COMBINATION OF A GLYCOSYLATION INHIBITOR WITH ONE CAR CELL THERAPY FOR TREATING CANCER

20210290646 · 2021-09-23

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to at least one glycosylation inhibitor for use in combination with CAR cell therapy. Preferably, the glycosylation inhibitor improves the therapeutic potential of the CAR cell therapy. The invention also relates to a pharmaceutical composition and to population or subpopulation of CAR cell that has been contacted with at least one glycosylation inhibitor.

Claims

1. A method for the treatment and/or prevention of cancer, comprising administering a glycosylation inhibitor and a CAR cell therapy to a patient in need thereof.

2. The method according to claim 1 wherein said at least ono glycosylation inhibitor improves the therapeutic potential of said CAR cell therapy and/or improves CAR cell activation and/or increases antigen engagement and/or sensitizes tumour cells to recognition by the CAR cell therapy and/or increases elimination of tumour cells.

3. A method for increasing tumour cell killing, comprising exposing a tumour cell to a CAR cell therapy and a glycosylation inhibitor.

4. The method according to claim 1 wherein the CAR cell therapy is a CAR-T cell therapy or a CAR-NK cell therapy, and the T cell is optionally an autologous or allogeneic T cell.

5. The method according to claim 1 wherein said glycosylation inhibitor is selected from the group consisting of: a O-glycosylation inhibitor, a N-glycosylation inhibitor, a P-glycosylation inhibitor, a C-glycosylation inhibitor, a S-glycosylation inhibitor or a combination thereof.

6. The method according to claim 1 wherein said glycosylation inhibitor is selected from the group consisting of: a mannose analog, 2-deoxyglucose, 3-deoxy-3-fluoroglucosamine, 4-deoxy-4-fluoroglucosamine, 2-deoxy-2-fluoro-glucose, 2-deoxy-2-fluoro-mannose, 6-deoxy-6-fluoro-N-acetylglucosamine, 2-deoxy-2-fluorofucose, and 3-fluoro sialic acid tunicamycin, castanospermine, australine, deoxynojirimycin, swainsonine, deoxymannojirimycin, kifunensin, mannostatin, neuraminidase inhibitors, inhibitors of glycosyltransferases.

7. The method according to claim 1 further comprising a therapeutic agent, wherein said therapeutic agent is optionally an antibody, or a checkpoint inhibitor antibody.

8. The method according to claim 1 wherein the glycosylation inhibitor is 2-deoxyglucose.

9. The method according to claim 1 wherein the cancer is a solid or haematopoietic or lymphoid tumor.

10. The method according to claim 9, wherein the solid tumor is selected from the group consisting of: colon cancer, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell carcinoma of the lung, cancer of the small intestine, cancer of the esophagus, melanoma, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, non-Hodgkin's lymphoma, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, solid tumors of childhood, cancer of the bladder, cancer of the kidney or ureter, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumor angio genesis, spinal axis tumor, brain stem glioma, pituitary adenoma, Kaposi's sarcoma, epidermoid cancer, squamous cell cancer, environmentally induced cancers, combinations of said cancers, and metastatic lesions of said cancers.

11. The method according to claim 9, wherein the haematopoietic or lymphoid tumor is selected from the group consisting of: chronic lymphocytic leukemia (CLL), acute leukemias, acute lymphoid leukemia (ALL), B-cell acute lymphoid leukemia (B-ALL), T-cell acute lymphoid leukemia (T-ALL), chronic myelogenous leukemia (CML), B cell prolymphocytic leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt's lymphoma, diffuse large B cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell- or a large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma, marginal zone lymphoma, multiple myeloma, myelodysplasia and myelodysplastic syndrome, non-Hodgkin's lymphoma, Hodgkin's lymphoma, plasmablastic lymphoma, plasmacytoid dendritic cell neoplasm, Waldenstrom macroglobulinemia, or preleukemia, combinations of said cancers, and metastatic lesions of said cancers.

12. The method according to claim 1 wherein the glycosylation inhibitor is administered prior to the CAR cell therapy.

13. The method according to claim 1 wherein the glycosylation inhibitor is administered concomitantly to the CAR-T cell therapy.

14. (canceled)

15. (canceled)

16. An isolated population or subpopulation of CAR cells or an isolated CAR cell that is contacted with at least one glycosylation inhibitor.

17. The isolated population or subpopulation of CAR cells or the isolated CAR cell of claim 16, wherein the isolated population or subpopulation of CAR cells or the isolated CAR cell are CAR-T cells or an isolated CAR-T cell.

Description

[0208] The present invention will be illustrated by means of non-limiting examples in reference to the following figures.

[0209] FIG. 1: O-glycosylation on tumour cells impairs recognition by CD44v6 CAR-T cells. a, DNA sequencing of Cosmc amplicons from the mutated Jurkat samples compared to K562 controls. b, Left: schematic representation of the generated Jurkat model cell lines. c, CD44v6 CAR-T cells (44v6.28z) or control CD19 CAR-T cells (19.28z) were cultured with glycosylation competent (44v6+/Cosmc+) or incompetent (44v6+/Cosmc−) Jurkat cells at 1:5, 1:10, 1:25 effector to target ratios (E:T). After 4 days, target cell killing was analysed by FACS and expressed as elimination index [1−(number of residual tumour cells with 44v6.28z CAR-T cells/number of residual tumour cells with 19.28z CAR-T cells)]. Left: FACS plots from a representative donor. Right: data obtained from n=3 donors (means±SEM). Results from a two-way ANOVA are shown when statistically significant (***P<0.001; ****P<0.0001).

[0210] FIG. 2: N-glycosylation on tumour cells impairs recognition by CD44v6 CAR-T cells. N-glycosylation was hampered in T3M4 pancreatic adenocarcinoma cell lines by knocking out the expression of the glycosyltransferase Mgat5 and the glyco-phenotype was assessed by PHA-L staining. a, Schematic representation of the model T3M4 pancreatic adenocarcinoma cell lines generated (PDAC). b,c, Staining of either wt (N-glycosylation competent) or Mgat5 ko (N-glycosylation defective) T3M4 tumours with PHA-L, that binds complex N-glycans, and with the CAR's target antigen CD44v6. d,e, CD44v6 CAR-T cells (44v6.28z) were challenged with either wt or Mgat5 ko or with tunicamycin treated (100 ng/ml, 48 h) T3M4 tumours. After 4 days, killing was expressed as elimination index (d) and T cell activation as CD69 up-regulation (e). A one-way ANOVA was used for statistical analysis (*P<0.05; **P<0.01). f, IFNγ and TNFα production by CD44v6 CAR T cells (44v6.28z) was measured 24 hours after stimulation with either wt or Mgat5 ko pancreatic tumour cells. A two-way ANOVA was used for statistical analysis (*P<0.05; **P<0.01; ****P<0.0001).

[0211] FIG. 3: Mgat5 ko tumours induce a stronger NFAT and NF-kB activation in effector cells. Jurkat triple reporter cells were transduced with CAR T constructs and stimulated with wt (N-glycosylation competent) or Mgat5 ko (N-glycosylation deficient) T3M4 pancreatic tumour cell lines. a, Schematic representation of the Jurkat-CAR.sup.+ triple reporter (TPR) cell lines generated. b, Time-course activation of Jurkat-CAR+ reporter cells. NFAT and NF-kB activations were assessed by measuring the percentage of eGFP and CFP signals, respectively. A two-way ANOVA was used for statistical analysis (*P<0.05; **P<0.01; ****P<0.0001).

[0212] FIG. 4: 2DG inhibits N-glycosylation in pancreatic tumour cells without having direct effects on their survival and proliferation. a, b, T3M4 pancreatic tumour cells were treated 4 mM of 2DG for 48 hours before analysing the glycosylation status compared to Mgat5 ko (N-glycosylation deficient) cells. a, PHA-L staining showing the glyco-phenotype of 2DG treated cells compared to control Mgat5 ko cells. A one-way ANOVA was used for statistical analysis (****P<0.0001). b, Analysis of (31 integrin and CD44v6 glycosylation in total cell lysates of tumours either untreated (nihil) or treated with incremental doses of 2DG (4 mM or 16 mM) or with control tunicamycin (Tunica, 100 ng/ml) for 48 hours. c,d, Tumour cells were treated with 4 mM 2DG for up to 48 hours before treatment wash-out. Kinetics of tumour de-glycosylation (c) and glycosylation (d) were assessed by PHA-L staining. A one-way ANOVA was used for statistical analysis (****P<0.0001). e,f, Dose-response of tumour cells treated with incremental concentrations of 2DG for 48h. N-glycosylation impairment was determined by PHA-L staining (e) and glycolysis tested by lactate production (f). A two-way ANOVA was used for statistical analysis (*P<0.05; **P<0.01; ****P<0.0001). Tumour survival (g) and proliferation (h) was analysed after treatment with 4 mM 2DG for 48 hours and expressed as percentage of 7AADpos cells and percentage of CFSE dilution, respectively.

[0213] FIG. 5: Blocking glycosylation with low doses of 2DG doesn't impair surface antigen expression. T3M4 pancreatic tumour cells were treated 4 mM of 2DG for 48 hours before analysing antigen expression and cell fitness. a, Biotin-enrichment assay of extracellular de-glycosylated (31 integrin and CD44v6 upon treatment with 2DG or with control PNGase, which cleaves N-glycans. Untreated tumour cells (nihil) are shown as control. b, Extracellular expression of (31 integrin and CD44v6 in tumours either untreated or treated with 4 mM 2DG for 48 hours.

[0214] FIG. 6: 2DG increases tumour recognition and killing by CD44v6 CAR-T cells. (a,b) CD44v6.sup.pos T3M4 (a) and PT45 pancreatic tumour cells (b) were exposed to 4 mM 2DG for 48 hours before being co-cultured with either CD44v6 CAR-T cells (44v6.28z) or control CD19 CAR-T cells (19.28z). The day after, tumour cells killing was analysed by FACS and expressed as elimination index. Left: FACS plots from a representative donor. Middle: elimination indexes at the 1:10 effector to target ratio (E:T ratio). Right: data obtained from n=3 donors (means±SEM). Results from a 1-way ANOVA are indicated when statistically significant (*, P<0.05; ***, P<0.001). c, Time-course activation of Jurkat-CAR+ reporter cells stimulated with either untreated (nihil) T3M4 tumours or treated with 4 mM 2DG for 48 hours. NFAT and NF-kB activations were assessed by measuring the percentage of eGFP and CFP signals, respectively. A two-way ANOVA was used for statistical analysis (****P<0.0001).

[0215] FIG. 7: 2DG doesn't de-glycosylate nor increases killing of healthy cells. a, b, Fresh buffy coat cells were exposed to either medium alone (nihil) or to 4 mM 2DG for 18 hours before analysing cell glycosylation by PHA-L staining (a) and viability by 7aad-AnnexinV staining (b). c,d, Primary keratinocytes were exposed to 2DG for 48 hours before being analysed by western blot or co-cultured with CD44v6 CAR− T cells (44v6.28z). c, Biotin-enrichment assay of extracellular 131 integrin and CD44v6 in primary keratinocytes either untreated (nihil) or treated with 2DG or with control PNGase, which cleaves N-glycosylation sites. d, In vitro killing of primary keratinocytes, either untreated or treated with 2DG, by CD44v6 CAR T cells (44v6.28z). Killing was expressed as elimination index compared to control CD19 CAR-T cells (19.28z).

[0216] FIG. 8: 2DG increases recognition and killing of pancreatic tumour by CD44v6 CAR-T cells in vivo. NSG mice were injected intra-pancreas with 0,1×10.sup.6 T3M4 adenocarcinoma cells expressing a secreted luciferase. a,c, On day 2 and 3 from tumour engraftment, when the tumour burden was low, mice were injected intraperitoneally (i.p.) with 500 mg/kg 2DG. At day 3 mice were infused intravenously (i.v.) with 5×10.sup.5 of either CD44v6 (44v6.28z) or CD19 (19.28z) CAR T cells as control. Tumour burden was monitored by measuring secreted luciferase and a two-way ANOVA was used for statistical analysis (**P<0.01; ***P<0.001). b,d, On day 6 and 7 from tumour engraftment, when the tumour burden was high, mice were injected intraperitoneally (i.p.) with 500 mg/kg 2DG. At day 7 mice were infused intravenously (i.v.) with 5×10.sup.5 of either CD44v6 (44v6.28z) or CD19 (19.28z) CART cells as control. Tumour burden was monitored by measuring secreted luciferase and a two-way ANOVA was used for statistical analysis (**P<0.01)

[0217] FIG. 9: 2DG increases tumour recognition and killing by CEA CAR-T cells. a,b, CEA CAR-T cells (CEA.28z) or control CD19 CAR T cells (19.28z) were challenged with either wt (N-glycosylation competent) or Mgat5 ko (N-glycosylation deficient) T3M4 pancreatic tumour cells. After 4 days, tumour killing was analysed by FACS and expressed as elimination index (a) and T cell activation as CD69 up-regulation (b). A t-test was used for statistical analysis (*P<0.05). c, Time-course activation of Jurkat-CAR+ reporter cells stimulated with either untreated (nihil) or 2DG-treated T3M4 pancreatic tumours. NFAT and NF-kB activations were assessed by measuring the percentage of eGFP and CFP signals, respectively. A two-way

[0218] ANOVA was used for statistical analysis (**P<0.01; ***P<0.001; ****P<0.0001). d-f, CEA.sup.− PT45 (d), CEA.sup.+ BxPc3 (e) and T3M4 (f) cells were exposed to 4 mM 2DG for 48 hours before being co-cultured with CEA CAR-T cells (CEA.28z) or with control CD19 CAR-T cells (19.28z). After 4 days, tumour killing was analysed by FACS and expressed as elimination index. Left: elimination indexes at the 1:10 E:T ratio. Right: data obtained from n=3 donors (means±SEM). Results from a 1-way ANOVA are indicated when statistically significant (*, P<0.05; **, P<0.01; ***, P<0.001). g, Activation of CEA CAR T cells (CEA.28z) co-cultured with either untreated T3M4 pancreatic tumour (nihil) or treated with 4 mM 2DG was measured at 96 hours by CD69 up-regulation. A t-test was used for statistical analysis (**, P<0.01) h, Time-course activation of Jurkat-CAR+ reporter cells stimulated with either untreated T3M4 pancreatic tumour cells (nihil) or treated with 4 mM 2DG for 48 hours. i, IFNγ production by CEA CAR T cells (CEA.28z) was measured 24 hours after stimulation with either untreated (nihil) or 2DG treated pancreatic tumour cells. A two-way ANOVA was used for statistical analysis (*P<0.05).

[0219] FIG. 10: Complex N-glycans are expressed by several epithelial carcinomas. a, heat map of PHA-L, CD44v6 and CEA expression on cell lines deriving from tumours of the pancreas, lung, breast and bladder. b, Correlation analysis of the expression of PHA-L (left) or CD44v6 (right) and the in vitro tumour killing at the 1:10 E:T ratio by 44v6.28z CAR T cells. c, CD44v6+5637, H1975 and PC9 cells were exposed to 4 mM 2DG for 48 hours before being co-cultured with CD44v6.28z CAR-T cells or control 19.28z CAR-T cells. Tumour killing was analysed by FACS and expressed as elimination index. Results from a two-way ANOVA are shown when statistically significant (*P<0.05).

[0220] FIG. 11: Complex N-glycans are expressed by several haematological tumours. a, heat map of PHA-L, CD44v6 and CD19 expression on cell lines deriving from acute myeloid leukaemia (AML), multiple myeloma (MM), chronic myelogenous leukaemia (CML), acute lymphoblastic leukaemia (ALL) and lymphoma.

DETAILED DESCRIPTION OF THE INVENTION

[0221] Materials and Methods

[0222] Transduction and Culture Conditions

[0223] Activation of T cells from healthy donors was performed with anti-CD3/CD28 immune-conjugated magnetic beads (bCD3/CD28) (ClinExvivo CD3/CD28; Invitrogen) following manufacturer's instructions. T cells were RV-transduced by 2 rounds of spinoculation or LV-transduced by overnight incubation and cultured in RPMI 1640 (Gibco-Brl), fetal bovine serum (10%, BioWhittaker) with IL-7 and IL-15 (5 ng/mL; Peprotech). CAR transduction efficiency and sorting was performed by protein-L (Thermo Scientific) staining according to manufacturer's instructions. Phenotypic analysis and functional testing were performed at day 21 after stimulation. Tumour cells were LV-transduced by overnight incubation and FACS-sorted with marker genes. Haematological tumours, bladder cancer and lung cancer cells were cultured in RPMI 1640 (Gibco-Brl) whereas pancreatic tumour cells were cultured in IMDM (Gibco-Brl). All media for T cell and tumour cell growth were supplemented with penicillin (100 UI/ml; Pharmacia), streptomycin (100 UI/ml; Bristol-Meyers Squibb), glutamine (2 mM; Gibco) and fetal bovine serum (10%, BioWhittaker). XG-6 and XG-7 cells were cultured with addition of IL-6 (2 ng/ml, Peprotech). Primary keratinocytes were purchased from Lonza (L0192627) and cultured in Epi-Life (Invitrogen, M-EPI-500-CA) with the human keratinocytes growth supplement (Invitrogen, S-001-5) following manufacturer's instructions.

[0224] Cosmc PCR and Sequencing

[0225] Total genomic DNA from Jurkat and K562 cells was isolated using the QIAamp DNA mini kit (Qiagen). For Cosmc gene PCR, the forward primer was 5′-CTCCATAGAGGAGTTGTTGC-3′ (SEQ ID NO. 1) and the reverse primer was 5′-TCACGCTTTTCTACCACTTC-3′ (SEQ ID NO. 2). The expected 1,218-bp PCR band product was analysed on agarose gel, extracted and sequenced.

[0226] Retroviral and Lentiviral Constructs

[0227] To generate the Cosmc lentiviral (LV) expression vector, DNA sequence was synthetized by GeneArt (ThermoFisher) and cloned into a self-inactivating LV vector with a PGK bidirectional promoter driving the co-expression of CD44v6 or Cosmc molecules and marker genes NGFR or eGFP, respectively. The inventors generated CD44v6, CEA, CD19 CAR constructs by cloning specific scFvs CD44v6, BIWA8 mAb; CEA, BW431-26 mAb; CD19, FMC63 mAb) in a CAR backbone carrying an IgG1-derived hinge spacer, a CD28 costimulatory endodomain and the TCR zeta chain. All CAR constructs were expressed into viral vectors and the supernatants produced in 293T cells. Retroviral vectors were employed as described in Casucci M et al., Blood. 2013 Nov. 14; 122(20):3392 while lentiviral vectors as described in Amendola M et al., Nat Biotechnol 2005 January; 23(1):108-16. Both, the CD44v6 lentiviral expression vector and the secreted luciferase expression vector were employed as previously described (Norelli et al., Nat Med 2018, 24, pages739-748; Bondanza and Casucci, Methods in molecular biology 1393, Tumor immunology methods and protocols, chapter 10).

[0228] All sequences generated and cloned into viral vector backbones are listed below.

TABLE-US-00005 COSMC sequence (SEQ ID NO. 3): MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNK EDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAE FFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTT FAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKR LNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDV FNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVY RLRAFGHIFNDALVFLPPNGSDND CD19-scFv (FMC63) sequence (SEQ ID NO. 4): MEFGLSWLFLVAILKGVQCSRDIQMTQTTSSLSASLGDRVTISCRASQD ISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISN LEQEDIATYFCQQGNTLPYTFGGGTKLELKRGGGGSGGGGSGGGGSGGG GSEVQLQQSGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEW LGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCA KHYYYGGSYAMDYWGQGTTVTVSSYVTVSS CD44v6-scFv (Biwa-8) sequence (SEQ ID NO. 5): MEAPAQLLFLLLLWLPDTTGEIVLTQSPATLSLSPGERATLSCSASSSI NYIYWLQQKPGQAPRILIYLTSNLASGVPARFSGSGSGTDFTLTISSLE PEDFAVYYCLQWSSNPLTFGGGTKVEIKRGGGGSGGGGSEVQLVESGGG LVKPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSTISSGGSYTY YLDSIKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARQGLDYWGRGT LVTVSS CEA-scFv (BW431-26) sequence (SEQ ID NO. 6): MDFQVQIFSFLLISASVIMSRGVHSQVQLQESGPGLVRPSQTLSLTCTV SGFTISSGYSWHWVRQPPGRGLEWIGYIQYSGITNYNPSLKSRVTMLVD TSKNQFSLRLSSVTAADTAVYYCAREDYDYHWYFDVWGQGTTVTVSSGG GGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCSTSSSVSYMHWYQ QKPGKAPKLLIYSTSNLASGVPSRFSGSGSGTDFTFTISSLQPEDIATY YCHQWSSYPTFGQGTKVEIKV Hinge sequence (SEQ ID NO. 7): EPKSCDKTHTCPPCP CD28 sequence (SEQ ID NO. 8): FWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGP TRKHYQPYAPPRDFAAYRS CD3ζ chain sequence (SEQ ID NO. 9): RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR*

[0229] 2DG Treatment

[0230] For dose assessment, tumour cells were exposed to 2, 4, 8, 16 or 64 mM 2DG (D8375, Sigma-Aldrich) and, after 48h, absolute cell numbers and percentages of necrotic and proliferating cells were determined by FACS using Flow-Count Fluorospheres (BeckmanCoulter), 7-AAD and CFSE, respectively. For pharmacokinetic studies, tumour cells were treated with 4 mM 2DG and surface N-glycosylation was assessed by PHA-L staining at different time points from treatment or from wash-out to assess the kinetic of de-glycosylation and glycosylation, respectively. For safety studies, buffy coat cells were treated with 4 mM 2DG for 18 hours in the presence of IL-2 (100 IU/mL; Chiron), IL-21 (10 ng/ml; Peprotech) and IL-15 (5 ng/mL; Peprotech) before assessment of the glyco-phenotype by PHA-L staining and of cell viability by 7aad/AnnexinV staining.

[0231] In Vitro Co-Culture Assay

[0232] CEA or CD44v6 CAR-T cells from healthy donors were co-cultured at 1:5, 1:10, 1:25 E:T ratios with target cells in the absence of IL-7 and IL-15. T cells transduced with an irrelevant CAR (CD19 CAR T) were used as control. After 24h or 96h, co-cultures were analysed by FACS using Flow-Count Fluorospheres (BeckmanCoulter) and target cell killing, expressed as Elimination Index, was calculated as follows: 1−(number of residual target cells with experimental CAR-T cells/number of residual target with irrelevant CAR-T cells). In co-culture assays combining CAR-T cells with 2DG, target cells were exposed to 4 mM 2DG for 48h before being washed, co-cultured with experimental or irrelevant CAR-T cells and analysed as above. In these experiments, the Elimination Index of 2DG alone was calculated as follows: 1-(number of target cells cultivated in medium supplemented with 2DG/number of target cells cultivated in medium alone). Co-culture of Jurkat CAR-TPR and tumour cells was performed at 1:1 E:T ratio. As control, Jurkat CAR-TPR cells were treated with either 50 ng/mL of phorbol myristate acetate (PMA) or 1 μg/mL of lonomycin or a combination of the two. Upregulation of fluorescence was assessed after 24 hours

[0233] Flow Cytometry

[0234] The inventors used mAbs specific for human CD44v6 (e-Bioscience), CD3, CD45, NGFR, LAG3 (BD Bioscience), HLA-DR, PD1, TIM3, (Biolegend), CD57 (Miltenyi Biotec). To determine cell vitality, 7-Aminoactinomicin D (7-AAD), AnnexinV or DAPI reagents were used. For LV transduced tumour cells, GFP expression was analysed by direct fluorescence. Samples were run through a fluorescence-activated cell sorting (FACS) Canto flow cytometer (BD Biosciences) and data were analysed with the FlowJo software (Tree Star, Inc.). For branched N-glycans expression analysis, cells were incubated with biotinylated Phaseolus vulgaris Leukoagglutinin (PHA-L; Caderlane) for 1 hour according to manufacturer's instructions, washed and incubated with PE-conjugated streptavidin and analysed by flow cytometry.

[0235] Generation of CAR.sup.+ Jurkat Triple Reporter Cells

[0236] The triple reporter Jurkat T cell line (Jurkat TPR) was kindly provided by the group of Steinberger (S. Jutz et al., Journal of Immunological Methods 430 (2016) 10-20). First, cells were transduced by overnight incubation with lentiviral vectors expressing CAR constructs, either specific for CD44v6 (44v6.28z) or CD19 (19.28z). Next, transduction efficiency was checked by flow cytometry after a week by looking at the percentage of cells positive for the marker gene NGFR. Finally, CAR′ Jurkat TPR cells were co-cultured with target cells at the effector to target (E:T) ratio of 1:1 and reporter gene activation was assessed at 4, 6, 24 or 48 hours by flow cytometry using CytoFLEX (Beckman Coulter).

[0237] Generation of Mgat5 Knocked-Out Pancreatic Tumour Cells

[0238] The lentiviral vector plasmid encoding for Mgat5-specific gRNA and Cas9 protein was purchased from ABM good (K1298706). After lentiviral vector production, T3M4 pancreatic tumour cell line was transduced and cultivated in puromycin supplemented medium for positive selection according to manufacturing instructions (Thermo Fisher, A1113803).

[0239] Western Blot Assays

[0240] Tumour cells or healthy primary keratinocytes were treated with either medium alone or supplemented with 4 mM 2DG for 48h, lysed and subjected to SDS polyacrylamide gel electrophoresys. De-glycosylation was assessed as molecular weight shift. For selective cell membrane protein analysis, biotinilation assay was performed according to manufacturer instructions (Thermo Scientific). Treatment of cell lysates with PNGase F (NEB, P0704) was performed as recommended by the manufacturer's instructions.

[0241] In Vivo Efficacy Experiment

[0242] All experiments were approved by the Institutional Animal Care and Use Committee (IACUC) of San Raffaele University Hospital and Scientific Institute and by the Italian Governmental Health Institute (Rome, Italy). NSG mice (NOD.Cg-Prkdcscid Il2rgtm1Wj1) were obtained from the Jackson Laboratories and kept in a specific-pathogen-free (SPF) facility within individually ventilated cages. 9-week-old NSG mice were injected intra-pancreas with 0,1×10.sup.6 T3M4 tumour cells expressing a secreted luciferase (Bondanza and Casucci, Methods in molecular biology 1393, Tumor immunology methods and protocols, chapter 10). At day 6 and 7 from tumour engraftment, when the tumour burden was high, mice were injected intraperitoneally (i.p.) with 500 mg/kg 2DG. At day 7 mice were infused intravenously (i.v.) with 5×10.sup.5 of either CD44v6 or CD19 CAR T cells as control. In another set of experiments, mice were treated with 500 mg/kg 2DG at day 2 and 3 and received 10×10.sup.5 of either CD44v6 or CD19 CAR T cells at day 3, when the tumour burden was low. Tumour growth was monitored by bioluminescence assay using the QUANTI-Luc detection reagent (InvivoGen) and expressed as relative light units (RLUs), according to the manufacturer instructions. Mice were sacrificed when RLUs were >10.sup.6. At sacrifice, tumour masses were retrieved, dissociated using gentle MACS (Miltenyi Biotec) and tumour dissociation reagents (Miltenyi Biotec, 130-095-929) following manufacturer's instructions and analysed by FACS.

[0243] Lactate Production Assay

[0244] Lactate production was assessed after 48 hours of 2DG treatment at the doses of 2, 4, 8, 16 or 64 mM 2DG using the Lactate-Glo assay (Promega) according to the manufacturer's instructions.

[0245] Statistical Analysis

[0246] Statistical analysis was performed using Graphpad Prism 5.0a software version. All data are presented as mean+/−SEM. T-test, One-way or Two-way ANOVA was used to determine the statistical significance of differences between samples. Differences with a P value<0.05 were considered statistically significant.

Examples

Example 1: Glycosylation Protects CD44v6+ Tumour Cells from CD44v6 CAR-T Cell Killing

[0247] The inventors recently developed and optimized a CD44v6 CAR able to tackle multiple tumour types including acute myeloid leukaemia, multiple myeloma and several epithelial carcinomas (Casucci M et al., Blood. 2013 Nov. 14; 122(20):3392-4). Since CD44v6 is extensively glycosylated (Ponta H et al., Nat Rev Mol Cell Biol. 2003 January; 4(1):33-45) and sugar chains may be sterically hulking, the inventors investigated whether glycosylation, either 0- or N-linked, could influence its targeting by CD44v6 CAR-T cells. As a first step to answer this question, the inventors took advantage of the Jurkat T-cell leukaemia cell line that is naturally characterized by a loss-of-function mutation of the T synthase chaperone protein Cosmc resulting in defective O-glycosylation (Ju T et al., Proc Natl Acad Sci USA. 2002 Dec. 24; 99(26):16613-8; FIG. 1a). To restore O-glycosylation and provide the antigen for CAR-T cells, Jurkat cells were transduced with lentiviral vectors carrying Cosmc and CD44v6 together with a selection marker (FIG. 1b). Strikingly, CD44v6 CAR-T cells recognized and killed more efficiently O-glycosylation incompetent Jurkat cells (44v6pos/Cosmcneg) than O-glycosylation competent Jurkat cells (44v6pos/Cosmcpos) (FIG. 1c). Accordingly, once transduced with the CD44v6 gene, naturally O-glycosylation competent K562 cells were lysed similarly to engineered glycosylation-competent Jurkat cells. These results indicate that O-glycosylation may hamper target cell killing by CAR-T cells.

[0248] To verify the impact of N-glycosylation, the inventors generated N-glycosylation-defective pancreatic tumour cells, e.g. T3M4, by knocking-out the expression of the glycosyltransferase Mgat5 using the CRISPR-Cas9 technology (FIG. 2a). Inhibition on N-glycosylation was confirmed by decreased binding to the PHA-L (FIG. 2b), a lectin that specifically binds to Mgat5-modified branched N-glycans. Importantly, glycosylation inhibition did not significantly interfere with CD44v6 exposure on the cell membrane, which is pre-requisite for CAR targeting (FIG. 2c). Strikingly, hampering N-glycosylation on T3M4 cells dramatically improved their elimination by CD44v6 CAR-T cells (FIG. 2d). This effect is associated with improved CAR-T cell activation (FIG. 2e) and cytokine release (FIG. 21), suggesting more proficient antigen engagement. These findings were confirmed using the N-glycosylation inhibitor tunicamycin. To verify if improved antitumor activity resulted from a different CAR-induced intracellular signalling event, the inventors exploited “triple parameter reporter” (TPR) Jurkat T cells (Jutz S et al., J Immunol Methods. 2016 March; 430:10-20 and FIG. 3a), in which different fluorescent proteins are placed under specific control of transcription factors (TFs) turned on during T-cell activation, e.g. NFAT, NF-kB and AP-1. These cells were transduced with the CD44v6 CAR and stimulated with different target cells. TFs elevation was stronger in the case of N-glycosylation defective T3M4 cells (FIG. 3b, left). As expected, no activation was observed in the case of TPR Jurkat cells transduced with the CD19 CAR and stimulated with CD19-negative target cells (FIG. 3b, right).

[0249] Altogether, these results indicate that glycosylation inhibits target cell elimination by CAR-T cells, possibly by sterically interfering with antigen recognition. Considering that solid tumours are characterized by several glycosylation alterations (Pinho S S et al., Nat Rev Cancer. 2015 September; 15(9):540-55), especially including an increased branching of N-glycans, pharmacological interference with the generation of such cumbersome sugar structures was assessed to verify if it might increase tumour cell recognition and killing by CAR-T cells.

Example 2: 2DG Blocks N-Glycosylation on Pancreatic Cancer Cells

[0250] Searching for glycosylation inhibitors to safely use in combination with CAR-T cells, the inventors focused their attention on 2-Deoxy-D-Glucose (2DG). 2DG is a potent inhibitor of both glycolysis and N-linked glycosylation, which proved good tolerability in humans possibly thanks to its preferential accumulation in tumour cells, compared to healthy cells, as a consequence of the Warburg effect (Singh D et al., Strahlenther Onkol. 2005 August; 181(8):507-14; Stein M et al., Prostate. 2010 Sep. 15; 70(13):1388-94; Raez L E et al., Cancer Chemother Pharmacol. 2013 February; 71(2):523-30; Magistroni R et al., J Nephrol. 2017 August; 30(4):511-519; Xi H et al., IUBMB Life. 2014 February; 66(2):110-21). For these reasons, the inventors started investigating if 2DG might increase antitumor activity of CAR-T cells against solid tumours. As a first tumour model they used pancreatic adenocarcinoma, a cancer for which the development of new therapeutic options is particularly urgent (only the 5% of people are alive 5 years after diagnosis, World Cancer Report 2014 WHO).

[0251] Similarly to what happens after knocking out the Mgat5 gene, 2DG was able to potently inhibit N-glycosylation, as indicated by reduced binding to PHA-L (FIG. 4a) and by molecular-weight shift of beta-1 integrin, a model protein used for western blot analysis (FIG. 4b). This effect was already detectable after 5 hours (FIG. 4c) and lasted 24 hours after washing out 2DG (FIG. 4d). Moreover, it was already present when using low doses of 2DG (FIG. 4e), which were unable to inhibit glycolysis (FIG. 4f), suggesting that the selective blockade of N-glycosylation with 2DG is feasible. To note, low doses of 2DG had no impact on tumour cell viability (FIG. 4g) and proliferation (FIG. 4h), suggesting poor efficacy of 2DG as monotherapy.

[0252] Since expression on the cell surface is a prerequisite for CAR targeting, the inventors sought to examine if de-glycosylated antigens generated upon treatment with 2DG were able to reach the cell membrane. To this aim, they performed biotin-enrichment western blot analysis (see methods). Importantly, de-glycosylated forms of beta-1 integrin and CD44v6 were clearly detected among surface proteins upon treatment with 2DG (FIG. 5a). Treatment with the PNGase enzyme, which is able to cut glycans on mature proteins, was used as control and produced similar results. Surface expression levels of beta-1 integrin and CD44v6 measured by FACS were maintained as well (FIG. 5b).

[0253] Altogether these results indicate that low doses of 2DG are not cytotoxic per se for tumour cells but can inhibit N-glycosylation without interfering with proteins exposure on the cell surface.

Example 3: 2DG Increases Killing of Pancreatic Cancer Cells by CD44v6 CAR-T Cells

[0254] After proving that 2DG induces the exposure of de-glycosylated antigens, the inventors investigated the antitumor activity of a combined approach based on 2DG plus CAR-T cells.

[0255] To avoid the potentially confusing activity of 2DG on T cells, tumour cells were pre-treated with 2DG before being co-cultured with CAR-T cells in the absence of 2DG. While expressing CD44v6, both PT45 and T3M4 were poorly targeted by CD44v6 CAR-T cells alone (FIG. 6a-b, red bars and lines). Strikingly, however, pre-treatment with 2DG sensitized tumour cells to recognition by CD44v6 CAR-T cells, significantly increasing their elimination (FIG. 6a-b, blue bars and lines). Notably, this effect was not simply additive but synergic, since it was above what could be expected from the individual antitumor activity of 2DG (which was lacking) and CAR-T cells alone (which was minimal)

[0256] By taking advantage of CAR-transduced Jurkat TPR cells, the inventors demonstrated that improved tumour cell killing also associated with improved T-cell activation (FIG. 6c), as was the case of Mgat5 knocked-out cells (see EXAMPLE 1).

Example 4: 2DG does not Increase the Killing of Healthy Keratinocytes by CD44v6 CAR T Cells

[0257] To shed some light on the safety profile of the approach, the inventors started by evaluating the effect of 2DG alone towards healthy peripheral blood mononuclear cells (PBMCs). The same doses of 2DG able to inhibit tumour glycosylation failed to interfere with PBMCs glycosylation (FIG. 7a) and did not impact on the viability of CD3+ T cells, CD19+ B cells, CD14+ monocytes and CD15+ granulocytes (FIG. 7b).

[0258] Next, the inventors investigated the effect of the combined approach on healthy cells that can be potentially targeted by CAR-T cells. They previously reported both in vitro (Casucci M et al., Blood. 2013 Nov. 14; 122(20):3392-4) and in vivo that human keratinocytes, while expressing CD44v6, are not targeted by CD44v6 CAR-T cells. To verify if 2DG might increase their killing, human primary keratinocytes were exposed to 2DG before being co-cultured with CD44v6 CAR-T cells. Importantly, the same dose of 2DG able to enhance tumour cell recognition failed to inhibit keratinocyte glycosylation (FIG. 7c) and to increase keratinocyte elimination by CD44v6 CAR-T cells (FIG. 7d). These data support that glycosylation inhibitors improve the efficacy of CAR-T cell therapy. In particular thanks to the Warburg effect, 2DG improves the efficacy of CD44v6 CAR-T cell therapy without increasing toxicity against healthy tissues.

Example 5: Treatment with 2DG Sensitizes Pancreatic Tumour Cells to CD44v6 CAR-T Cell Therapy In Vivo

[0259] The inventors next sought to evaluate if glycosylation inhibitors, such as 2DG, can sensitize tumour cells to killing by CAR-T cells in a pancreatic adenocarcinoma xenograft mouse model. To this aim, they used two different settings, i e minimal residual-disease (MRD) with a high CAR-T cell dose (FIG. 8a) and high tumour burden (HTB) with low CAR-T cell dose (FIG. 8b) in order to test the combinatorial treatment modality in both a more permissive setting as well as in a more challenging one, respectively. Briefly, NSG mice were injected with 44v6pos/19neg T3M4 cells expressing a secreted luciferase that allows the easy monitoring of tumour growth by simply analysing blood samples (Falcone L et al., Methods Mol Biol. 2016; 1393:105-11). After 2 or 7 days (MRD and HTB settings, respectively) mice received 2DG and were treated with different doses of CD44v6 or CD19 CAR-T cells (see Methods). Tumour growth was weekly monitored through bioluminescent analysis of blood samples. Whereas in the MRD setting, CD44v6 CAR-T cells were able alone to clear pancreatic tumour cells (FIG. 8c), in the HTB setting mice receiving CD44v6 CAR-T cells significantly benefited from 2DG administration (FIG. 8d). Interestingly, at sacrifice, tumour-infiltrating CD44v6 CAR-T cells from mice that received 2DG included a significantly lower frequency of cells expressing exhaustion and senescence markers compared to mice that did not receive 2DG, suggesting a better anti-tumour activity in the long-term (FIG. 8e). Altogether, these results showed efficacy of the combined treatment against a very aggressive pancreatic cancer cell line even in the setting where CAR-T cell alone were uncapable to mediate any antitumor activity.

Example 6: The Combined Approach is Feasible with Different CAR Specificities

[0260] To verify if the synergistic effect between 2DG and CAR-T cells is common to other CAR specificities, the inventors took advantage of CEA CAR-T cells. The inventors chose CEA because it is a heavily glycosylated protein (60% of its weight comes from carbohydrates) over-expressed on a wide variety of solid tumours. Recently, CEA CAR-T cells proved hint of efficacy in the absence of significant toxicities in patients with liver metastasis of pancreatic cancer or colorectal carcinoma (Katz S C et al., Clin Cancer Res. 2015 Jul. 15; 21(14):3149-59; Zhang C et al., Mol Ther. May 3; 25(5):1248-1258), indicating that strategies to increase antitumor efficacy of CEA CAR-T cells are of great interest in the field.

[0261] In the present invention, it is demonstrated that, similarly to what observed with CD44v6 CAR-T cells (EXAMPLE 1), CEA CAR-T cells kill more efficiently N-glycosylation defective T3M4 cells than N-glycosylation competent cells (FIG. 9a). Also in this case, increased tumour killing was accompanied by increase T-cell activation, as indicated by analysing CD69 upregulation (FIG. 9b) and by exploiting Jurkat TPR cells as described in EXAMPLE 1 (FIG. 9c).

[0262] Most importantly, while pre-treatment with 2DG did not increase recognition of CEAneg PT45 tumour cells by CEA CAR-T cells (FIG. 9d), it significantly improved the elimination of CEApos BxPC3 and T3M4 tumour cells (FIG. 9e-f). Again, such improvement associated with increased CAR-T cell activation (FIG. 9g-h) and cytokine release (FIG. 9i).

[0263] Altogether, these results support the application of this combined strategy with different CAR specificities.

Example 7: The Synergistic Effect is Applicable to Different Tumour Types

[0264] To verify if the synergistic effect between glycosylation inhibitors (such as 2DG) and CAR-T cells can be exploited with different tumour types, the inventors screened different solid (FIG. 10a) and hematologic (FIG. 11a) tumour cell lines for their glycosylation status, by exploiting PHA-L staining. Albeit expected variability, several cell cancer lines both from solid and hematopoietic types were found highly N-glycosylated, indicating that different cancer types, including pancreatic, lung and bladder solid tumours as well as AML, ALL and MM, can be targeted with the approach that combines glycosylation inhibitors and CAR T-cell treatments.

[0265] To functionally prove it, the inventors performed co-culture assays with some of the cell lines analysed. Strikingly, a negative correlation was observed between N-glycosylation levels and killing by CD44v6 CAR-T cells (FIG. 10b), further supporting that glycosylation negatively impacts CAR-T cell recognition. Moreover, the inventors proved that inhibiting glycosylation, in particular N-glycosylation with an inhibitor, in particular 2DG, drastically increase the elimination of highly glycosylated tumours that are barely targeted by CAR-T cells alone (FIG. 10c).

[0266] Altogether, these results support the application of this combined strategy for the treatment of multiple tumour types.