Improved Fluorescent Resonance Energy Transfer-Based Biosensor Proteins And Their Methods of Use Thereof
20210285940 · 2021-09-16
Inventors
- Richard Sayre (Los Alamos, NM)
- Mikhail Sinev (Los Alamos, NM, US)
- Elena Sineva (Los Alamos, NM, US)
- Tim Travers (Los Alamos, NM, US)
Cpc classification
G01N21/6428
PHYSICS
C07K2319/60
CHEMISTRY; METALLURGY
G01N33/542
PHYSICS
International classification
G01N33/542
PHYSICS
Abstract
The inventive technology may include a tripartite fluorescent resonance energy transfer (FRET) based fusion protein complex having a ligand binding domain capable of binding to a target ligand and coupled with a donor-acceptor pair of chromophores moieties. The ligand binding domain may be positioned between the donor and acceptor chromophore moieties and may further bind to another ligand binding domain forming a homodimer complex. Ligand binding may cause dissociation of the homodimer complex leading to enhanced donor fluorescence emission and simultaneous quenching of the acceptor fluorescence emission, yielding significant decreases in the acceptor-to-donor fluorescence emission ratio. The tripartite FRET based fusion protein may be used as a biosensor, preferably for molecules responsible for bacterial quorum sensing.
Claims
1. A biosensor for the detection of quorum sensing molecules comprising: a LuxP binding domain disposed between a Tq protein donor moiety and a NG protein acceptor moiety forming a fusion biosensor protein wherein said LuxP binding domain binds to a LuxP binding domain of a second fusion biosensor protein forming a homodimer fusion biosensor protein; wherein binding of a quorum sensing molecule to said LuxP binding domain causes dissociation of said homodimer fusion biosensor protein causing enhanced Tq-donor fluorescence emission and simultaneous quenching of NG-acceptor fluorescence emission resulting in a decrease in the Tq-NG acceptor-to-donor fluorescence emission ratio.
2. The biosensor protein of claim 1, wherein said fusion biosensor protein comprises a fusion biosensor protein selected from the group consisting of: amino acid SEQ ID NOs. 2-3.
3. The biosensor protein of claim 1, wherein said wherein said LuxP binding domain comprises amino acid SEQ ID NO. 5.
4. The biosensor protein of claim 3, wherein said wherein said Tq protein donor moiety comprises amino acid SEQ ID NO. 9.
5. The biosensor protein of claim 3, wherein said, wherein said NG protein acceptor moiety comprises amino acid SEQ ID NO. 7.
6. The biosensor protein of claim 4, wherein said Tq protein donor moiety is connected to the N-terminus of said LuxP binding domain, and wherein said NG protein acceptor moiety is connected to the C-terminus of said LuxP binding domain.
7. (canceled)
8. The biosensor protein of claim 1, wherein said quorum sensing molecule comprises BAI-2.
9. The biosensor protein of claim 1, wherein said homodimer fusion biosensor protein comprises a homodimer fusion biosensor protein formed in a low salt environment.
10-14. (canceled)
15. A tripartite fluorescent ratiometric sensor protein comprising: a ligand binding domain disposed between a protein donor moiety and a protein acceptor moiety forming a fusion biosensor protein wherein said ligand binding domain binds to a ligand binding domain of a second fusion biosensor protein forming a homodimer fusion biosensor protein; wherein binding of a ligand to said ligand binding domain causes dissociation of said homodimer fusion biosensor protein causing enhanced donor fluorescence emission and simultaneous quenching of acceptor fluorescence emission.
16. The tripartite fluorescent ratiometric sensor protein of claim 15, wherein said ligand binding domain comprises a LuxP binding domain.
17. The tripartite fluorescent ratiometric sensor protein of claim 16, wherein said LuxP binding domain comprises a truncated BAI-2 receptor (LuxP) from Vibrio harveyi.
18. The tripartite fluorescent ratiometric sensor protein of claim 17, wherein said truncated BAI-2 receptor (LuxP) from Vibrio harveyi comprises amino acid SEQ ID NO. 5.
19. The tripartite fluorescent ratiometric sensor protein of claim 15, wherein said donor protein moiety comprises a mTurquoise2 (Tq) monomeric subunit from Aequorea victoria fused to the N-terminus of said ligand binding domain.
20. The tripartite fluorescent ratiometric sensor protein of claim 19, wherein said mTurquoise2 (Tq) monomeric subunit from Aequorea victoria comprises amino acid SEQ ID NO. 9.
21. The tripartite fluorescent ratiometric sensor protein of claim 15, wherein said acceptor protein moiety comprises a mNeonGreen (NG) monomeric subunit from Aequorea victoria fused to the C-terminus of said ligand binding domain.
22. The tripartite fluorescent ratiometric sensor protein of claim 21, wherein said mNeonGreen (NG) monomeric subunit from Aequorea victoria comprises amino acid SEQ ID NO. 7.
23. The tripartite fluorescent ratiometric sensor protein of claim 15, wherein said fusion biosensor protein comprises a fusion biosensor protein selected from the group consisting of: amino acid SEQ ID NOs. 2-3.
24-25. (canceled)
26. The tripartite fluorescent ratiometric sensor protein of claim 15, wherein said homodimer fusion biosensor protein comprises a homodimer fusion biosensor protein formed in a low salt environment.
27. The tripartite fluorescent ratiometric sensor protein of claim 15, wherein said enhanced Tq-donor fluorescence emission and simultaneous quenching of NG-acceptor fluorescence emission comprises a decrease in the Tq-NG acceptor-to-donor fluorescence emission ratio.
28-36. (canceled)
37. A fluorescent biosensor protein selected from the group consisting of: SEQ ID NOs. 2-3.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0034] The novel aspects, features, and advantages of the present disclosure will be better understood from the following detailed descriptions taken in conjunction with the accompanying figures, all of which are given by way of illustration only, and are not limiting the presently disclosed embodiments, in which:
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
DETAILED DESCRIPTION OF INVENTION
[0056] The following detailed description is provided to aid those skilled in the art in practicing the various embodiments of the present disclosure, including all the methods, uses, compositions, etc., described herein. Even so, the following detailed description should not be construed to unduly limit the present disclosure, as modifications and variations in the embodiments herein discussed may be made by those of ordinary skill in the art without departing from the spirit or scope of the present discoveries.
[0057] The present invention relates to systems, methods and compositions for the detection of target molecules. In one preferred embodiment, the inventive technology may include systems, methods and compositions for the detection of QS molecules, preferably produced by bacterial pathogens or mimics thereof, and biosensors embodying such method. In general, one method of the present invention involves binding a QS compound to a fluorescent protein complex, which results in a conformational change in the complex, which causes dissociation of the biosensor dimers, and thereby yields a characteristic change in resonance energy transfer.
[0058] A biosensor protein or compound within the scope of the inventive technology may include a tripartite FRET-based fusion protein complex comprising: (1) a ligand binding domain capable of binding to a target ligand or compound and a donor-acceptor pair of chromophores moieties. In this embodiment, the ligand binding domain may be positioned between the donor and acceptor chromophore moieties, enabling fluorescent resonance energy transfer (FRET) between them as generally described herein.
[0059] The invention may include a biosensor protein comprising: (1) a protein capable of binding to the class of QS compounds known as autoinducers, such as autoinducer 2 (AI-2) and/or derivatives thereof shown in
[0060] In one embodiment, a fusion biosensor protein, such as TqLPNG, may include linker domains that tether the donor (Tq) and acceptor (NG) moieties to the QS—ligand binding moiety. In some embodiments, such linkages can be useful for positioning the Tq and NG moieties enabling FRET between their fluorophores. Typically, useful linkages can comprise relatively flexible and sterically unhindered moieties, such as glycine, alanine and polymers or copolymers thereof. Alternatively, other embodiments can include relatively inflexible linking moieties, such as amino acids having bulky side chains, e.g. phenylalanine, tyrosine, etc. Still further embodiments can comprise combinations of flexible and inflexible linking moieties, thereby achieving an intermediate degree of flexibility.
[0061] As noted above, the improved biosensor protein incorporates FRET. In general, FRET occurs when the emission spectrum of a donor moiety overlaps with the absorption spectrum of an acceptor moiety, and the donor and acceptor are close enough to electronically couple (Van der Meer et al., 1994). The spectral overlap (among the other factors like the donor radiative lifetime and the orientation factor) determines an important characteristic of the donor-acceptor FRET pair, the Forster distance (R.sub.0), which in turn determines the dependence of the FRET efficiency (E) on the donor-acceptor distance (R):
E=R.sub.0.sup.6/(R.sub.0.sup.6+R.sup.6)
[0062] Preferably, the absorption spectra of the donor and acceptor should be well separated, so that the wavelength selected for exciting the donor (λex.sup.D) minimally excites the acceptor. In other words, at λex.sup.D excitation, the donor absorption should prevail over the acceptor absorption [ε.sub.D(λex.sup.D)>ε.sub.A(λex.sup.D)]. If the acceptor absorption at λex.sup.D prevails over the donor absorption, then the directly excited acceptor emission (dirA) prevails over the acceptor emission excited through FRET mechanism (A.sub.FRET), yielding a small enhancement in the acceptor emission and associated problems for the FRET evaluation.
[0063] In the case of FRET, fluorescence emission spectrum (at λex.sup.D excitation) of donor-acceptor species, DA(λ) comprises the donor emission contribution, quenched (as compared with donor emission in the absence of FRET) due to the FRET reduced donor emission, and the acceptor emission contribution, enhanced (as compared with the acceptor emission directly excited at λex.sup.D) due to the FRET excited acceptor:
[0064] where dirA(λ)+A.sub.FRET(λ)=k[c.sub.DAε.sub.AQ.sub.AF.sub.A(λ)+c.sub.DAε.sub.DEQ.sub.AF.sub.A(λ)]; k is the geometric factor (which determines the fraction of the total emission collected); c.sub.DA—is the molar concentration of DA-species; Q.sub.D—is the donor emission quantum yield; Q.sub.A—is the acceptor emission quantum yield; F.sub.D(λ)—is the donor fluorescence emission spectrum; and F.sub.A(λ)—is the acceptor emission spectrum.
[0065] The efficiency of FRET may be determined either from the extent of quenching of the donor emission, E=(Q.sub.DA−Q.sub.D)/Q.sub.D=1−D-DA(λ)/D-D(λ) [where D-DA(λ) is the donor emission intensity in DA-species (i.e., in the presence of acceptor); and D-D(λ)—is the donor emission in the D-species (i.e., in the absence of the acceptor)], or from the extent of enhancement in the acceptor emission, E=[A-DA(λ)/dirA(λ)−1]/[ε.sub.D(λex.sup.D)/ε.sub.A(λex.sup.D)] [where A-DA(λ)—is the acceptor emission component of the total emission in DA-species at λex.sup.D excitation]. The latter one is preferable since the direct acceptor excitation can be determined using the same DA-species selectively excited at the acceptor excitation only, i.e., at the wavelength where the donor has no absorption (which is 505 nm in the case of TqLPNG biosensor).
[0066] As shown in the spectra in
[0067] In addition to the foregoing, FRET can be quantified by time-resolved fluorescence spectroscopy. Usually, the appropriate time-scale for such measurements falls in the nanosecond regime; however, others may fall in the pico or femtosecond parameters. In any case, an increase in FRET is indicated by a reduction in donor excited state life-time relative to an appropriate control sample. As will be apparent to one of ordinary skill in the art, there are a variety of alternative methods for quantifying FRET which may fall within the scope of the current invention.
[0068] In one embodiment, the biosensor of the present invention comprises at least the following three components: (1) a ligand binding domain protein or protein fragment, such as a full or truncated QS binding protein moiety; (2) a donor protein; and (3) a paired acceptor protein. In a preferred embodiment, a ligand binding domain protein or protein fragment ‘holds’ the donor and acceptor protein or fragments in close enough proximity for them to experience FRET. When a target ligand, such as QS molecule (or other compounds) binds the ligand binding domain, it results in a conformational change wherein the donor and acceptor move apart (due to the ligand-induced dimer dissociation) and experience less FRET. Thus, the amount of target can be quantitatively determined as a function of energy transfer associated with dimer-monomer equilibrium. Alternatively, fusion proteins of the present invention can be used to qualitatively determine the presence or absence of a target from a sample.
[0069] In one preferred embodiment, the biosensor of the present invention comprises at least the following three components: (1) a receptor protein such as a full or truncated LuxP; (2) a donor mTurquoise2 (Tq, the ‘cyan emitting’ mutant variant of GFP from Aequorea victoria); and (3) an acceptor mNeonGreen (NG, the monomeric mutant variant of the green fluorescent protein derived from the Branchiostoma lanceolatum). More particularly, the truncated LuxP binding moiety, which encompasses amino acids Δ24-365 of the LuxP protein, is bound to the Tq and NG components so that it holds Tq and NG in close proximity. This embodiment can also include one or more linkers that serve to tether Tq and NG to the truncated LuxP. Still more particularly, LuxP holds Tq and NG in close enough proximity for them to experience FRET. When the truncated LuxP protein binds to AI-2, it results in a conformational change causing dissociation of TqLPNG dimers present and yielding. Thus, the amount of AI-2 can be quantitatively determined as a function of energy transfer associated with a change in dimer-monomer equilibrium.
[0070] A fusion protein, read from the N to C terminus, may be made from Tq, truncated LuxP, and NG as shown in
[0071] According to well known methods, the foregoing concentration dependent FRET effect can be used to determine the amount of, in one preferred embodiment, a QS molecule such as a BAI-2 ligand, or other analyte. For instance, in one preferred embodiment, a calibration curve can be constructed by running a series of samples containing known amounts of BAI-2. Unknown concentrations can then be determined by comparison to the calibration curve.
[0072] In one embodiment the biosensor of the present invention may be used to monitor the state of an infection. In this embodiment, higher concentrations of BAI-2 generally infer the presence of larger the level of infectious pathogens. Thus, the state of infection is monitored as a function of the amount of infectious cells and/or the concentration of QS molecules in a sample, cell or a target environment. In another embodiment the present invention is used to monitor the level of QS compounds in various medical devices. According to this embodiment, higher bacterial levels result in higher QS compound levels, which can result in bacterial biofilm formation in the device and ultimately infection in the patient. Therefore, in this embodiment the present invention is used to detect the need for remedial measures, and/or check their effectiveness. In a still further embodiment, the present invention is used to identify molecular mimics of QS compounds. This embodiment can be useful in drug discovery screening protocols for drug candidates. For instance, some pharmaceutically relevant mimics of QS compounds may bind with the biosensor of the present invention.
[0073] “Fluorescent protein” refers to any protein capable of emitting light when excited with appropriate electromagnetic radiation. Fluorescent proteins include proteins having amino acid sequences that are either natural or engineered, such as the fluorescent proteins derived from Aequorea- or Branchiostoma-related fluorescent proteins.
[0074] As used herein when generally describing FRET, the “donor” or “donor moiety” or “donor protein” and the “acceptor” or “acceptor moiety” or “acceptor protein” are selected so that the donor and acceptor moieties exhibit fluorescence resonance energy transfer when the donor moiety is excited. One factor to be considered in choosing the donor/acceptor fluorescent protein moiety pair is the efficiency of FRET between the two moieties. Preferably, the efficiency of FRET between the donor and acceptor moieties is at least 10%, more preferably at least 50%, more preferably at least 80%, and more preferably at least 90% or more. The efficiency of FRET can be tested empirically using the methods described herein and known in the art, particularly, using the conditions set forth in the Examples.
[0075] “Binding protein” or “binding domain” or “binding moiety” refers to a protein or protein fragment capable of binding an analyte or ligand. Preferred binding proteins change conformation upon binding the analyte or ligand. “Analyte” or ligand refers to a molecule or ion that binds to the binding protein or domain, causing it to change conformation. Preferably, the analyte or ligand binds reversibly to the binding protein or domain.
[0076] “Moiety” refers to a radical of a molecule that is attached to another radical of the indicator. Thus, a “fluorescent protein moiety” is the radical of a fluorescent protein coupled to a binding protein moiety or a linker moiety, a “binding protein moiety” is a radical of a binding protein coupled to a fluorescent protein moiety, a “target peptide moiety” is a radical of a target peptide of the binding protein, and a “linker moiety” refers to the radical of a molecular linker that is ultimately coupled to both the donor and acceptor fluorescent protein moieties.
[0077] The term “sequence identity” or “identity,” as used herein in the context of two nucleic acid or polypeptide sequences, refers to the residues in the two sequences that are the same when aligned for maximum correspondence over a specified comparison window.
[0078] As used herein, the term “homologous” with regard to a contiguous nucleic acid sequence, refers to contiguous nucleotide sequences that hybridize under appropriate conditions to the reference nucleic acid sequence. For example, homologous sequences may have from about 70%-100, or more generally 80% to 100% sequence identity, such as about 81%; about 82%; about 83%; about 84%; about 85%; about 86%; about 87%; about 88%; about 89%; about 90%; about 91%; about 92%; about 93%; about 94% about 95%; about 96%; about 97%; about 98%; about 98.5%; about 99%; about 99.5%; and about 100%. The property of substantial homology is closely related to specific hybridization. For example, a nucleic acid molecule is specifically hybridizable when there is a sufficient degree of complementarity to avoid non-specific binding of the nucleic acid to non-target sequences under conditions where specific binding is desired, for example, under stringent hybridization conditions.
[0079] The term, “operably linked,” when used in reference to a regulatory sequence and a coding sequence, means that the regulatory sequence affects the expression of the linked coding sequence. “Regulatory sequences,” or “control elements,” refer to nucleotide sequences that influence the timing and level/amount of transcription, RNA processing or stability, or translation of the associated coding sequence. Regulatory sequences may include promoters; translation leader sequences; introns; enhancers; stem-loop structures; repressor binding sequences; termination sequences; polyadenylation recognition sequences; etc. Particular regulatory sequences may be located upstream and/or downstream of a coding sequence operably linked thereto. Also, particular regulatory sequences operably linked to a coding sequence may be located on the associated complementary strand of a double-stranded nucleic acid molecule.
[0080] As used herein, the term “promoter” refers to a region of DNA that may be upstream from the start of transcription, and that may be involved in recognition and binding of RNA polymerase and other proteins to initiate transcription. A promoter may be operably linked to a coding sequence for expression in a cell, or a promoter may be operably linked to a nucleotide sequence encoding a signal sequence which may be operably linked to a coding sequence for expression in a cell. A “plant promoter” may be a promoter capable of initiating transcription in plant cells. Examples of promoters under developmental control include promoters that preferentially initiate transcription in certain tissues, such as leaves, roots, seeds, fibers, xylem vessels, tracheids, or sclerenchyma. Such promoters are referred to as “tissue-preferred.” Promoters which initiate transcription only in certain tissues are referred to as “tissue-specific.”
[0081] A “cell type-specific” promoter primarily drives expression in certain cell types in one or more organs, for example, vascular cells in roots or leaves. An “inducible” promoter may be a promoter which may be under environmental control. Examples of environmental conditions that may initiate transcription by inducible promoters include anaerobic conditions and the presence of light. Tissue-specific, tissue-preferred, cell type specific, and inducible promoters constitute the class of “non-constitutive” promoters. A “constitutive” promoter is a promoter which may be active under most environmental conditions or in most cell or tissue types.
[0082] Any inducible promoter can be used in some embodiments of the invention. See Ward et al. (1993) Plant Mol. Biol. 22:361-366. With an inducible promoter, the rate of transcription increases in response to an inducing agent. Exemplary inducible promoters include, but are not limited to: Promoters from the ACEI system that responds to copper; In2 gene from maize that responds to benzenesulfonamide herbicide safeners; Tet repressor from Tn10; and the inducible promoter from a steroid hormone gene, the transcriptional activity of which may be induced by a glucocorticosteroid hormone are general examples (Schena et al. (1991) Proc. Natl. Acad. Sci. USA 88:0421).
[0083] As used herein, the term “transformation” or “genetically modified” refers to the transfer of one or more nucleic acid molecule(s) into a cell. A plant is “transformed” or “genetically modified” by a nucleic acid molecule transduced into the plant when the nucleic acid molecule becomes stably replicated by the plant. As used herein, the term “transformation” or “genetically modified” encompasses all techniques by which a nucleic acid molecule can be introduced into, such as a plant.
[0084] The term “vector” refers to some means by which DNA, RNA, a protein, or polypeptide can be introduced into a host, which may be a prokaryotic cell, such as bacteria, or a eukaryotic, such as a yeast or even animal cell. The polynucleotides, protein, and polypeptide which are to be introduced into a host can be therapeutic or prophylactic in nature; can encode or be an antigen; can be regulatory in nature, etc. There are various types of vectors including virus, plasmid, bacteriophages, cosmids, and bacteria.
[0085] As is known in the art, different organisms preferentially utilize different codons for generating polypeptides. Such “codon usage” preferences may be used in the design of nucleic acid molecules encoding the proteins and chimeras of the invention in order to optimize expression in a particular host cell system.
[0086] An “expression vector” is nucleic acid capable of replicating in a selected host cell or organism. An expression vector can replicate as an autonomous structure, or alternatively can integrate, in whole or in part, into the host cell chromosomes or the nucleic acids of an organelle, or it is used as a shuttle for delivering foreign DNA to cells, and thus replicate along with the host cell genome. Thus, an expression vector are polynucleotides capable of replicating in a selected host cell, organelle, or organism, e.g., a plasmid, virus, artificial chromosome, nucleic acid fragment, and for which certain genes on the expression vector (including genes of interest) are transcribed and translated into a polypeptide or protein within the cell, organelle or organism; or any suitable construct known in the art, which comprises an “expression cassette.” In contrast, as described in the examples herein, a “cassette” is a polynucleotide containing a section of an expression vector of this invention. The use of the cassettes assists in the assembly of the expression vectors. An expression vector is a replicon, such as plasmid, phage, virus, chimeric virus, or cosmid, and which contains the desired polynucleotide sequence operably linked to the expression control sequence(s).
[0087] A polynucleotide sequence is operably linked to an expression control sequence(s) (e.g., a promoter and, optionally, an enhancer) when the expression control sequence controls and regulates the transcription and/or translation of that polynucleotide sequence.
[0088] Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), the complementary (or complement) sequence, and the reverse complement sequence, as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (see e.g., Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)). Because of the degeneracy of nucleic acid codons, one can use various different polynucleotides to encode identical polypeptides. The table below contains information about which nucleic acid codons encode which amino acids.
TABLE-US-00001 Amino acid Nucleic acid codons Amino Acid Nucleic Acid Codons Ala/A GCT, GCC, GCA, GCG Arg/R CGT, CGC, CGA, CGG, AGA, AGG Asn/N AAT, AAC Asp/D GAT, GAC Cys/C TGT, TGC Gln/Q CAA, CAG Glu/E GAA, GAG Gly/G GGT, GGC, GGA, GGG His/H CAT, CAC Ile/I ATT, ATC, ATA Leu/L TTA, TTG, CTT, CTC, CTA, CTG Lys/K AAA, AAG Met/M ATG Phe/F TTT, TTC Pro/P CCT, CCC, CCA, CCG Ser/S TCT, TCC, TCA, TCG, AGT, AGC Thr/T ACT, ACC, ACA, ACG Trp/W TGG Tyr/Y TAT, TAC Val/V GTT, GTC, GTA, GTG
[0089] “Peptide” refers to a polymer in which the monomers are amino acid residues which are joined together through amide bonds, alternatively referred to as a polypeptide. A “single polypeptide” is a continuous peptide that constitutes the protein. When the amino acids are alpha-amino acids, either the L-optical isomer or the D-optical isomer can be used, the L-isomers being preferred. Additionally, unnatural amino acids such as beta-alanine, phenylglycine, and homoarginine are meant to be included. Commonly encountered amino acids which are not gene-encoded can also be used in the present invention, although preferred amino acids are those that are encodable.
[0090] In addition to the degenerate nature of the nucleotide codons which encode amino acids, alterations in a polynucleotide that result in the production of a chemically equivalent amino acid at a given site, but do not affect the functional properties of the encoded polypeptide, are well known in the art. “Conservative amino acid substitutions” are those substitutions that are predicted to interfere least with the properties of the reference polypeptide. In other words, conservative amino acid substitutions substantially conserve the structure and the function of the reference protein. Thus, a codon for the amino acid alanine, a hydrophobic amino acid, may be substituted by a codon encoding another less hydrophobic residue, such as glycine, or a more hydrophobic residue, such as valine, leucine, or isoleucine. Similarly, changes which result in substitution of one negatively charged residue for another, such as aspartic acid for glutamic acid, or one positively charged residue for another, such as lysine for arginine or histidine, can also be expected to produce a functionally equivalent protein or polypeptide.
[0091] As provided below, the table provides a list of exemplary conservative amino acid substitutions. Conservative amino acid substitutions generally maintain (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a beta sheet or alpha helical conformation, (b) the charge or hydrophobicity of the molecule at the site of the substitution, and/or (c) the bulk of the side chain.
TABLE-US-00002 Amino Acids and Conservative Substitutes Amino Acid Conservative Substitute Ala Gly, Ser Arg His, Lys Asn Asp, Gln, His Asp Asn, Glu Cys Ala, Ser Gln Asn, Glu, His Glu Asp, Gln, His Gly Ala His Asn, Arg, Gln, Glu Ile Leu, Val Leu Ile, Val Lys Arg, Gln, Glu Met Ile, Leu Phe His, Leu, Met, Trp, Tyr Ser Cys, Thr Thr Ser, Val Trp Phe, Tyr Tyr His, Phe, Trp Val Ile, Leu, Thr
[0092] Oligonucleotides and polynucleotides that are not commercially available can be chemically synthesized e.g., according to the solid phase phosphoramidite triester method first described by Beaucage and Caruthers, Tetrahedron Letts. 22:1859-1862 (1981), or using an automated synthesizer, as described in Van Devanter et al., Nucleic Acids Res. 12:6159-6168 (1984). Other methods for synthesizing oligonucleotides and polynucleotides are known in the art. Purification of oligonucleotides is done using either native acrylamide gel electrophoresis or by anion-exchange HPLC as described in Pearson & Reanier, J. Chrom. 255:137-149 (1983). Additional methods are known by those of ordinary skill in the art.
[0093] The term “expression,” as used herein, or “expression of a coding sequence” (for example, a gene or a transgene) refers to the process by which the coded information of a nucleic acid transcriptional unit (including, e.g., genomic DNA or cDNA) is converted into an operational, non-operational, or structural part of a cell, often including the synthesis of a protein. Gene expression can be influenced by external signals; for example, exposure of a cell, tissue, or organism to an agent that increases or decreases gene expression. Expression of a gene can also be regulated anywhere in the pathway from DNA to RNA to protein. Regulation of gene expression occurs, for example, through controls acting on transcription, translation, RNA transport and processing, degradation of intermediary molecules such as mRNA, or through activation, inactivation, compartmentalization, or degradation of specific protein molecules after they have been made, or by combinations thereof. Gene expression can be measured at the RNA level or the protein level by any method known in the art, including, without limitation, Northern blot, RT-PCR, Western blot, or in vitro, in situ, or in vivo protein activity assay(s).
[0094] The term “nucleic acid” or “nucleic acid molecules” include single- and double-stranded forms of DNA; single-stranded forms of RNA; and double-stranded forms of RNA (dsRNA). The term “nucleotide sequence” or “nucleic acid sequence” refers to both the sense and antisense strands of a nucleic acid as either individual single strands or in the duplex. The term “ribonucleic acid” (RNA) is inclusive of iRNA (inhibitory RNA), dsRNA (double stranded RNA), siRNA (small interfering RNA), mRNA (messenger RNA), miRNA (micro-RNA), hpRNA (hairpin RNA), tRNA (transfer RNA), whether charged or discharged with a corresponding acylated amino acid), and cRNA (complementary RNA). The term “deoxyribonucleic acid” (DNA) is inclusive of cDNA, genomic DNA, and DNA-RNA hybrids. The terms “nucleic acid segment” and “nucleotide sequence segment,” or more generally “segment,” will be understood by those in the art as a functional term that includes both genomic sequences, ribosomal RNA sequences, transfer RNA sequences, messenger RNA sequences, operon sequences, and smaller engineered nucleotide sequences that encoded or may be adapted to encode, peptides, polypeptides, or proteins.
[0095] The term “gene” or “sequence” refers to a coding region operably joined to appropriate regulatory sequences capable of regulating the expression of the gene product (e.g., a polypeptide or a functional RNA) in some manner. A gene includes untranslated regulatory regions of DNA (e.g., promoters, enhancers, repressors, etc.) preceding (up-stream) and following (down-stream) the coding region (open reading frame, ORF) as well as, where applicable, intervening sequences (i.e., introns) between individual coding regions (i.e., exons). The term “structural gene” as used herein is intended to mean a DNA sequence that is transcribed into mRNA which is then translated into a sequence of amino acids characteristic of a specific polypeptide.
[0096] A nucleic acid molecule may include either or both naturally occurring and modified nucleotides linked together by naturally occurring and/or non-naturally occurring nucleotide linkages. Nucleic acid molecules may be modified chemically or biochemically, or may contain non-natural or derivatized nucleotide bases, as will be readily appreciated by those of skill in the art. Such modifications include, for example, labels, methylation, substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications (e.g., uncharged linkages: for example, methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.; charged linkages: for example, phosphorothioates, phosphorodithioates, etc.; pendent moieties: for example, peptides; intercalators: for example, acridine, psoralen, etc.; chelators; alkylators; and modified linkages: for example, alpha anomeric nucleic acids, etc.). The term “nucleic acid molecule” also includes any topological conformation, including single-stranded, double-stranded, partially duplexed, triplexed, hair-pinned, circular, and padlocked conformations.
[0097] As used herein with respect to DNA, the term “coding sequence,” “structural nucleotide sequence,” or “structural nucleic acid molecule” refers to a nucleotide sequence that is ultimately translated into a polypeptide, via transcription and mRNA, when placed under the control of appropriate regulatory sequences. With respect to RNA, the term “coding sequence” refers to a nucleotide sequence that is translated into a peptide, polypeptide, or protein. The boundaries of a coding sequence are determined by a translation start codon at the 5′-terminus and a translation stop codon at the 3′-terminus. Coding sequences include, but are not limited to: genomic DNA; cDNA; EST; and recombinant nucleotide sequences.
[0098] The term “sequence identity” or “identity,” as used herein in the context of two nucleic acid or polypeptide sequences, refers to the residues in the two sequences that are the same when aligned for maximum correspondence over a specified comparison window.
[0099] The term “recombinant” when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, organism, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein, or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, for example, recombinant cells may express genes that are not found within the native (nonrecombinant or wild-type) form of the cell or express native genes that are otherwise abnormally expressed—over-expressed, under expressed or not expressed at all.
[0100] As used herein, a compound is referred to as “isolated” when it has been separated from at least one component with which it is naturally associated. For example, a metabolite can be considered isolated if it is separated from contaminants including polypeptides, polynucleotides and other metabolites. Isolated molecules can be either prepared synthetically or purified from their natural environment. Standard quantification methodologies known in the art can be employed to obtain and isolate the molecules of the invention.
[0101] The terms “approximately” and “about” refer to a quantity, level, value or amount that varies by as much as 30%, or in another embodiment by as much as 20%, and in a third embodiment by as much as 10% to a reference quantity, level, value or amount. As used herein, the singular form “a,” “an,” and “the” include plural references unless the context clearly dictates otherwise.
[0102] The invention now being generally described will be more readily understood by reference to the following examples, which are included merely for the purposes of illustration of certain aspects of the embodiments of the present invention. The examples are not intended to limit the invention, as one of skill in the art would recognize from the above teachings and the following examples that other techniques and methods can satisfy the claims and can be employed without departing from the scope of the claimed invention. Indeed, while this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.
EXAMPLES
Example 1: FRET-Based TqLPNG Biosensor Protein Configuration and Signal Strategy
[0103] In one embodiment the biosensing fusion protein of the present invention is constructed according to the following. LuxP protein is conserved in several Vibrio species. A BLASTP search (www.ncbi.nlm.nih.gov/BLAST/) using the V harveyi LuxP protein revealed the presence of LuxP in a variety of related organisms, such as V harveyi, V. parahaemolyticus, V. vulnificus V. cholerae, and V. anguillarum. Multiple sequence alignment of LuxP sequences reveals a highly conserved amino acid sequences and BAI-2 binding residues as shown in
[0104] In one preferred embodiment of the current inventive technology, the present inventors designed a novel TqLPNG biosensor as a tripartite fluorescent ratiometric sensor protein. The core of the TqLPNG biosensor is the N-terminus truncated (amino acids 24-365) LuxP periplasmic BAI-2 receptor from Vibrio harveyi, which undergoes large structural transition upon BAI-2 binding (See
[0105] In this preferred embodiment, the present inventor's choice of Tq and NG as the donor (D) and the acceptor (A) FRET pair for the D-LP-A biosensor was based on the following enhanced properties of these fluorescent proteins (see generally
[0106] Detection of BAI-2 by TqLPNG biosensor is based on the translation of the structural changes in LP receptor (upon BAI-2 binding) into the changes of the fluorescence spectra of its Tq and NG moieties. Specifically, under the solution conditions recommended by the inventors, a fraction of the biosensor is in the dimeric state. The changes in LP upon the BAI-2 binding causes dissociation of the TqLPNG into monomers, which is followed by the change in TqLPNG fluorescence emission spectrum. In more details, at the excited state, the fluorescent chromophore of Tq interacts with the non-excited chromophore of the NG moiety, resulting in non-radiative transfer of the excitation energy from the Tq chromophore (the donor) to the non-excited NG chromophore (the acceptor). The resulting FRET causes the distance-dependent quenching of the Tq-donor emission and concomitant enhancement of the NG-acceptor emission in the individual (monomeric) TqLPNG molecule. In the case of TqLPNG dimer, the Tq-donor features an extra quenching, and the NG-acceptor features an extra enhancement in their fluorescence emission (as compared to monomeric TqLPNG) due to the FRET from excited Tq-donor chromophore in one molecule to the non-excited NG-acceptor chromophore in the other dimer molecule. As a result, the acceptor-to-donor emission ratio of the TqLPNG dimer is markedly higher than that for TqLPNG monomer. Noteworthy, BAI-2 binding to the monomeric TqLPNG is not accompanied by significant changes in the donor-acceptor distance, thus yielding a small or no change in FRET, and an associated small change in the acceptor-to-donor emission ratio for the monomeric biosensor. Thus, the presence of a fraction of TqLPNG in the dimeric form may be especially useful for sensing of BAI-2 molecules. Furthermore, it is the fraction of dimeric TqLPNG that determines the biosensor emission response (or, in other words, amplitude) upon the BAI-2 binding (expressed as the decrease in the acceptor-to-donor emission ratio, corresponding to the fully saturated TqLPNG). In summary, the basis (modus operandi) of BAI-2 quantification is BAI-2 concentration dependent dissociation of TqLPNG dimers detected through the corresponding decrease in the biosensor acceptor-to-donor emission ratio (
[0107] Accordingly, the present invention includes a biosensor fusion protein, wherein the protein is capable of producing a signal that is substantially time independent. Furthermore, time independence can be achieved in any of a wide variety of ways including, without limitation, aging, temperature treatment, sonication, absorption of electromagnetic radiation (e.g., infrared or microwave), and any combination thereof.
Example 2: Biosensor Expression and Purification
[0108] In one preferred embodiment, the TqLPNG biosensor was expressed in E. coli BL21 (DE 3) (luxS.sup.−) cells transformed with pET21-TqLPNGh, coding for the TqLPNG containing the His.sub.6-affinity tag at the C-terminus of the protein fusion construct, TqLPNGh (
[0109] The choice of His.sub.6-extension at the C-terminus of the TqLPNG facilitated TqLPNG purification and enabled to use specific affinity chromatography (on Talon Metal Affinity resin) which yielded efficient purification at the very first purification step (see
[0110] Further purification of TqLPNGh through hydrophobic interaction chromatography (HIC) on HiTrap HP Butyl column yielded nearly homogeneous biosensor preparation (
[0111] Absorbance and fluorescent emission spectra of the purified TqLPNGh biosensor are presented in
[0112] Notably, the presence of sufficiently high concentration of NaCl (i.e., 0.3 M) in all buffers used for TqLPNGh purification (and storage, especially) is very important, since it prevents accumulation of high order TqLPNG associates.
Example 3: Mechanism of TqLPNG Action as a Biosensor for BAI-2
[0113] TqLPNG fluorescence response towards BAI-2 binding was examined at different concentrations of NaCl (see
[0114] The nature of the above noted strong salt dependence in the observable binding amplitude was clarified by simultaneous measurements of ligand-free TqLPNG fluorescence emission spectra. The experimental data on ligand-free TqLPNG are summarized in the
[0115] Based on the above experiments, the inventors propose the following simplified model for the TqLPNG emission response towards BAI-2 binding schematically shown in
Example 4: FRET Based BAI-2 Bioassay
[0116] The reasonable question that follows deciphering the origin of the TqLPNG fluorescence emission response towards BAI-2 binding is to understand the optimal conditions for the biosensor-based determination of BAI-2 concentrations. Low NaCl conditions provide an increased change in acceptor-to-donor emission ratio for the BAI-2 binding favorable for accurate BAI-2 quantification. However, prolonged storage of TqLPNG in low salt buffer (even at low temperature, i.e., 4° C.) yields accumulation of high-order TqLPNG associates which do not respond to BAI-2 binding (most likely due to enhanced stability of high order associates towards dissociation) (see
[0117] To verify the suitability of purified TqLPNGh as biosensor and the suggested assay conditions (i.e., the optimal NaCl concentration), the present inventors evaluated the effect of BAI-2 on the biosensor emission spectrum in 50 mM HEPES (pH 7.5)/0.4 mM boric acid/0.1 mM EDTA buffer containing 0.15 M NaCl. They found that titration of TqLPNGh solution with increasing BAI-2 concentrations was accompanied by an enhancement in donor fluorescence intensity and corresponding quenching of the acceptor component of the TqLPNGh fluorescence emission spectrum. Opposite changes in fluorescent intensity of D and A result in decrease of the acceptor-to-donor emission ratio (see
[0118] To determine the sensitivity of the suggested TqLPNG-based BAI-2 assay, the present inventors determined both BAI-2 concentration corresponding to the half-transition (C.sub.50%) in the TqLPNG emission response under the suggested assay conditions (50 nM TqLPNG, 50 mM HEPES (pH 7.5)/0.1 mM EDTA/0.15 M NaCl buffer containing 0.4 mM boric acid) and the BAI-2•TqLPNG dissociation constant under the suggested assay conditions (i.e., 50 nM TqLPNG, 50 mM HEPES (pH 7.5)/0.1 mM EDTA/0.15 M NaCl buffer containing 0.4 mM boric acid) (see
Example 5: Molecular Modeling of the TqLPNG Biosensor
[0119] To investigate the molecular mechanisms of function for the TqLPNG biosensor, a computational technique called protein-protein docking was used to build a molecular model of this protein construct. The main questions addressed using this approach are whether either or both fluorescent proteins (FPs) form a complex with LuxP in this biosensor, and whether these complex/es are driven mainly by salt-bridge and other polar contacts. Docking of the two FPs to LuxP suggested that both make a tight complex with separate lobes of LuxP (
[0120] The predicted distance between the center of masses (COMs) of the fluorophores from both FPs is around 60.6 Ain the molecular model containing ligand-free LuxP (black dashed line in
[0121] Because of the observed salt-dependent formation of dimers in experiments, protein-protein docking was used to investigate the molecular mechanism leading to this dimer formation. Since monomer-inducing mutations are present in both FPs, the focus here was on the possible homodimerization of LuxP. Docking of two LuxP molecules suggested that a tight symmetric homodimer interface is formed between the N-terminal lobes (
[0122] The structural model for the TqLPNG biosensor dimer is given in
[0123] As highlighted in
Example 6: Experimental Material and Methods
[0124] Materials
[0125] (4S)-4,5-Dihydroxy-2,3-pentadion (DPD) known as autoinduer-2 (AI-2) was purchased from Omm Scientific (Texas) as 4.47 mM solution in 0.5 mM NaHSO.sub.4 (pH 1.56) and stored frozen at −80° C. unless required.
[0126] Strains and Plasmids Design and Construction
[0127] All the strains and plasmids used in this invention are listed below in Table 1. All plasmids were made by GENESCRIPT (NJ, USA) although any generic bacterial plasmid may be substituted for the expression of the biosensor protein. As generally shown in
[0128] As generally shown in
[0129] As generally shown in
[0130] As generally shown in
[0131] Protein Expression
[0132] In one preferred embodiment, E. coli BL21 (DE 3) (luxS.sup.−) were transformed with the pET21-TqLPNGh plasmid by using home-made electrocompetent cells and a standard protocol (Maniatis et al., 1982). 1 μL of 10 ng/μl plasmid was added to 50 μL suspension of competent cells. Following the transformation and post-transformation growing of the cells in 1 mL SOC medium, the cells were plated onto LB-agar plate (containing carbenicillin 50 mg/L) and incubated at 37° C. for 16 h. Next day, bacterial colonies from the LB-agar plate were washed out from the plates using 10 mL LB, and the wash was used for inoculation of 0.5 L LB-carbenicillin medium (in 2 L conical flask). The culture was grown at 28° C. with aeration (200 rpm) till OD600˜ 0.6, and then transferred into a refrigerated shaker at 21° C. (200 rpm) for about 40 min to cool it down prior to induction with 1 mM IPTG. Following IPTG addition, the culture was further grown at 21° C. for 20 h, and then transferred to the cold room at 4° C.) for 4 h with periodic agitation (one per hour) to facilitate its saturation with air oxygen. The cells were collected by (3,200 g×15 min, 4° C.)-centrifugation, transferred to the 50 mL Falcon tube, and stored at −80° C. until needed. Typically, ˜3.4 g of wet cell pellet was collected from the 0.45 L culture.
[0133] Protein Purification
[0134] In preferred embodiment, buffer solutions used for the protein purification contained an EDTA-free protease inhibitor cocktail (Roche, Germany) at concentrations according to the manufacturer recommendations. All protein purifications steps were performed at 4° C. A portion of the frozen cells was thawed on ice for ˜2 hrs, and re-suspended with 30 mL of 50 mM HEPES-NaOH (pH 7.5) buffer, containing 0.3 M NaCl and 5 mM mercaptoethanol (ME) (the HS300 buffer). The cells were disrupted by sonication while keeping the cell suspension in the ice-water mix. To obtain the soluble fraction, disrupted cells were centrifuged at 30,000 g for 1 h. The supernatant (31 mL) was loaded onto 5 mL Talon Metal Affinity resin (Clontech) packed into the plastic gravity column and equilibrated with the binding buffer (HS300+5 mM ME). The flow-through fraction containing the unbound species was collected for further SDS-PAGE analysis, and the resin was washed with 40 mL HS300+5 mM ME buffer. Next, the resin was washed with ˜20 mL HS300+0.5 M NaCl+5 mM ME, and then with ˜30 mL HS300+10 mM imidazole-HCl (pH 7.5). No fluorescent protein species were detected in the washes. Finally, the bound proteins were eluted with HS300+200 mM imidazole-HCl (pH 7.5). The eluate was fractionated into five fractions—Fr. 1 (the first 0.45 mL eluate), Fr. 2 (further 3.1 mL of the eluate), Fr. 3 (2.1 mL), Fr. 4 (1.6 mL) and Fr. 5 (the last 1.8 mL of the eluate). The eluted fractions were supplemented with 1 mM EDTA (to inhibit metal-dependent proteases), and analyzed by PAGE/SDS. The less contaminated fractions (Fr. 1 through Fr.3 containing about 27 mG TqLPNGh) were combined and used for further TqLPNGh purification. The combined TqLPNGh solution was exchanged into HS300 buffer containing 0.1 mM EDTA and 0.25 mM DTT (HS300eD) using two 10 mL Econo-Pac 10 DG columns (Bio-Rad) equilibrated in HS300eD. The exchanged TqLPNGh (˜7 mL) was precipitated by mixing with 10 mL saturated ammonium sulfate (AS) till 2.35 M AS (as final concentration). The AS suspension were equally distributed among 151.5 mL-Eppendorf tubes, and the protein was collected by (21,000 g×15 min, 4° C.)-centrifugation. The protein precipitate was re-dissolved in ˜15 mL 50 mM Tris-HCl (pH 7.5)/0.6 M AS/0.1 mM EDTA/0.5 mM DTT (i.e., ˜1 mL per each tube), clarified by (21,000 g×10 min, 4° C.)-centrifugation, and applied for further purification through hydrophobic interaction chromatography (HIC) on 5 mL HiTrap HP Butyl column (GE Healthcare Life Sciences). To avoid overloading, about ⅓ of the clarified TqLPNGh solution (corresponding to 8-9 mG TqLPNGh) was loaded onto the column equilibrated with the 50 mM Tris-HCl (pH 7.5)/0.7 M AS/0.1 mM EDTA/0.5 mM DTT buffer (the binding buffer). Following the column wash with ˜25 mL binding buffer, the bound protein species were eluted with linear gradient of the ammonium-free buffer containing 0.3 M NaCl, i.e., with 50 mM Tris-HCl (pH 7.5)/0.3 M NaCl/0.1 mM EDTA/0.5 mM DTT using 1 mL/min flow rate. The eluate was fractionated in 2.5 mL portions, and analyzed through absorbance spectrum measurements and SDS-PAGE.
[0135] The less contaminated fractions from the three HIC runs were combined (˜40 mL), and mixed with 5.7 mL 50 mM HEPES (pH 7.3)/80% (v/v) glycerol/1 mM EDTA to get 10% (v/v) glycerol as final concentration prior to concentration TqLPNGh solution on 30 kDa cutoff membrane (i.e., on Ultra 15 centrifugal unit, 30 kDa cutoff membrane, Millipore). The TqLPNGh solution was exhaustively exchanged into the 50 mM HEPES (pH 7.3)/0.6 M NaCl/10% (v/v) glycerol/0.1 mM EDTA/0.5 mM TCEP/1 mM DTT on the centrifugal unit by using multiple concentration-dilution steps. ˜1.9 mL exchanged/concentrated TqLPNGh solution was mixed with 2.53 mM 50 mM HEPES (pH 7.3)/1 mM EDTA/80% (v/v) glycerol to get 50% (v/v) glycerol at the final concentration of glycerol for further storage of the TqLPNGh at −20° C. The final buffer composition for TqLPNGh storage was 50 mM HEPES (pH 7.3)/0.3 M NaCl/50% (v/v) glycerol/˜0.6 mM EDTA/0.21 mM TCEP/0.42 mM DTT. The final storage concentration of TqLPNGh (as judged from absorbance spectrum of its diluted solution) was 44.6 μM.
[0136] The partial purification of the hTqLPNG on Talon Metal Affinity resin was performed as described for the TqLPNGh construct and as generally described above.
[0137] Individual fluorescent proteins, mTurquoise2 and mNeonGreen, and LuxP-NGh fusion were expressed in E. coli BL21 (DE 3) (luxS.sup.−) transformed with appropriate plasmids (pET21-Tqh, pET21-NGh or pET21-LPNGh, respectively). Preparation of cells for protein purification was performed in the same way as described above for the purification of the TqLPNG biosensor. Due to the high level of the protein expression for each protein (which were 200-250 mG/L of the cell culture), purification included affinity chromatography on Talon resin (which was very similar as that described for TqLPNGh purification) and size exclusion chromatography on Superdex 200 (GE Healthcare Life Sciences).
[0138] General Spectroscopic Measurements
[0139] A Cary 300 spectrophotometer (Agilent/Varian Technologies) and FluoroMax fluorescence spectrophotometer (Horiba Scientific) equipped with Peltier-based temperature controlled cell holders were used for absorbance and fluorescence measurements, respectively. To characterize fluorescent proteins, all measurements (including TqLPNGh titration with BAI-2) were performed at 20° C. with proteins prepared in 50 mM HEPES buffer (pH 7.5)/0.1 mM EDTA, containing different NaCl concentrations. Fluorescence emission spectra were recorded in a 4 mm fluorescence cell by using 2 nm slit width at both excitation and emission monochromators. Typically, 50 nM protein concentrations were employed for fluorescence measurements. The protein stock solutions were prepared in 50 mM HEPES buffer (pH 7.5)/0.1 mM EDTA/0.3 M NaCl at 2 μM (for the TqLPNG) or 10 μM (for Tqh or NGh) concentration. The protein concentrations were determined based on absorption measurements, and the published values of the molar extinction coefficients—ε.sub.434 nm=30,000 M.sup.−1 cm.sup.−1 and ε.sub.505 nm=116,000 M.sup.−1 cm.sup.−1 for mTurquoise2 (Goedhart et al., 2012) and mNeonGreen Shaner et al., 2013), respectively. Due to negligible absorption of mTurquoise2 at 505 nm, the protein concentration for TqLPNGh biosensor was determined by using molar extinction of mNeonGreen.
[0140] Forster Distances and Evaluation for the FRET Efficiency in TqLPNG
[0141] The Förster distance (R.sub.0)—is the important characteristic of the donor-acceptor FRET pair which can be phenomenologically determined as the donor-to-acceptor distance (R) at which 50% excited donor molecules are deactivated through the FRET mechanism, so that FRET efficiency (E) equals 0.5 (Van der Meer et al., 1994). Thus, the Förster distance determines sensitivity of donor-acceptor resonance coupling:
E=R.sub.0.sup.6/(R.sub.0.sup.6+R.sup.6)
The Förster distance can be determined as:
R.sub.0=0.211×(κ2×n−4×Q.sub.D×J.sub.DA).sup.1/6(in Å)
where κ.sup.2—is the orientation factor between the donor emission transition dipole moment and the acceptor absorbance transition dipole moment; n—is the refractive index (taken from the tabulated data available for water solutions of NaCl); Q.sub.D—is the mTurquoise2-donor quantum yield [taken as 0.93 from the reported data—Merola et al. (2014)]; and J.sub.DA—is the overlap integral between the donor fluorescence emission F.sub.D(λ) spectrum and the acceptor absorption ε.sub.A(λ) spectrum (in units of molar extinction, M.sup.−1 cm.sup.−1): J.sub.DA=Σ F.sub.D(λ)ε.sub.A(λ)λ.sup.4Δλ/Σ F.sub.D(λ)Δλ.
[0142] To calculate R.sub.0-values for Tq-NG donor-acceptor pair corresponding to different salt conditions, Tq-donor fluorescence emission (corrected to the spectral sensitivity of the emission detector) and NG-acceptor absorption spectra were measured in the 50 mM HEPES (pH 7.5)/0.1 mM EDTA buffer containing different concentrations of NaCl (0, 0.15, 0.30 and 0.60 M). Although both the donor emission and the acceptor absorption featured a small red shift [which did not exceed 1 nm in the case of the donor emission spectra, and was about 2 nm in the case of the acceptor absorption spectra] when increasing the salt concentration, both the donor quantum yield, the overlap integral and R0-values were practically unaffected by NaCl (see Table 3).
[0143] FRET efficiency in TqLPNG was determined under variety of solution conditions by measurements of the emission spectra of TqLPNG (DA-species) alternatively excited at 440 nm and 505 nm. The first wavelength, 440 nm, corresponds to the excitation of the Tq-donor, and, therefore, to the conditions for FRET to occur. The second wavelength, 505 nm, is the wavelength for the selective excitation of NG-acceptor (at which no excitation of the donor happens due to the absence of the donor absorption at 500 nm or larger). Emission spectrum of acceptor at 505 nm, A-DA (λ,λ.sub.A), is required for determination the acceptor emission directly excited at 440 nm, dirA-DA (λ, λ.sub.D), which is in turn necessary for the determination of FRET efficiency (E.sub.FRET or simply, E). The dirA-DA (λ, λ.sub.D) spectrum can be easily determined from A-DA (λ,λ.sub.A) by taking into account the ratio for the excitation light intensity at 440 and 505 nm, I.sub.EX(λ.sub.D)/I.sub.EX(λ.sub.A), and the absorption ratio of the acceptor, ε.sub.A(λ.sub.D)/ε.sub.A(λ.sub.A):
dirA-DA(λ,λ.sub.D)=[I.sub.EX(λ.sub.D)/I.sub.EX(λ.sub.A)]×[ε.sub.A(λ.sub.D)/ε.sub.A(λ.sub.A)]×A-DA(λ,λ.sub.A),
where the excitation light intensity ratio, I.sub.EX(λ.sub.D)/I.sub.EX(λ.sub.A), is determined through the reading of the reference detector (corrected for the spectral sensitivity); and the acceptor absorption ratio, ε.sub.A(λ.sub.D)/ε.sub.A(λ.sub.A), is determined from the corrected excitation spectrum of A-species, which is NG-acceptor prepared under corresponding buffer conditions.
[0144] In general, emission spectrum of DA at the donor excitation, DA(λ, λ.sub.D) [or simply DA(λ)] consists of the donor emission component, DC-DA(λ), and the acceptor emission component, AC-DA(λ):
DA(λ)=DC-DA(λ)+AC-DA(λ)
[0145] Both the donor and acceptor emission are affected by FRET—the donor emission in DA is quenched as compared with the donor emission in the absence of FRET [i.e., in the absence of the acceptor], while the acceptor emission is enhanced [as compared with the directly excited acceptor emission, which is the acceptor emission in the absence of FRET, in the absence of the donor] due to extra excitation from FRET:
DC-DA(λ)=k I.sub.EX(λ.sub.D)ε.sub.Dc.sub.DA(1−E)Q.sub.DF.sub.D(λ)
[0146] AC-DA(λ)=dirA(λ)+A.sub.FRET(λ)=k I.sub.EX(λ.sub.D) ε.sub.A c.sub.DA Q.sub.A F.sub.A(λ)+k ε.sub.D E c.sub.DA Q.sub.A F.sub.A(λ), where k—is the geometric factor [which determines the fraction of the total emission detected]; ε.sub.D(λ.sub.EX) and ε.sub.A(λ.sub.EX)—are molar extinction of the donor and the acceptor, respectively; c.sub.DA—is the biosensor molar concentration; E—is the FRET efficiency; Q.sub.D and Q.sub.A—are the emission efficiency (aka quantum yield) of the donor and the acceptor, respectively; F.sub.D(λ) and F.sub.A(λ)—are the spectra [i.e., distribution of the emitted photons over emission wavelengths] of the donor and the acceptor, respectively.
[0147] The FRET efficiency can be determined as:
E=[AC-DA(λ)/dirA(λ)−1]/(ε.sub.D/ε.sub.A)
The acceptor emission component can be easily determined through subtraction of the donor emission component from the TqLPNG emission spectrum: AC-DA(λ)=DA(λ)−DC-DA(λ). The donor emission component is in turn determined from the emission spectrum donor in D-species, Tq-D(λ) [the so-called D.sub.ONLY-species], normalized to the emission intensity of the donor in DA:
DC-DA(λ)=F.sub.NORM×D-D(λ),
where normalization factor is calculated as an average of the constant level for DA(λ)/D(λ) corresponding to the initial spectral range of the donor emission (i.e., 450-480 nm), which does not have acceptor emission contribution. Thus, in the case of TqLPNG, deconvolution of its emission spectrum into the donor and the acceptor emission components is evident.
[0148] The donor-to-acceptor absorption ratio, ε.sub.D/ε.sub.A, at the donor excitation (i.e., at 440 nm) was calculated from the corrected excitation spectra of the donor and the acceptor (recorded for the Tq-D or NG-A species under appropriate buffer conditions), which were normalized at their excitation maximums to the values the their molar extinctions (30,000 and 116,000 M.sup.−1 cm.sup.−1, respectively). The validity of using excitation spectra for the determination of the donor-to-acceptor absorption ratio, ε.sub.D/ε.sub.A, as well as for the determination of the acceptor absorption ratio, ε.sub.A(λ.sub.D)/ε.sub.A(λ.sub.A), was proved by practical identity of the normalized excitation and absorption spectra for either Tq-D or NG-A species.
[0149] TqLPNG Biosensor Response for BAI-2 Binding
[0150] For measurements associated with examination of ligand-induced response of TqLPNG biosensor fluorescence emission 0.1 mM BAI-2 stock solution was freshly prepared and contained 1 mM DPD and 4 mM boric acid in 50 mM HEPES buffer (pH 7.5) (Semmelhack et al., 2005). To test the biosensor fluorescence response for BAI-2 binding 400 μL samples having the same biosensor concentration (50 nM) and variable BAI-2 concentrations in 50 mM HEPES (pH 7.5)/0.4 mM boric acid/0.1 mM EDTA/0.15 M NaCl were prepared from the protein and the ligand stock solutions using analytical balances. Fluorescence emission spectra were taken following 3 min temperature equilibration of the sample within the temperature controlled cell holder (set for 20° C.). Control experiments for photo-bleaching showed no changes in the fluorescence spectrum during three consecutive spectrum records. Control experiments for the Linker sequences were added to the corresponding domain termini, which were then fixed using the ModLoop server (Fiser et al., 2000; Fiser and Sali, 2003) to combine as a single protein construct. Computational estimates of the binding affinities at each interface, as well as quantification of the number of polar vs. nonpolar contacts at each interface, was done using the PRODIGY web server (Vangone and Bonvin 2015; Xue et al., 2016).
[0151] To generate a model of ligand-bound TqLPNG monomer, structural overlaps were done between ligand-free LuxP with the BAI-2-bound crystal structure of LuxP (PDB ID 1JX6) (Chen et al., 2002). In particular, the C-terminal lobes from both LuxP structures were structurally overlapped to get the position and orientation of mTurquoise2 in the ligand-bound model, and similarly a structural overlap of the N-terminal lobes from both LuxP structures gave the location of mNeonGreen. Domain termini and linker sequences were again fixed using ModLoop, followed by binding affinity estimates and interface contact analysis using PRODIGY.
[0152] Protein-Protein Docking for the LuxP Homodimer
[0153] Docking of two ligand-free LuxP molecules (PDB 1ZHH) or two ligand-bound LuxP molecules (PDB 1JX6) was performed using the same protocol as above with HADDOCK2.2. Binding affinity estimates and interface contact analysis of the top predicted poses were then performed using PRODIGY.
Tables
[0154]
TABLE-US-00003 TABLE 1 Pathogenic organisms that use BAI-2 for QS BACTERIA HOST/DISEASE Vibrio harveyi Fish and aquatic animals Vibrio parahaemolyticus (for example, Early Mortality Syndrome) Vibrio cholerae Humans (cholera) Salmonella ser. typhimurium Humans and Animals (food poisoning) E. coli H0157:H7 Humans (food poisoning) Helicobacter pylori Humans (ulcer) Streptococcus mutans Humans (infections)
TABLE-US-00004 TABLE 2 Bacterial strains and plasmids STRAINS GENOTYPE ORIGIN BL21 DE3 (luxS) ΔluxS Chen et al. (2002) BL21-TqLPNGh BL21 DE3 (luxS) transformed This invention with pET21-TqLPNGh BL21-Tqh BL21 DE3 (luxS) transformed This invention with pET21-Tqh BL21-NGh BL21 DE3 (luxS) transformed This invention with pET21-NGh PLASMID DESCRIPTION ORIGIN pET21a(+) Low copy plasmid vector for Novagen expression of proteins under the control of T7 promoter. Ap.sup.R pET21-TqLPNGh Plasmid for expression of bio This invention sensor protein pET21-Tqh Plasmid for expression of donor This invention fluorescent protein pET21-NGh Plasmid for expression of This invention acceptor fluorescent protein
TABLE-US-00005 TABLE 3 Förster distances for mTurquoise2-mNeonGreen donor-acceptor pair at different salt concentrations Overlap integral, Forster Buffer Refractive J.sub.DA (M.sup.−1 cm.sup.−1 distance, R.sub.0 composition index nm.sup.4 units) (Å) no salt 1.3330 2.9386 x 10.sup.15 60.88 0.15M NaCl 1.3345 2.9750 × 10.sup.15 60.96 0.30M NaCl 1.3360 2.9790 × 10.sup.15 60.93 0.60M NaCl 1.3390 2.9879 × 10.sup.15 60.87 The Förster distance for Tq-NG donor-acceptor pair were measured in 50 mM HEPES (pH 7.5)/0.1 mM EDTA buffer containing different concentration of NaCl (at 20° C.). mTurquoise2 quantum yield was taken as 0.93 [Merola et al. (2014)]. The value of the orientation factor was taken as 2/3.
REFERENCES
[0155] [1] Chen, X., S. Schauder, N. Potier, A. Van Dorsselaer, I. Pelczer, B. L. Bassler & F. M. Hughson, (2002) Structural identification of a bacterial quorum-sensing signal containing boron. Nature 415: 545-549. [0156] [2] Defoirdt, T., (2017) Quorum-Sensing Systems as Targets for Antivirulence Therapy. Trends Microbiol. [0157] [3] Goedhart, J., D. von Stetten, M. Noirclerc-Savoye, M. Lelimousin, L. Joosen, M. A. Hink, L. van Weeren, T. W. Gadella, Jr. & A. Royant, (2012) Structure-guided evolution of cyan fluorescent proteins towards a quantum yield of 93%. Nat Commun 3: 751. [0158] [4] Maniatis, T., E. F. Fritsch & J. Sambrook, (1982) Molecular cloning: a laboratory manual. Cold spring harbor laboratory Cold Spring Harbor, N.Y. [0159] [5] Merola, F., Fredj, A., Betolngar, D.-B., Ziegler C., Erard, M. & Pasquier H. (2014) Newly engineered cyan fluorescence proteins with enhanced performances for live cell FRET imaging. Biotechnol. J. 9: 180-191. [0160] [6] Neiditch, M. B., M. J. Federle, S. T. Miller, B. L. Bassler & F. M. Hughson, (2005) Regulation of LuxPQ receptor activity by the quorum-sensing signal autoinducer-2. Mol Cell 18: 507-518. [0161] [7] Pettersen, E. F., T. D. Goddard, C. C. Huang, G. S. Couch, D. M. Greenblatt, E. C. Meng & T. E. Ferrin, (2004) UCSF Chimera—a visualization system for exploratory research and analysis. J Comput Chem 25: 1605-1612. [0162] [8] Rajamani, S., J. Zhu, D. Pei & R. Sayre, (2007) A LuxP-FRET-Based Reporter for the Detection and Quantification of AI-2 Bacterial Quorum-Sensing Signal Compounds. Biochemistry 46: 3990-3997. [0163] [9] Raut, N., S. Joel, P. Pasini & S. Daunert, (2015) Bacterial autoinducer-2 detection via an engineered quorum sensing protein. Anal Chem 87: 2608-2614. [0164] [10] Semmelhack, M. F., S. R. Campagna, M. J. Federle & B. L. Bassler, (2005) An expeditious synthesis of DPD and boron binding studies. Org Lett 7: 569-572. [0165] [11] Shaner, N. C., G. G. Lambert, A. Chammas, Y. Ni, P. J. Cranfill, M. A. Baird, B. R. Sell, J. R. Allen, R. N. Day, M. Israelsson, M. W. Davidson & J. Wang, (2013) A bright monomeric green fluorescent protein derived from Branchiostoma lanceolatum. Nat Methods 10: 407-409. [0166] [12] Thompson, J. A., R. A. Oliveira, A. Djukovic, C. Ubeda & K. B. Xavier, (2015) Manipulation of the quorum sensing signal AI-2 affects the antibiotic-treated gut microbiota. Cell Rep 10: 1861-1871. [0167] [13] Van Der Meer, B. W., G. Coker & S.-Y. S. Chen, (1994) Resonance energy transfer: theory and data. Wiley-VCH. [0168] [14] Whiteley, M., S. P. Diggle & E. P. Greenberg, (2017) Progress in and promise of bacterial quorum sensing research. Nature 551: 313-320. [0169] [15] Zhu, J. & D. Pei, (2008) A LuxP-Based Fluorescent Sensor for Bacterial Autoinducer II. ACS Chem Biol 3: 110-119. [0170] [16] U.S. patent application Ser. No. 11/789,479 [0171] [17] U.S. Pat. No. 5,998,204 (expired) [0172] [18] U.S. Pat. No. 6,469,154 [0173] [19] Chen, X., S. Schauder, N. Potier, A. Van Dorsselaer, I. Pelczer, B. L. Bassler & F. M. Hughson, (2002) Structural identification of a bacterial quorum-sensing signal containing boron. Nature 415: 545-549. [0174] [20] Clavel, D., G. Gotthard, D. von Stetten, D. De Sanctis, H. Pasquier, G. G. Lambert, N. C. Shaner & A. Royant, (2016) Structural analysis of the bright monomeric yellow-green fluorescent protein mNeonGreen obtained by directed evolution. Acta Crystallogr D Struct Biol 72: 1298-1307. [0175] [21] de Vries S. J. & A. M. J. J. Bonvin, (2011) CPORT: a consensus interface predictor and its performance in predictoin-driven docking with HADDOCK. PLoS One 6: e17695. Dominguez, C., R. Boelens & A. M. J. J. Bonvin, (2003) HADDOCK: a protein-protein docking approach based on biochemical and/or biophysical information. J Am Chem Soc 125: 1731-1737. [0176] [22] Fiser, A., R. K. Do & A. Sali, (2000) Modeling of loops in protein structures. Protein Sci 9: 1753-1773. [0177] [23] Fiser, A. & A. Sali, (2003) ModLoop: automated modeling of loops in protein structures. Bioinformatics 19: 2500-2501.
TABLE-US-00006 SEQUENCE IDENTIFICATION DNA TqLPNGh biosensor protein Artificial SEQ ID NO: 1 CATATGGTATCAAAGGGTGAAGAACTTTTCACCGGTGTTGTGCCAATTTTGGTCGAGTTAGACGGTGATG TGAATGGCCACAAATTCTCTGTCTCCGGCGAAGGTGAGGGTGATGCAACCTATGGCAAACTGACGCTGAA ATTTATTTGCACCACCGGGAAGCTTCCCGTTCCTTGGCCTACTTTGGTTACCACCTTGTCTTGGGGTGTG CAGTGCTTCGCACGTTATCCTGACCACATGAAACAGCACGATTTTTTTAAAAGTGCAATGCCGGAAGGCT ATGTCCAGGAACGTACTATTTTTTTTAAGGATGATGGCAACTATAAAACCCGTGCCGAGGTCAAATTTGA AGGCGACACCTTGGTTAACCGAATTGAACTGAAAGGTATTGATTTTAAAGAAGATGGTAATATTCTGGGT CACAAATTGGAGTATAACTATTTCAGCGACAACGTTTATATTACCGCAGATAAACAAAAAAACGGTATCA AAGCCAACTTTAAAATTAGACACAATATCGAAGATGGCGGTGTCCAATTAGCCGACCACTATCAGCAGAA CACGCCGATCGGTGATGGTCCTGTGCTGCTGCCGGATAATCATTACCTTTCAACACAGAGCAAACTGAGC AAAGACCCGAACGAGAAACGTGACCACATGGTACTGCTGGAATTTGTGACAGCTGCGGGCATTACGCTTG GGATGGACGAGCTATATAAAACGGCCGGGGGTGTGCTTAATGGCTATTGGGGCTATCAGGAGTTTCTGGA TGAGTTCCCAGAACAGCGCAATCTTACGAACGCCCTGTCTGAAGCGGTTCGGGCGCAGCCTGTGCCTCTG TCTAAGCCGACTCAACGTCCTATCAAGATTTCGGTCGTATACCCTGGGCAGCAAGTTTCCGATTACTGGG TGCGTAACATCGCAAGCTTTGAAAAACGTCTGTATAAACTGAACATTAATTACCAACTGAACCAAGTGTT CACCCGACCCAATGCCGATATTAAACAACAGTCACTCAGTCTGATGGAGGCCCTGAAATCCAAATCGGAC TACCTGATCTTTACCTTGGATACGACTCGCCACCGTAAATTTGTGGAGCACGTACTCGATAGTACAAATA CGAAACTGATTTTACAGAATATAACGACGCCGGTACGGGAATGGGACAAACACCAGCCGTTCCTGTATGT GGGTTTTGACCATGCTGAAGGTTCCCGAGAACTGGCAACCGAATTCGGTAAATTTTTCCCGAAACATACG TATTACTCTGTGCTCTATTTCTCGGAAGGCTACATCAGCGATGTACGTGGAGATACCTTTATCCATCAGG TGAATCGGGATAATAACTTTGAGCTTCAGTCCGCTTACTACACCAAGGCGACCAAGCAATCCGGTTATGA TGCTGCCAAGGCGAGCTTGGCAAAGCACCCTGACGTTGACTTTATTTATGCCTGCTCGACGGACGTAGCT CTGGGTGCAGTAGATGCACTGGCAGAGCTCGGGAGAGAGGATATTATGATCAACGGTTGGGGAGGGGGGT CCGCGGAATTAGACGCGATACAGAAAGGTGATCTGGATATTACCGTCATGCGTATGAACGATGACACGGG TATTGCCATGGCAGAAGCGATTAAATGGGATCTGGAAGACAAACCAGTACCGACCGTATATAGTGGCGAC TTTGAAATCGTAACCAAAGCGGATTCCCCGGAACGAATCGAAGCGCTGAAGAAGCGTGCTTTTCGCTATT CCGATAACGGTGGGGCGGCTGCCATGGCAAGCCTTCCGGCTACCCATGAGCTTCATATTTTCGGCAGTAT TAATGGCGTAGACTTTGACATGGTGGGTCAGGGAACCGGAAATCCCAATGATGGCTATGAAGAGTTGAAC CTGAAATCTACCAAGGGCGACCTCCAGTTTTCACCTTGGATTTTGGTGCCACACATCGGTTATGGATTTC ATCAGTATTTACCTTATCCGGATGGAATGAGTCCGTTCCAGGCGGCCATGGTTGATGGTTCCGGTTATCA GGTCCATCGCACGATGCAGTTCGAGGACGGGGCCTCTCTGACGGTGAATTATCGTTATACCTATGAAGGT TCACATATAAAAGGTGAAGCTCAGGTAAAAGGCACGGGTTTTCCGGCGGATGGCCCGGTGATGACCAACT CCCTCACGGCGGCGGACTGGTGCCGGAGCAAAAAGACGTATCCGAATGATAAAACCATCATTAGCACCTT TAAATGGTCATACACGACTGGCAACGGTAAACGCTACAGATCCACCGCTCGCACCACATATACTTTTGCT AAACCTATGGCCGCAAACTATTTGAAAAACCAGCCTATGTACGTTTTCCGTAAAACCGAACTGAAGCACA GTAAAACTGAACTGAATTTCAAAGAATGGCAAAAAGCATTTACGGATGTTATGGGTATGGATGAGCTGTA TAAGCATCACCATCATCATCATTAATAGCTCGAG Amino Acid TqLPNGh biosensor protein Artificial SEQ ID NO: 2 MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSWGVQ CFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGH KLEYNYFSDNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSK DPNEKRDHMVLLEFVTAAGITLGMDELYKTAGGVLNGYWGYQEFLDEFPEQRNLTNALSEAVRAQPVPLS KPTQRPIKISVVYPGQQVSDYWVRNIASFEKRLYKLNINYQLNQVFTRPNADIKQQSLSLMEALKSKSDY LIFTLDTTRHRKFVEHVLDSTNTKLILQNITTPVREWDKHQPFLYVGFDHAEGSRELATEFGKFFPKHTY YSVLYFSEGYISDVRGDTFIHQVNRDNNFELQSAYYTKATKQSGYDAAKASLAKHPDVDFIYACSTDVAL GAVDALAELGREDIMINGWGGGSAELDAIQKGDLDITVMRMNDDTGIAMAEAIKWDLEDKPVPTVYSGDF EIVTKADSPERIEALKKRAFRYSDNGGAAAMASLPATHELHIFGSINGVDFDMVGQGTGNPNDGYEELNL KSTKGDLQFSPWILVPHIGYGFHQYLPYPDGMSPFQAAMVDGSGYQVHRTMQFEDGASLTVNYRYTYEGS HIKGEAQVKGTGFPADGPVMTNSLTAADWCRSKKTYPNDKTIISTFKWSYTTGNGKRYRSTARTTYTFAK PMAANYLKNQPMYVFRKTELKHSKTELNFKEWQKAFTDVMGMDELYKHHHHHH Amino Acid TqLPNGh biosensor protein lacking H6 sequence at C-terminal end Artificial SEQ ID NO: 3 MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSWGVQ CFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGH KLEYNYFSDNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSK DPNEKRDHMVLLEFVTAAGITLGMDELYKTAGGVLNGYWGYQEFLDEFPEQRNLTNALSEAVRAQPVPLS KPTQRPIKISVVYPGQQVSDYWVRNIASFEKRLYKLNINYQLNQVFTRPNADIKQQSLSLMEALKSKSDY LIFTLDTTRHRKFVEHVLDSTNTKLILQNITTPVREWDKHQPFLYVGFDHAEGSRELATEFGKFFPKHTY YSVLYFSEGYISDVRGDTFIHQVNRDNNFELQSAYYTKATKQSGYDAAKASLAKHPDVDFIYACSTDVAL GAVDALAELGREDIMINGWGGGSAELDAIQKGDLDITVMRMNDDTGIAMAEAIKWDLEDKPVPTVYSGDF EIVTKADSPERIEALKKRAFRYSDNGGAAAMASLPATHELHIFGSINGVDFDMVGQGTGNPNDGYEELNL KSTKGDLQFSPWILVPHIGYGFHQYLPYPDGMSPFQAAMVDGSGYQVHRTMQFEDGASLTVNYRYTYEGS HIKGEAQVKGTGFPADGPVMTNSLTAADWCRSKKTYPNDKTIISTFKWSYTTGNGKRYRSTARTTYTFAK PMAANYLKNQPMYVFRKTELKHSKTELNFKEWQKAFTDVMGMDELYK DNA Δ24-365 LuxP Vibrio harveyi SEQ ID NO: 4 ATGGTATCAAAGGGTGTGCTTAATGGCTATTGGGGCTATCAGGAGTTTCTGGATGAGTTCCCAGAACAGC GCAATCTTACGAACGCCCTGTCTGAAGCGGTTCGGGCGCAGCCTGTGCCTCTGTCTAAGCCGACTCAACG TCCTATCAAGATTTCGGTCGTATACCCTGGGCAGCAAGTTTCCGATTACTGGGTGCGTAACATCGCAAGC TTTGAAAAACGTCTGTATAAACTGAACATTAATTACCAACTGAACCAAGTGTTCACCCGACCCAATGCCG ATATTAAACAACAGTCACTCAGTCTGATGGAGGCCCTGAAATCCAAATCGGACTACCTGATCTTTACCTT GGATACGACTCGCCACCGTAAATTTGTGGAGCACGTACTCGATAGTACAAATACGAAACTGATTTTACAG AATATAACGACGCCGGTACGGGAATGGGACAAACACCAGCCGTTCCTGTATGTGGGTTTTGACCATGCTG AAGGTTCCCGAGAACTGGCAACCGAATTCGGTAAATTTTTCCCGAAACATACGTATTACTCTGTGCTCTA TTTCTCGGAAGGCTACATCAGCGATGTACGTGGAGATACCTTTATCCATCAGGTGAATCGGGATAATAAC TTTGAGCTTCAGTCCGCTTACTACACCAAGGCGACCAAGCAATCCGGTTATGATGCTGCCAAGGCGAGCT TGGCAAAGCACCCTGACGTTGACTTTATTTATGCCTGCTCGACGGACGTAGCTCTGGGTGCAGTAGATGC ACTGGCAGAGCTCGGGAGAGAGGATATTATGATCAACGGTTGGGGAGGGGGGTCCGCGGAATTAGACGCG ATACAGAAAGGTGATCTGGATATTACCGTCATGCGTATGAACGATGACACGGGTATTGCCATGGCAGAAG CGATTAAATGGGATCTGGAAGACAAACCAGTACCGACCGTATATAGTGGCGACTTTGAAATCGTAACCAA AGCGGATTCCCCGGAACGAATCGAAGCGCTGAAGAAGCGTGCTTTTCGCTATTCCGATAACGG Amino Acid Δ24-365 LuxP Vibrio harveyi SEQ ID NO: 5 MVSKGVLNGYWGYQEFLDEFPEQRNLTNALSEAVRAQPVPLSKPTQRPIKISVVYPGQQVSDYWVRNIAS FEKRLYKLNINYQLNQVFTRPNADIKQQSLSLMEALKSKSDYLIFTLDTTRHRKFVEHVLDSTNTKLILQ NITTPVREWDKHQPFLYVGFDHAEGSRELATEFGKFFPKHTYYSVLYFSEGYISDVRGDTFIHQVNRDNN FELQSAYYTKATKQSGYDAAKASLAKHPDVDFIYACSTDVALGAVDALAELGREDIMINGWGGGSAELDA IQKGDLDITVMRMNDDTGIAMAEAIKWDLEDKPVPTVYSGDFEIVTKADSPERIEALKKRAFRYSDNG DNA mNeonGreen-His6 fluorescent protein Branchiostoma lanceolatum SEQ ID NO: 6 ATGGCAAGCCTTCCGGCTACCCATGAGCTTCATATTTTCGGCAGTATTAATGGCGTAGACTTTGACATGG TGGGTCAGGGAACCGGAAATCCCAATGATGGCTATGAAGAGTTGAACCTGAAATCTACCAAGGGCGACCT CCAGTTTTCACCTTGGATTTTGGTGCCACACATCGGTTATGGATTTCATCAGTATTTACCTTATCCGGAT GGAATGAGTCCGTTCCAGGCGGCCATGGTTGATGGTTCCGGTTATCAGGTCCATCGCACGATGCAGTTCG AGGACGGGGCCTCTCTGACGGTGAATTATCGTTATACCTATGAAGGTTCACATATAAAAGGTGAAGCTCA GGTAAAAGGCACGGGTTTTCCGGCGGATGGCCCGGTGATGACCAACTCCCTCACGGCGGCGGACTGGTGC CGGAGCAAAAAGACGTATCCGAATGATAAAACCATCATTAGCACCTTTAAATGGTCATACACGACTGGCA ACGGTAAACGCTACAGATCCACCGCTCGCACCACATATACTTTTGCTAAACCTATGGCCGCAAACTATTT GAAAAACCAGCCTATGTACGTTTTCCGTAAAACCGAACTGAAGCACAGTAAAACTGAACTGAATTTCAAA GAATGGCAAAAAGCATTTACGGATGTTATGGGTATGGATGAGCTGTATAAGCATCACCATCATCATCAT Amino Acid mNeonGreen-His6 fluorescent protein Branchiostoma lanceolatum SEQ ID NO: 7 MVSKGEEDNMASLPATHELHIFGSINGVDFDMVGQGTGNPNDGYEELNLKSTKGDLQFSPWILVPHIGYG FHQYLPYPDGMSPFQAAMVDGSGYQVHRTMQFEDGASLTVNYRYTYEGSHIKGEAQVKGTGFPADGPVMT NSLTAADWCRSKKTYPNDKTIISTFKWSYTTGNGKRYRSTARTTYTFAKPMAANYLKNQPMYVFRKTELK HSKTELNFKEWQKAFTDVMGMDELYKHHHHHH DNA mTurquoise-His6 fluorescent protein Aequorea victoria SEQ ID NO: 8 ATGGTATCAAAGGGTGAAGAACTTTTCACCGGTGTTGTGCCAATTTTGGTCGAGTTAGACGGTGATGTGA ATGGCCACAAATTCTCTGTCTCCGGCGAAGGTGAGGGTGATGCAACCTATGGCAAACTGACGCTGAAATT TATTTGCACCACCGGGAAGCTTCCCGTTCCTTGGCCTACTTTGGTTACCACCTTGTCTTGGGGTGTGCAG TGCTTCGCACGTTATCCTGACCACATGAAACAGCACGATTTTTTTAAAAGTGCAATGCCGGAAGGCTATG TCCAGGAACGTACTATTTTTTTTAAGGATGATGGCAACTATAAAACCCGTGCCGAGGTCAAATTTGAAGG CGACACCTTGGTTAACCGAATTGAACTGAAAGGTATTGATTTTAAAGAAGATGGTAATATTCTGGGTCAC AAATTGGAGTATAACTATTTCAGCGACAACGTTTATATTACCGCAGATAAACAAAAAAACGGTATCAAAG CCAACTTTAAAATTAGACACAATATCGAAGAT GGCGGTGTCCAATTAGCCGACCACTATCAGCAGAACAC GCCGATCGGTGATGGTCCTGTGCTGCTGCCGGATAATCATTACCTTTCAACACAGAGCAAACTGAGCAAA GACCCGAACGAGAAACGTGACCACATGGTACTGCTGGAATTTGTGACAGCTGCGGGCATTACGCTTGGGA TGGACGAGCTATATAAACATCACCATCATCATCATTAATAG Amino Acid mTurquoise-His6 fluorescent protein Aequorea victoria SEQ ID NO: 9 MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSWGVQ CFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGH KLEYNYFSDNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSK DPNEKRDHMVLLEFVTAAGITLGMDELYKHHHHHH DNA Plasmid - pET-21a(+)-TqLPNGh Artificial SEQ ID NO: 10 TGGCGAATGGGACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACC GCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCG GCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGA CCCCAAAAAACTTGATTAGGGTGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCT TTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCT CGGTCTATTCTTTTGATTTATAAGGGATTTTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTA ACAAAAATTTAACGCGAATTTTAACAAAATATTAACGTTTACAATTTCAGGTGGCACTTTTCGGGGAAAT GTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGACAATAAC CCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTAT TCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCT GAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTT TTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCG TATTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCA CCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGA GTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCA CAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGAC GAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTA CTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTC GGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATT GCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTA TGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCA AGTTTACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATC CTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAG AAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACC ACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTC AGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTG TAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTG TCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCG TGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAA GCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCG CACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTT GAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTT TACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGA TAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCA GTGAGCGAGGAAGCGGAAGAGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACC GCATATATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGTATACACTCCGCTAT CGCTACGTGACTGGGTCATGGCTGCGCCCCGACACCCGCCAACACCCGCTGACGCGCCCTGACGGGCTTG TCTGCTCCCGGCATCCGCTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGCATGTGTCAGAGGTTTTCA CCGTCATCACCGAAACGCGCGAGGCAGCTGCGGTAAAGCTCATCAGCGTGGTCGTGAAGCGATTCACAGA TGTCTGCCTGTTCATCCGCGTCCAGCTCGTTGAGTTTCTCCAGAAGCGTTAATGTCTGGCTTCTGATAAA GCGGGCCATGTTAAGGGCGGTTTTTTCCTGTTTGGTCACTGATGCCTCCGTGTAAGGGGGATTTCTGTTC ATGGGGGTAATGATACCGATGAAACGAGAGAGGATGCTCACGATACGGGTTACTGATGATGAACATGCCC GGTTACTGGAACGTTGTGAGGGTAAACAACTGGCGGTATGGATGCGGCGGGACCAGAGAAAAATCACTCA GGGTCAATGCCAGCGCTTCGTTAATACAGATGTAGGTGTTCCACAGGGTAGCCAGCAGCATCCTGCGATG CAGATCCGGAACATAATGGTGCAGGGCGCTGACTTCCGCGTTTCCAGACTTTACGAAACACGGAAACCGA AGACCATTCATGTTGTTGCTCAGGTCGCAGACGTTTTGCAGCAGCAGTCGCTTCACGTTCGCTCGCGTAT CGGTGATTCATTCTGCTAACCAGTAAGGCAACCCCGCCAGCCTAGCCGGGTCCTCAACGACAGGAGCACG ATCATGCGCACCCGTGGGGCCGCCATGCCGGCGATAATGGCCTGCTTCTCGCCGAAACGTTTGGTGGCGG GACCAGTGACGAAGGCTTGAGCGAGGGCGTGCAAGATTCCGAATACCGCAAGCGACAGGCCGATCATCGT CGCGCTCCAGCGAAAGCGGTCCTCGCCGAAAATGACCCAGAGCGCTGCCGGCACCTGTCCTACGAGTTGC ATGATAAAGAAGACAGTCATAAGTGCGGCGACGATAGTCATGCCCCGCGCCCACCGGAAGGAGCTGACTG GGTTGAAGGCTCTCAAGGGCATCGGTCGAGATCCCGGTGCCTAATGAGTGAGCTAACTTACATTAATTGC GTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGC GCGGGGAGAGGCGGTTTGCGTATTGGGCGCCAGGGTGGTTTTTCTTTTCACCAGTGAGACGGGCAACAGC TGATTGCCCTTCACCGCCTGGCCCTGAGAGAGTTGCAGCAAGCGGTCCACGCTGGTTTGCCCCAGCAGGC GAAAATCCTGTTTGATGGTGGTTAACGGCGGGATATAACATGAGCTGTCTTCGGTATCGTCGTATCCCAC TACCGAGATATCCGCACCAACGCGCAGCCCGGACTCGGTAATGGCGCGCATTGCGCCCAGCGCCATCTGA TCGTTGGCAACCAGCATCGCAGTGGGAACGATGCCCTCATCAGCATTTGCATGGTTTGTTGAAAACCGGA CATGGCACTCCAGTCGCCTTCCCGTTCCGCTATCGGCTGAATTTGATTGCGAGTGAGATATTTATGCCAG CCAGCCAGACGCAGACGCGCCGAGACAGAACTTAATGGGCCCGCTAACAGCGCGATTTGCTGGTGACCCA ATGCGACCAGATGCTCCACGCCCAGTCGCGTACCGTCTTCATGGGAGAAAATAATACTGTTGATGGGTTC TGGTCAGAGACATCAAGAAATAACGCCGGAACATTAGTGCAGGCAGCTTCCACAGCAATGGCATCCTGGT CATCCAGCGGATAGTTAATGATCAGCCCACTGACGCGTTGCGCGAGAAGATTGTGCACCGCCGCTTTACA GGCTTCGACGCCGCTTCGTTCTACCATCGACACCACCACGCTGGCACCCAGTTGATCGGCGCGAGATTTA ATCGCCGCGACAATTTGCGACGGCGCGTGCAGGGCCAGACTGGAGGTGGCAACGCCAATCAGCAACGACT GTTTGCCCGCCAGTTGTTGTGCCACGCGGTTGGGAATGTAATTCAGCTCCGCCATCGCCGCTTCCACTTT TTCCCGCGTTTTCGCAGAAACGTGGCTGGCCTGGTTCACCACGCGGGAAACGGTCTGATAAGAGACACCG GCATACTCTGCGACATCGTATAACGTTACTGGTTTCACATTCACCACCCTGAATTGACTCTCTTCCGGGC GCTATCATGCCATACCGCGAAAGGTTTTGCGCCATTCGATGGTGTCCGGGATCTCGACGCTCTCCCTTAT GCGACTCCTGCATTAGGAAGCAGCCCAGTAGTAGGTTGAGGCCGTTGAGCACCGCCGCCGCAAGGAATGG TGCATGCAAGGAGATGGCGCCCAACAGTCCCCCGGCCACGGGGCCTGCCACCATACCCACGCCGAAACAA GCGCTCATGAGCCCGAAGTGGCGAGCCCGATCTTCCCCATCGGTGATGTCGGCGATATAGGCGCCAGCAA CCGCACCTGTGGCGCCGGTGATGCCGGCCACGATGCGTCCGGCGTAGAGGATCGAGATCTCGATCCCGCG AAATTAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAAATAATTTTGTTTA ACTTTAAGAAGGAGATATACATATGGTATCAAAGGGTGAAGAACTTTTCACCGGTGTTGTGCCAATTTTG GTCGAGTTAGACGGTGATGTGAATGGCCACAAATTCTCTGTCTCCGGCGAAGGTGAGGGTGATGCAACCT ATGGCAAACTGACGCTGAAATTTATTTGCACCACCGGGAAGCTTCCCGTTCCTTGGCCTACTTTGGTTAC CACCTTGTCTTGGGGTGTGCAGTGCTTCGCACGTTATCCTGACCACATGAAACAGCACGATTTTTTTAAA AGTGCAATGCCGGAAGGCTATGTCCAGGAACGTACTATTTTTTTTAAGGATGATGGCAACTATAAAACCC GTGCCGAGGTCAAATTTGAAGGCGACACCTTGGTTAACCGAATTGAACTGAAAGGTATTGATTTTAAAGA AGATGGTAATATTCTGGGTCACAAATTGGAGTATAACTATTTCAGCGACAACGTTTATATTACCGCAGAT AAACAAAAAAACGGTATCAAAGCCAACTTTAAAATTAGACACAATATCGAAGATGGCGGTGTCCAATTAG CCGACCACTATCAGCAGAACACGCCGATCGGTGATGGTCCTGTGCTGCTGCCGGATAATCATTACCTTTC AACACAGAGCAAACTGAGCAAAGACCCGAACGAGAAACGTGACCACATGGTACTGCTGGAATTTGTGACA GCTGCGGGCATTACGCTTGGGATGGACGAGCTATATAAAACGGCCGGGGGTGTGCTTAATGGCTATTGGG GCTATCAGGAGTTTCTGGATGAGTTCCCAGAACAGCGCAATCTTACGAACGCCCTGTCTGAAGCGGTTCG GGCGCAGCCTGTGCCTCTGTCTAAGCCGACTCAACGTCCTATCAAGATTTCGGTCGTATACCCTGGGCAG CAAGTTTCCGATTACTGGGTGCGTAACATCGCAAGCTTTGAAAAACGTCTGTATAAACTGAACATTAATT ACCAACTGAACCAAGTGTTCACCCGACCCAATGCCGATATTAAACAACAGTCACTCAGTCTGATGGAGGC CCTGAAATCCAAATCGGACTACCTGATCTTTACCTTGGATACGACTCGCCACCGTAAATTTGTGGAGCAC GTACTCGATAGTACAAATACGAAACTGATTTTACAGAATATAACGACGCCGGTACGGGAATGGGACAAAC ACCAGCCGTTCCTGTATGTGGGTTTTGACCATGCTGAAGGTTCCCGAGAACTGGCAACCGAATTCGGTAA ATTTTTCCCGAAACATACGTATTACTCTGTGCTCTATTTCTCGGAAGGCTACATCAGCGATGTACGTGGA GATACCTTTATCCATCAGGTGAATCGGGATAATAACTTTGAGCTTCAGTCCGCTTACTACACCAAGGCGA CCAAGCAATCCGGTTATGATGCTGCCAAGGCGAGCTTGGCAAAGCACCCTGACGTTGACTTTATTTATGC CTGCTCGACGGACGTAGCTCTGGGTGCAGTAGATGCACTGGCAGAGCTCGGGAGAGAGGATATTATGATC AACGGTTGGGGAGGGGGGTCCGCGGAATTAGACGCGATACAGAAAGGTGATCTGGATATTACCGTCATGC GTATGAACGATGACACGGGTATTGCCATGGCAGAAGCGATTAAATGGGATCTGGAAGACAAACCAGTACC GACCGTATATAGTGGCGACTTTGAAATCGTAACCAAAGCGGATTCCCCGGAACGAATCGAAGCGCTGAAG AAGCGTGCTTTTCGCTATTCCGATAACGGTGGGGCGGCTGCCATGGCAAGCCTTCCGGCTACCCATGAGC TTCATATTTTCGGCAGTATTAATGGCGTAGACTTTGACATGGTGGGTCAGGGAACCGGAAATCCCAATGA TGGCTATGAAGAGTTGAACCTGAAATCTACCAAGGGCGACCTCCAGTTTTCACCTTGGATTTTGGTGCCA CACATCGGTTATGGATTTCATCAGTATTTACCTTATCCGGATGGAATGAGTCCGTTCCAGGCGGCCATGG TTGATGGTTCCGGTTATCAGGTCCATCGCACGATGCAGTTCGAGGACGGGGCCTCTCTGACGGTGAATTA TCGTTATACCTATGAAGGTTCACATATAAAAGGTGAAGCTCAGGTAAAAGGCACGGGTTTTCCGGCGGAT GGCCCGGTGATGACCAACTCCCTCACGGCGGCGGACTGGTGCCGGAGCAAAAAGACGTATCCGAATGATA AAACCATCATTAGCACCTTTAAATGGTCATACACGACTGGCAACGGTAAACGCTACAGATCCACCGCTCG CACCACATATACTTTTGCTAAACCTATGGCCGCAAACTATTTGAAAAACCAGCCTATGTACGTTTTCCGT AAAACCGAACTGAAGCACAGTAAAACTGAACTGAATTTCAAAGAATGGCAAAAAGCATTTACGGATGTTA TGGGTATGGATGAGCTGTATAAGCATCACCATCATCATCATTAATAGCTCGAGCACCACCACCACCACCA CTGAGATCCGGCTGCTAACAAAGCCCGAAAGGAAGCTGAGTTGGCTGCTGCCACCGCTGAGCAATAACTA GCATAACCCCTTGGGGCCTCTAAACGGGTCTTGAGGGGTTTTTTGCTGAAAGGAGGAACTATATCCGGAT DNA Plasmid - pET21-hTqLPNG Artificial SEQ ID NO. 11 TGGCGAATGGGACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACC GCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCG GCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGA CCCCAAAAAACTTGATTAGGGTGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCT TTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCT CGGTCTATTCTTTTGATTTATAAGGGATTTTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTA ACAAAAATTTAACGCGAATTTTAACAAAATATTAACGTTTACAATTTCAGGTGGCACTTTTCGGGGAAAT GTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGACAATAAC CCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTAT TCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCT GAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTT TTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCG TATTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCA CCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGA GTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCA CAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGAC GAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTA CTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTC GGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATT GCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTA TGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCA AGTTTACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATC CTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAG AAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACC ACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTC AGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTG TAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTG TCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCG TGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAA GCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCG CACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTT GAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTT TACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGA TAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCA GTGAGCGAGGAAGCGGAAGAGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACC GCATATATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGTATACACTCCGCTAT CGCTACGTGACTGGGTCATGGCTGCGCCCCGACACCCGCCAACACCCGCTGACGCGCCCTGACGGGCTTG TCTGCTCCCGGCATCCGCTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGCATGTGTCAGAGGTTTTCA CCGTCATCACCGAAACGCGCGAGGCAGCTGCGGTAAAGCTCATCAGCGTGGTCGTGAAGCGATTCACAGA TGTCTGCCTGTTCATCCGCGTCCAGCTCGTTGAGTTTCTCCAGAAGCGTTAATGTCTGGCTTCTGATAAA GCGGGCCATGTTAAGGGCGGTTTTTTCCTGTTTGGTCACTGATGCCTCCGTGTAAGGGGGATTTCTGTTC ATGGGGGTAATGATACCGATGAAACGAGAGAGGATGCTCACGATACGGGTTACTGATGATGAACATGCCC GGTTACTGGAACGTTGTGAGGGTAAACAACTGGCGGTATGGATGCGGCGGGACCAGAGAAAAATCACTCA GGGTCAATGCCAGCGCTTCGTTAATACAGATGTAGGTGTTCCACAGGGTAGCCAGCAGCATCCTGCGATG CAGATCCGGAACATAATGGTGCAGGGCGCTGACTTCCGCGTTTCCAGACTTTACGAAACACGGAAACCGA AGACCATTCATGTTGTTGCTCAGGTCGCAGACGTTTTGCAGCAGCAGTCGCTTCACGTTCGCTCGCGTAT CGGTGATTCATTCTGCTAACCAGTAAGGCAACCCCGCCAGCCTAGCCGGGTCCTCAACGACAGGAGCACG ATCATGCGCACCCGTGGGGCCGCCATGCCGGCGATAATGGCCTGCTTCTCGCCGAAACGTTTGGTGGCGG GACCAGTGACGAAGGCTTGAGCGAGGGCGTGCAAGATTCCGAATACCGCAAGCGACAGGCCGATCATCGT CGCGCTCCAGCGAAAGCGGTCCTCGCCGAAAATGACCCAGAGCGCTGCCGGCACCTGTCCTACGAGTTGC ATGATAAAGAAGACAGTCATAAGTGCGGCGACGATAGTCATGCCCCGCGCCCACCGGAAGGAGCTGACTG GGTTGAAGGCTCTCAAGGGCATCGGTCGAGATCCCGGTGCCTAATGAGTGAGCTAACTTACATTAATTGC GTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGC GCGGGGAGAGGCGGTTTGCGTATTGGGCGCCAGGGTGGTTTTTCTTTTCACCAGTGAGACGGGCAACAGC TGATTGCCCTTCACCGCCTGGCCCTGAGAGAGTTGCAGCAAGCGGTCCACGCTGGTTTGCCCCAGCAGGC GAAAATCCTGTTTGATGGTGGTTAACGGCGGGATATAACATGAGCTGTCTTCGGTATCGTCGTATCCCAC TACCGAGATATCCGCACCAACGCGCAGCCCGGACTCGGTAATGGCGCGCATTGCGCCCAGCGCCATCTGA TCGTTGGCAACCAGCATCGCAGTGGGAACGATGCCCTCATTCAGCATTTGCATGGTTTGTTGAAAACCGG ACATGGCACTCCAGTCGCCTTCCCGTTCCGCTATCGGCTGAATTTGATTGCGAGTGAGATATTTATGCCA GCCAGCCAGACGCAGACGCGCCGAGACAGAACTTAATGGGCCCGCTAACAGCGCGATTTGCTGGTGACCC AATGCGACCAGATGCTCCACGCCCAGTCGCGTACCGTCTTCATGGGAGAAAATAATACTGTTGATGGGTG TCTGGTCAGAGACATCAAGAAATAACGCCGGAACATTAGTGCAGGCAGCTTCCACAGCAATGGCATCCTG GTCATCCAGCGGATAGTTAATGATCAGCCCACTGACGCGTTGCGCGAGAAGATTGTGCACCGCCGCTTTA CAGGCTTCGACGCCGCTTCGTTCTACCATCGACACCACCACGCTGGCACCCAGTTGATCGGCGCGAGATT TAATCGCCGCGACAATTTGCGACGGCGCGTGCAGGGCCAGACTGGAGGTGGCAACGCCAATCAGCAACGA CTGTTTGCCCGCCAGTTGTTGTGCCACGCGGTTGGGAATGTAATTCAGCTCCGCCATCGCCGCTTCCACT TTTTCCCGCGTTTTCGCAGAAACGTGGCTGGCCTGGTTCACCACGCGGGAAACGGTCTGATAAGAGACAC CGGCATACTCTGCGACATCGTATAACGTTACTGGTTTCACATTCACCACCCTGAATTGACTCTCTTCCGG GCGCTATCATGCCATACCGCGAAAGGTTTTGCGCCATTCGATGGTGTCCGGGATCTCGACGCTCTCCCTT ATGCGACTCCTGCATTAGGAAGCAGCCCAGTAGTAGGTTGAGGCCGTTGAGCACCGCCGCCGCAAGGAAT GGTGCATGCAAGGAGATGGCGCCCAACAGTCCCCCGGCCACGGGGCCTGCCACCATACCCACGCCGAAAC AAGCGCTCATGAGCCCGAAGTGGCGAGCCCGATCTTCCCCATCGGTGATGTCGGCGATATAGGCGCCAGC AACCGCACCTGTGGCGCCGGTGATGCCGGCCACGATGCGTCCGGCGTAGAGGATCGAGATCTCGATCCCG CGAAATTAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCTCTAGAAATAATTTTGTT TAACTTTAAGAAGGAGATATACATATGGGCAGCAGCCATCATCATCATCATCACGGAAGCAGTGGCCGTA AAGGCGAGGAGCTGTTCACAGGCGTCGTGCCGATCCTGGTAGAACTCGATGGGGATGTCAATGGACATAA GTTTAGCGTCTCGGGAGAAGGGGAGGGTGACGCCACGTATGGGAAGCTTACGCTGAAATTTATTTGCACC ACGGGCAAATTACCGGTCCCGTGGCCTACCCTTGTAACCACTCTCTCTTGGGGAGTGCAGTGCTTCGCGA GGTACCCAGATCACATGAAACAACATGATTTTTTCAAATCGGCGATGCCGGAAGGCTATGTGCAAGAGCG CACAATCTTTTTTAAAGATGACGGTAATTACAAGACCCGAGCCGAAGTAAAATTTGAGGGAGATACACTG GTGAACCGTATTGAACTGAAAGGTATTGACTTTAAAGAGGACGGCAATATCCTGGGCCATAAGCTGGAAT ACAATTATTTTTCTGATAACGTATATATTACGGCCGACAAACAGAAGAACGGTATCAAAGCGAATTTTAA AATTCGCCACAATATCGAAGACGGGGGTGTTCAGTTGGCCGATCATTATCAACAGAACACTCCGATTGGG GATGGCCCCGTACTGCTGCCAGATAATCATTACCTCTCTACTCAGTCAAAGCTGAGCAAAGATCCAAACG AGAAACGTGATCACATGGTTTTACTGGAGTTTGTCACGGCCGCCGGTATTACCCTGGGAATGGATGAACT GTATAAGACCGCAGGGGGCGTGCTGAACGGCTATTGGGGCTATCAGGAATTCCTGGACGAATTTCCGGAA CAGCGAAATTTAACCAACGCACTGAGCGAAGCAGTACGCGCCCAACCGGTGCCTCTGTCTAAACCCACCC AACGCCCGATTAAGATTTCTGTTGTCTACCCGGGGCAGCAGGTGTCTGATTACTGGGTCCGCAACATTGC CTCCTTTGAGAAGAGGCTGTATAAGCTTAATATCAATTACCAGCTGAACCAAGTGTTCACTCGCCCTAAT GCGGATATCAAACAGCAATCGCTTTCGCTGATGGAAGCTCTGAAAAGTAAATCTGACTATCTCATCTTTA CCCTGGACACGACCCGTCACAGAAAGTTCGTCGAACACGTCCTTGATTCAACAAACACAAAACTAATTCT TCAGAACATCACTACGCCAGTGCGTGAATGGGATAAACATCAGCCGTTTCTTTATGTGGGCTTTGACCAT GCCGAAGGCAGCCGTGAGTTAGCAACGGAGTTTGGGAAGTTTTTCCCGAAACATACATACTACTCTGTTC TGTATTTTAGCGAGGGATATATCTCGGACGTGCGCGGTGATACCTTTATTCATCAGGTAAACCGCGATAA CAACTTTGAACTGCAAAGCGCGTATTATACGAAAGCTACCAAACAAAGCGGCTATGACGCAGCGAAAGCG TCCCTGGCGAAGCATCCGGATGTCGATTTTATTTACGCATGCAGTACCGACGTAGCATTAGGGGCGGTTG ACGCACTGGCTGAGTTAGGTCGCGAGGATATTATGATTAATGGTTGGGGTGGGGGTAGTGCCGAATTGGA CGCTATTCAGAAAGGTGACCTGGATATTACAGTAATGCGTATGAACGATGATACTGGCATTGCCATGGCA GAGGCAATCAAATGGGATCTGGAAGATAAACCTGTTCCCACGGTATATTCCGGTGATTTTGAAATTGTCA CTAAAGCAGACAGTCCGGAACGTATAGAAGCACTCAAAAAGCGTGCTTTCCGTTACTCAGATAATGGGGG CGCTGCCGCCATGGCCTCTCTGCCAGCCACCCATGAACTGCACATTTTTGGTTCGATTAACGGTGTTGAC TTCGACATGGTAGGGCAGGGTACCGGCAATCCGAATGACGGCTATGAAGAATTGAACCTGAAATCAACGA AAGGCGATTTGCAGTTTTCTCCGTGGATCCTGGTGCCGCACATTGGCTACGGATTTCACCAGTATCTTCC GTACCCCGATGGGATGTCACCATTTCAGGCGGCTATGGTGGATGGTTCCGGCTATCAGGTACATCGCACG ATGCAGTTTGAAGACGGCGCGAGCCTGACGGTTAATTATCGCTACACGTATGAGGGTAGCCACATCAAAG GCGAAGCGCAAGTAAAAGGTACCGGTTTTCCGGCCGATGGACCGGTTATGACGAACAGTCTAACGGCAGC CGACTGGTGTCGGTCGAAGAAAACGTATCCGAATGATAAGACCATTATTTCGACGTTCAAGTGGTCCTAT ACGACCGGAAACGGTAAGCGCTATCGGTCTACCGCACGCACGACATACACTTTCGCTAAACCGATGGCTG CCAACTACCTTAAAAATCAGCCGATGTATGTATTCCGAAAAACAGAATTAAAACATTCTAAAACCGAACT TAATTTTAAAGAATGGCAAAAAGCCTTTACAGATGTGATGGGCATGGACGAATTGTACAAATAATAGCTC GAGCACCACCACCACCACCACTGAGATCCGGCTGCTAACAAAGCCCGAAAGGAAGCTGAGTTGGCTGCTG CCACCGCTGAGCAATAACTAGCATAACCCCTTGGGGCCTCTAAACGGGTCTTGAGGGGTTTTTTGCTGAA AGGAGGAACTATATCCGGAT