test 7.89 0.083333 290 787 2835 substance

    [0155] Experiments above were repeated in the same way, except that L0-GFA16-GLP-1, L2-GFA16-GLP-1, L3-GFA16-GLP-1, L4-GFA16-GLP-1, and L5-GFA16-GLP-1 of the present invention were used. Results showed that half-lives of the GLP-1 derivatives of the present invention were significantly prolonged while maintaining biological activity.

    Example 9 Synthesis of PTH Proteins Containing a Butynyloxycarbonyl-Lysine

    [0156] A DNA fragment encoding a PTH protein, which contained a butynyloxycarbonyl-lysine which contained an amino acid sequence as shown in SEQ ID NO: 13 was chemically synthesized, wherein the coding sequence of 76th lysine (K) was replaced by TAG (which encoded a lysine derivative). Then the DNA fragment which encoded the complete amino acid sequence as shown in SEQ ID NO: 13 was cloned into a modified pBAD-HisA vector. The obtained plasmid was used for the expression of the recombinant PTH protein, which contained the structure of a butynyloxycarbonyl-lysine. The plasmid and an enzyme plasmid pEvol-pylRs-pylT were transformed into E. coli Top10 strain together. The transformant solution was cultured on LB agar medium containing 25 μg/mL kanamycin and 17 μg/mL chloramphenicol at 37° C. overnight. A single colony was picked and cultured in an LB liquid medium containing 25 μg/mL kanamycin and 17 μg/mL chloramphenicol on a constant temperature shaker at 37° C. at 220 rpm overnight. Then, the overnight culture was inoculated into 100 mL TB liquid medium containing 25 μg/mL kanamycin and 17 μg/mL chloramphenicol, and cultured at 37° C. until OD600 reached 2-4. 25% arabinose solution was added to the medium at a final concentration of 0.25%, and 0.1 M butynyloxycarbonyl-lysine solution was added at a final concentration of 5 mM to induce the expression of a fusion protein. The culture solution was cultured for 16-20 hours, and then collected by centrifugation (10000 rpm, 5 min, 4° C.).

    [0157] The amino acid sequence of SEQ ID NO: 13:

    [0158] MVSKGEELFTGVTYKTRAEVKFEGDTLVNRIELKGIDFENLYFQGDDDDKSVSE IQLMHNLGRHLNSMERVEWLRKRLQDVHNF, wherein the 76th K was a lysine to which a butynyloxycarbonyl group was covalently attached.

    [0159] The fusion proteins were expressed in the form of insoluble “inclusion bodies”. In order to release the inclusion bodies, the E. coli cells were disrupted with a high-pressure homogenizer. Cell debris and soluble E. coli host proteins were removed by centrifugation at 5000 g. The inclusion bodies were washed with a solution containing Tween 80, EDTA, and NaCl, and then washed with pure water 1-2 times. The washed inclusion bodies were dissolved in 7.5M urea, which contained 2-10 mM β-mercaptoethanol with a pH of 10.5-11.5, so that the concentration of a total protein after a dissolution reached 10-25 mg/mL. The sample was diluted 5-10 times, maintained between 4-8° C., and routinely folded for 14-30 hours under the pH condition of 10.5-11.7. After a clarification of a refolding solution, the fusion protein was separated and purified with weak anion packings under the pH condition of 9.0, and a purity of a target protein reached 80% confirmed by electrophoresis. The sample was eluted with high salt. After desalting, an enzyme digestion was performed with enterokinase for 10-20 hours at 25° C., and the pH value was maintained between 8.0-9.0. Reversed-phase HPLC analysis results showed that a yield of the enzyme digestion step was higher than 90%. A PTH analog obtained after the enzyme digestion with enterokinase was named butynyloxycarbonyl-lysine-PTH. After the enzyme digestion, it was purified by hydrophobic packings to extract butynyloxycarbonyl-lysine-PTH, and the purity thereof confirmed by electrophoresis reached 90%.

    ##STR00038##

    [0160] Methods were the same as in Examples 6 and 7. The PTH proteins containing N-(butynyloxycarbonyl)-lysine were substituted for the GLP-1 proteins containing N-(butynyloxycarbonyl)-lysine to synthesize L0-GFA16-PTH, L2-GFA16-PTH, L3-GFA16-PTH, L4-GFA16-PTH, L5-GFA16-PTH and L6-GFA16-PTH.

    Example 10 Pharmacokinetics Studies of PTH-1 Derivatives of the Present Invention in Rats

    [0161] The experiment comprised a reference substance group and a test substance group. PTH-1 and L6-GFA16-PTH-1 were injected subcutaneously with a single administration of 8.6 μg/kg, respectively. Animals in each group were collected blood at 0 min, 5 min, 15 min, 30 min, 1 h, 2 h, and 4 h after administration. LC-MS/MS analysis method was used to detect contents of different PTH-1 analogues. A metabolic kinetic data analysis software WinNonlin 7.0 was used to compile statistics of plasma concentration data, and a non-compartmental model method (NCA) was used to calculate pharmacokinetic parameters (Table 3). Results in Table 3 indicated that peak times of L6-GFA16-PTH in each group of animals were extended to about 1.6 h. Exposure time of drugs in vivo was prolonged and exposure doses were increased.

    TABLE-US-00006 TABLE 3 Main pharmacokinetic parameters in each group of animals AUC0- AUC0- Num- Cmax(pg/ t(h*pg/ ∞(h*pg/ ber Group t1/2(h) Tmax(h) mL) mL) mL) 1 Reference 0.30 0.083333 468 248 251 substance 2 Reference 0.32 0.083333 429 219 223 substance 3 Reference 0.35 0.083333 374 201 207 substance 4 Test 1.15 0.083333 463 641 719 substance 5 Test 1.60 0.083333 389 597 724 substance 6 Test 2.23 0.083333 331 584 803 substance

    [0162] Experiments above were repeated in the same way, except that L0-GFA16-PTH, L2-GFA16-PTH, L3-GFA16-PTH, L4-GFA16-PTH, and L5-GFA16-PTH of the present invention were used. Results showed that half-lives of the PTH derivatives of the present invention were significantly prolonged while maintaining biological activity.

    [0163] All documents mentioned in the present invention are incorporated by reference herein as if each document were incorporated separately by reference. Furthermore, it should be understood that after reading the foregoing teachings of the invention, various changes or modifications may be made to the invention by those skilled in the art and that these equivalents also fall in the scope of the claims appended to this application.