Butelase-mediated peptide ligation

11091786 · 2021-08-17

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to a method of forming a peptide of Formula (I) (P.sup.1-Xaa.sup.1-Xaa.sup.2-P.sup.2) by ligating a first peptide of Formula (II) (P.sup.1-Xaa.sup.1-X—R, wherein X is O or S) to a second peptide of Formula (III) (Xaa.sup.1-Xaa.sup.2-P.sup.2) by enzymatically cleaving the bond between “Asx” and “X” in the first peptide of Formula (II) and ligating the fragment P.sup.1-Asx of the first peptide to the second peptide of Formula (III), wherein the enzymatic cleavage and ligation reaction is catalyzed by butelase 1 (SEQ ID NO: 1) and the peptide of Formula (I) is a depsipeptide, preferably a thiodepsipeptide. Further encompassed are peptides and dendrimeric peptide assemblies prepared using the presently disclosed method, as well as use of the dendrimeric peptide assemblies as a vaccine, medicament, or diagnostic agent, particularly as an antimicrobial agent.

Claims

1. A method of forming a peptide of Formula (I) P.sup.1-Asx-Xaa.sup.1-Xaa.sup.2-P.sup.2 (I), the method comprising: enzymatically cleaving a bond between “Asx” and “X” in a first peptide of Formula (II)
P.sup.1-Asx-X—R  (II); and ligating a P.sup.1-Asx fragment of the first peptide of Formula (II) to a second peptide of Formula (III) Xaa.sup.1-Xaa.sup.2-P.sup.2 (III) to form the peptide of Formula (I); wherein P.sup.1 and P.sup.2 are each independently any peptide, modified or unmodified; Asx is Asp or Asn; X is S; R is a substituted or unsubstituted alkyl selected from the group consisting of —(CH.sub.2).sub.n—CONH.sub.2, —(CH.sub.2).sub.n—COOH, —(CH.sub.2).sub.n—CO-AA.sup.1, ##STR00004## wherein n is an integer of 1 to 10, R.sub.1 is H, or any other side chain of a naturally occurring amino acid, and AA.sup.1 is any amino acid or is absent; Xaa.sup.1 is any naturally occurring amino acid with the exception of Pro; Xaa.sup.2 is a naturally occurring amino acid; wherein the enzymatic cleavage and ligation are catalyzed by a polypeptide having at least 90% of the ligase activity of butelase 1 (SEQ ID NO:1).

2. The method according to claim 1, wherein Asx is Asn, R is —CH(R.sub.1)—CO-AA.sup.1, R.sub.1 is H, and AA.sup.1 is any amino acid or absent.

3. The method according to claim 1, wherein Asx is Asn, R is —CH(R.sub.1)—CO-AA.sup.1, R.sub.1 is H, and AA.sup.1 is Val.

4. The method according to claim 1, wherein the polypeptide having at least 90% of the ligase activity of butelase 1 (SEQ ID NO:1) comprises: (a) the amino acid sequence as set forth in SEQ ID NO:1 (butelase 1); (b) an amino acid sequence that shares at least 80% sequence identity with the amino acid sequence as set forth in SEQ ID NO:1; or (c) a fragment of any one of (a)-(b).

5. The method according to claim 1, wherein the polypeptide having the ligase activity of butelase 1 (SEQ ID NO:1) comprises the amino acid sequence as set forth in SEQ ID NO:2.

6. The method according to claim 1, wherein the polypeptide having at least 90% of the ligase activity of butelase 1 (SEQ ID NO:1) comprises (a) the amino acid residue Asn at the position corresponding to position 19 of SEQ ID NO:1; and/or (b) the amino acid residue His at the position corresponding to position 124 of SEQ ID NO:1; and/or (c) the amino acid residue Cys at the position corresponding to position 166 of SEQ ID NO:1.

7. The method according to claim 1, wherein the polypeptide having at least 90% of the ligase activity of butelase 1 (SEQ ID NO:1) comprises (a) any one of the amino acid sequences as set forth in SEQ ID Nos:3-109; (b) an amino acid sequence that shares at least 80% sequence identity with any one of the amino acid sequences of (a) over its entire length; (c) a fragment of any one of (a)-(b).

8. The method according to claim 1, wherein P.sup.1 or P.sup.2 is modified by one or more of an affinity tag, a detectable label, a solid support material, a scaffold molecule, or any combination thereof.

9. The method according to claim 1, wherein P.sup.1 or P.sup.2 is modified by one or more of a biotin, a fluorescent marker, a polymer resin, a dendrimer, or any combination thereof.

10. The method according to claim 9, wherein P.sup.1 or P.sup.2 is modified by a dendrimer.

11. The method according to claim 10, wherein each dendrimer is conjugated to 2 or more copies of the second peptide via P.sup.2, such that the ligation of the first peptide and the second peptide results in a dendrimeric peptide assembly comprising 2 or more copies of the ligated peptide P.sup.1-Asx-Xaa.sup.1-Xaa.sup.2-P.sup.2.

12. The method according to claim 10, wherein each dendrimer is a lysyl dendrimer.

13. The method according to claim 1, wherein the first peptide is P.sup.1-Asn-thioglc-Val, and P.sup.1 is an antimicrobial peptide.

14. The method according to claim 13, wherein P.sup.1 is an antimicrobial peptide comprising a BHHB tetrapeptide motif.

15. The method according to claim 14, wherein P.sup.1 is an antimicrobial peptide comprising an Arg-Leu-Tyr-Arg (SEQ ID NO:121) tetrapeptide.

16. The method according to claim 15, wherein the first peptide is Ac-Arg-Leu-Tyr-Arg-Asn-thioglc-Val (SEQ ID NO:120).

17. The method according to claim 1, wherein the second peptide is Arg-Ile-βAla conjugated to a lysyl dendrimer via βAla.

18. The method according to claim 12, wherein the first peptide is Ac-Arg-Leu-Tyr-Arg-Asn-thioglc-Val (SEQ ID NO:120), and each lysyl dendrimer is conjugated to 2 or more copies of the second peptide Arg-Ile-βAla via βAla, such that the ligation of the first peptide and the second peptide results in a dendrimeric peptide assembly comprising 2 or more copies of Ac-Arg-Leu-Tyr-Arg-Asn-Arg-Ile-βAla (SEQ ID NO:131).

19. A dendrimeric peptide assembly comprising 2 or more copies of Ac-Arg-Leu-Tyr-Arg-Asn-Arg-Ile-βAla (SEQ ID NO:131).

20. The method according to claim 1, wherein Xaa.sup.2 is a hydrophobic amino acid or Cys.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The invention will be better understood with reference to the detailed description when considered in conjunction with the non-limiting examples and the accompanying drawings.

(2) FIG. 1. Butelase 1 ligation using a) natural peptide and b) thiodepsipeptide.

(3) FIG. 2. Synthetic strategy for a) thiodepsipeptide 1 and b) depsipeptide 2.

(4) FIG. 3. Time-course of butelase-mediated ligation of peptides 1-4 with peptide 5. The reaction was monitored by HPLC. Reaction conditions: 50 nM butelase 1, 100 peptide 5, corresponding ratios of peptide 1-4, 20 mM phosphate buffer, 1 mM EDTA, pH 6.5, 42° C.

(5) FIG. 4. a) Schematic illustration of the butelase-mediated N-terminal modification of ubiquitin by the use of thiodepsipeptide 1. b) Time-course analysis of ubiquitin labeling reaction. c) ESI spectra of unmodified and modified ubiquitin. d) Deconvoluted ESI spectra of unmodified and modified ubiquitin.

(6) FIG. 5. a) Schematic illustration of the butelase-mediated N-terminal ligation of ubiquitin modified with a short linker peptide by the use of thiodepsipeptide 1. A quantitative ligation yield was obtained as shown by the deconvoluted ESI spectra. b) Schematic illustration of the butelase-mediated N-terminal modification of ubiquitin by the use of thiodepsipeptide 8 which carries a biotin tag. A quantitative ligation yield was obtained with four equivalent of peptide 8 and 0.001 molar equivalent of butelase 1.

(7) FIG. 6. Irreversible butelase-mediated ligation: A novel approach to render the ligation irreversible by using a thiodepsipeptide substrate. A ligation yield of >95% was achieved with a minimal excess of substrate and a low catalytic amount of butelase 1 (0.0005 to 0.001 molar equivalent). This method has been successfully applied to introduce a functional tag to ubiquitin and green fluorescent protein with high yields.

(8) FIG. 7. Butelase-mediated ligation with glycerol. Incubation of a model peptide WRLYRGRLYRRNHV (SEQ ID NO:132) (100 μM) with butelase 1 in the present of 20% glycerol for 2 hours led to formation of three major products: a hydrolyzed product (WRLYRGRLYRRN) (SEQ ID NO:133), a cyclized product

(9) ##STR00002##
and a ligated product with glycerol (WRLYRGRLYRRN—OCH.sub.2(OH)CH.sub.2OH) (SEQ ID NO:135).

(10) FIG. 8. Butelase-mediated ligation with (O)GVYKV peptide (SEQ ID NO:115). A model peptide ERLYRGRLYRRNHV (SEQ ID NO:116) (50 μM) was incubated butelase 1 (50 nM) and (O)GVYKV (SEQ ID NO:115) (5 mM) in 20 mM sodium phosphate buffer, pH 6.0 at 37° C. for 2 h. Analysis by mass spectrometry showed the formation of the ligated product with about 25% yield.

(11) FIG. 9. Degradation time course for thiodepsipeptide 1 and depsipeptide 2. Each peptide (100 μM) was incubated in the absence or presence of butelase 1 (50 nM) at 42° C. The peptide stability was monitored by HPLC every 15 mM.

(12) FIG. 10. a) Schematic illustration of the butelase-mediated N-terminal modification of GFP by the use of thiodepsipeptide 1. b, c) Deconvoluted ESI spectra of GFP before (b) and after (c) the ligation reaction. Unmodified and modified GFP have observed masses of 29406.5 and 29813.7 Da, respectively.

(13) FIG. 11. a) Schematic illustration of the butelase-mediated N-terminal modification of GFP by the use of thiodepsipeptide 8 which carries a biotin tag. b, c) Deconvoluted ESI spectra of GFP before (b) and after (c) the ligation reaction. Unmodified and modified GFP have observed masses of 29406.5 and 30142.6 Da, respectively.

(14) FIG. 12. SDS-PAGE analysis of butelase 1. The gel was visualized by silver staining. The left lane is the purified butelase 1 and the right lane is the protein ladder with molecular weight labeled in kDa.

(15) FIG. 13. Mass spectrum of Peptide 1 YKN-thioglc-V (SEQ ID NO:110). ESI-MS (positive) 595.71 (observed, M+H) 596.21 (calculated, M).

(16) FIG. 14. Mass spectrum of Peptide 2 YKN-glc-V (SEQ ID NO:111). ESI-MS (positive) 580.22 (observed, M+H) 602.37 (observed, M+Na) 618.11 (observed, M+K) 579.30 (calculated, M).

(17) FIG. 15. Mass spectrum of Peptide 4 YKNGV (SEQ ID NO:113). ESI-MS (positive) 579.16 (observed, M+H) 578.66 (calculated, M).

(18) FIG. 16. Mass spectrum of Peptide 3 YKNGV (SEQ ID NO:112). ESI-MS (positive) 659.27 (observed, M+H) 681.41 (observed, M+Na) 659.36 (calculated, M).

(19) FIG. 17. Mass spectrum of Peptide 5 GIGGIR (SEQ ID NO:114). ESI-MS (positive) 571.30 (observed, M+H) 570.69 (calculated, M).

(20) FIG. 18. Mass spectrum of Peptide 8 biotin-TYKN-thioglc-V (SEQ ID NO:117). ESI-MS (positive) 923.34 (observed, M+H) 945.42 (observed, M+Na) 922.40 (calculated, M).

(21) FIG. 19. Butelase-mediated peptide dendrimer synthesis (bivalent format as example), using A) native peptides and B) thiodepsipeptides as acyl donor substrates.

(22) FIG. 20. Schematic presentation of selected peptide dendrimer structures assembled by butelase-mediated bioconjugation. A) bivalent peptide dendrimer (Ac-RYRLNRIβA).sub.2KY; B) tetravalent peptide dendrimer (Ac-RYRLNRIβA).sub.4K.sub.2KY; C) octavalent peptide dendrimer (Ac-RYRLNRIβA).sub.8K.sub.4K.sub.2KY.

(23) FIG. 21. Analytical HPLC monitoring of butelase-mediated peptide dendrimer bioconjuation using A) thiodepsipeptide—peak a: peptide Ac-RYRLN-thioglc-V (SEQ ID NO:118); peak b: desired bivalent product (Ac-RYRLNRIβA).sub.2KY with an observed mass of 2478.5 (calc. 2478.4 Da) or B) normal peptide—peak a′: peptide RYRLNHV (SEQ ID NO:119); peak b′: dendron core (RIβA).sub.2KY; peak c′: the monovalent product; peak d′: the desired bivalent product (RYRLNRIβA).sub.2KY.

(24) FIG. 22. Analytical HPLC monitoring of butelase-mediated preparation of (A) tetravalent dendrimer—peak a: linear peptide Ac-RYRLN-thioglc-V (SEQ ID NO:118); peak b: the desired tetravalent product (Ac-RYRLNRIβA).sub.4K.sub.2KY with an observed mass of 4903.5 Da (calc. 4903.8 Da) and (B) octavalent dendrimer—peak a: linear peptide Ac-RYRLN-thioglc-V (SEQ ID NO:118); peak b′: the desired octavalent product (Ac-RYRLNRIβA).sub.8K.sub.4K.sub.2KY with an observed mass of 9753.4 Da (calc. 9754.7 Da).

(25) FIG. 23. HPLC profile of the ligation between the thiodepsipeptide RYRLN(S)GV (SEQ ID NO: 142) and the bivalent dendron core (RI).sub.2KY in the presence of butelase 1 (100 nM) and TCEP (1 mM) in pH 6.5 20 mM phosphate buffer, 42° C. Peak a refers to the dendron core, peak b refers to thiodepsipeptide, peak c refers to the monovalent product, peak d refers to bivalent product, peak e refers to byproduct caused by self-ligation (inset: MALDI mass spec of desired bivalent product).

(26) FIG. 24. SDS-PAGE (silver staining) of isolated butelase 1 (left lane) and protein markers (right lane).

(27) FIG. 25. Mass spectrum of RYRLN(S)GV-NH.sub.2 (SEQ ID NO: 136). ESI-MS (positive) 893.45 (observed, M+H) 893.5 (calculated, M+H).

(28) FIG. 26. Mass spectrum of Ac-RYRLN(S)GV-NH.sub.2 (SEQ ID NO:137). MALDI-MS 935.5 (observed, M+H) 935.5 (calculated, M+H).

(29) FIG. 27. Mass spectrum of Ac-RLYRN(S)GV—NH.sub.2 (SEQ ID NO:138). ESI-MS (positive) 935.50 (observed, M+H) 1048.82 (observed, M+TFA) 935.5 (calculated, M+H).

(30) FIG. 28. Mass spectrum of RLRY—NH.sub.2 (SEQ ID NO:139). ESI-MS (positive) 606.52 (observed, M+H) 719.83 (observed, M+TFA) 606.4 (calculated, M+H).

(31) FIG. 29. Mass spectrum of RYRLNHV—NH.sub.2 (SEQ ID NO:140). ESI-MS (positive) 956.68 (observed, M+H) 1069.94 (observed, M+Na) 956.5 (calculated, M).

(32) FIG. 30. Mass spectrum of (RIβA).sub.2KY—NH.sub.2 ESI-MS (positive) 989.76 (observed, M+H) 1103.00 (observed, M+TFA) 989.6 (calculated, M+H).

(33) FIG. 31. Mass spectrum of (RIβA).sub.8K.sub.2KY—NH.sub.2 MALDI-MS 1926.1 (observed, M+H) 1926.3 (calculated, M).

(34) FIG. 32. Mass spectrum of (RIβA).sub.8K.sub.4K.sub.2KY—NH.sub.2. MALDI-MS 3799.6 (observed, M+H) 3799.5 (calculated, M+H).

(35) FIG. 33. Mass spectrum of (Ac-RLYRNRIβA).sub.2KY—NH.sub.2. MALDI-MS 2478.5 (observed, M+H) 2478.4 (calculated, M+H).

(36) FIG. 34. Mass spectrum of (Ac-RLYRNRIβA).sub.4K.sub.2KY—NH.sub.2. MALDI-MS 4905.2 (observed, M+H) 4903.8 (calculated, M+H).

(37) It should be noted that a significant percentage of peptide being hydrolyzed or reacting with glycerol instead of intramolecular cyclization as the model peptide contains an Arg at the second position which is not preferred by butelase 1 for cyclization.

DETAILED DESCRIPTION OF THE INVENTION

(38) The following detailed description refers to, by way of illustration, specific details and embodiments in which the invention may be practiced. These embodiments are described in sufficient detail to enable those skilled in the art to practice the invention. Other embodiments may be utilized and structural, and logical changes may be made without departing from the scope of the invention. The various embodiments are not necessarily mutually exclusive, as some embodiments can be combined with one or more other embodiments to form new embodiments.

(39) Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. The singular terms “a,” “an,” and “the” include plural referents unless context clearly indicates otherwise. Similarly, the word “or” is intended to include “and” unless the context clearly indicates otherwise. The term “comprises” means “includes.” In case of conflict, the present specification, including explanations of terms, will control.

(40) The object of the present invention is to provide a technique for ligating peptides, taking advantage of the superior site specificity and catalytic efficiency of butelase 1-like Asx-specific protein ligases.

(41) To this end, provided in a first aspect of the present disclosure is a method of forming a peptide of Formula (I)
P.sup.1-Asx-Xaa.sup.1-Xaa.sup.2-P.sup.2  (I)
by ligating a first peptide of Formula (II)
P.sup.1-Asx-X—R  (II)
to a second peptide of Formula (III)
Xaa.sup.1-Xaa.sup.2-P.sup.2  (III), wherein P.sup.1 and P.sup.2 are each independently any peptide, modified or unmodified; Asx is Asp or Asn, preferably Asn; X is O or S, preferably S; R is a substituted or unsubstituted alkyl, preferably selected from the group consisting of —(CH.sub.2).sub.n—CONH.sub.2, —(CH.sub.2).sub.n—COOH, —(CH.sub.2)—CO-AA.sup.1,

(42) ##STR00003## wherein n is an integer of 1 to 10, R.sub.1 is H, or any other side chain of a naturally occurring amino acid, and AA.sup.1 is any amino acid or is absent; Xaa.sup.1 is any naturally occurring amino acid with the exception of Pro; Xaa.sup.2 is any naturally occurring amino acid, but preferably is a hydrophobic amino acid or Cys, more preferably Val, Ile, Leu, or Cys,
by enzymatically cleaving the bond between “Asx” and “X” in the first peptide of Formula (II) and ligating the fragment P.sup.1-Asx of the first peptide to the second peptide of Formula (III) to form a ligated peptide of Formula (I), wherein the enzymatic cleavage and ligation reaction is catalyzed by a polypeptide having the activity of butelase 1 (SEQ ID NO:1) under conditions allowing said ligation.

(43) It is also envisaged that, when the first peptide and the second peptide are the same peptide, the presently disclosed method cyclizes said peptide.

(44) In the whole context of the present application, the terms “polypeptide”, “peptide” and “protein” are used interchangeably to refer to polymers of amino acids of any length connected by peptide bonds. The polymer may comprise modified amino acids, it may be linear or branched, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation to a labeling component.

(45) The term “amino acid” refers to natural and/or unnatural or synthetic amino acids, including both the D and L optical isomers, amino acid analogs (for example norleucine is an analog of leucine) and peptidomimetics. The term “naturally occuring amino acid”, as used herein, relates to the 20 naturally occuring L-amino acids, namely Gly, Ala, Val, Leu, Ile, Phe, Cys, Met, Pro, Thr, Ser, Glu, Gln, Asp, Asn, His, Lys, Arg, Tyr, and Trp. The term “peptide bond” refers to a covalent amide linkage formed by loss of a molecule of water between the carboxyl group of one amino acid and the amino group of a second amino acid. For example, the “-” between P.sup.1 and Asx in Formula (II), as well as all “-” in Formulae (I) and (III) represent peptide bonds. The “-” between X and R in Formula (II) represents a covalent bond. In addition, the “-” between C(O) and AA.sup.1 in —(CH.sub.2)—CO-AA.sup.1, —CH(R.sub.1)—CO-AA.sup.1, and —CH.sub.2—C.sub.6H.sub.4—CO-AA.sup.1 represents a covalent bond between the carbonyl group and the amino group of AA.sup.1, i.e. the carbonyl group shown and the amino group of AA.sup.1 also form a peptide bond. Generally, in all formulae depicted herein, the peptides are shown in the N- to C-terminal orientation.

(46) The term “hydrophobic amino acid”, as used herein, refers to an amino acid selected from the group consisting of Ala, Gly, Ile, Leu, Met, Phe, Pro, Trp, and Val.

(47) The term “amino acid side chain” as used herein refers to a moiety attached to the α-carbon in an amino acid, preferably a naturally occuring amino acid. For example, the amino acid side chain may be methyl, isopropyl, 1-methylpropyl, 2-methylpropyl, benzyl, methyl(4-hydroxyphenyl), hydroxymethyl, 1-hydroxy-ethyl, carboxymethyl, 2-carboxyethyl, etc.

(48) The term “alkyl”, as used herein, refers to a linear, branched, or cyclic saturated hydrocarbon group. The term “unsubstituted” means that the specified group bears no substituents but the respective positions are occupied by hydrogen atoms only. By “substituted” as in “substituted alkyl” is meant that in the alkyl at least one hydrogen atom bound to a carbon (or other) atom is replaced with one or more non-hydrogen substituents. Examples of such substituents include, without limitation: functional groups such as halo, hydroxyl, sulfhydryl, C.sub.1-C.sub.24 alkoxy, C.sub.2-C.sub.24 alkenyloxy, C.sub.2-C.sub.24 alkynyloxy, C.sub.5-C.sub.20 aryloxy, acyl (including C.sub.2-C.sub.24 alkylcarbonyl (—CO-alkyl) and C.sub.6-C.sub.20 arylcarbonyl (—CO-aryl), acyloxy (—O-acyl), C.sub.2-C.sub.24 alkoxycarbonyl (—(CO)—O-alkyl), C.sub.6-C.sub.20 aryloxycarbonyl (—(CO)—O-aryl), halocarbonyl (—CO)—X where X is halo), C.sub.2-C.sub.24 alkylcarbonato (—O—(CO)—O-alkyl), C.sub.6-C.sub.20 arylcarbonato (—O—(CO)—O-aryl), carboxy (—COOH), carboxylato (—COO.sup.−), carbamoyl (—(CO)—NH.sub.2), mono-(C.sub.1-C.sub.24 alkyl)-substituted carbamoyl (—(CO)—NH(C.sub.1-C.sub.24 alkyl)), di-(C.sub.1-C.sub.24 alkyl)-substituted carbamoyl (—(CO)—N(C.sub.1-C.sub.24 alkyl).sub.2), mono-substituted arylcarbamoyl (—(CO)—NH-aryl), thiocarbamoyl (—(CS)—NH.sub.2), carbamido (—NH—(CO)—NH.sub.2), cyano (—C≡N), isocyano (—N.sup.+≡C.sup.−), cyanato (—O—C≡N), isocyanato (—O—N.sup.+≡C.sup.−), isothiocyanato (—S—C≡N), azido (—N═N.sup.+═N.sup.−), formyl (—(CO)—H), thioformyl (—(CS)—H), amino (—NH.sub.2), mono- and di-(C.sub.1-C.sub.24 alkyl)-substituted amino, mono- and di-(C.sub.5-C.sub.20 aryl)-substituted amino, C.sub.2-C.sub.24 alkylamido (—NH—(CO)-alkyl), C.sub.6-C.sub.20 arylamido (—NH—(CO)-aryl), imino (—CR═NH where R=hydrogen, C.sub.1-C.sub.24 alkyl, C.sub.5-C.sub.20 aryl, C.sub.6-C.sub.24 alkaryl, C.sub.6-C.sub.24 aralkyl, etc.), alkylimino (—CR═N(alkyl), where R=hydrogen, alkyl, aryl, alkaryl, etc.), arylimino (—CR═N(aryl), where R=hydrogen, alkyl, aryl, alkaryl, etc.), nitro (—NO.sub.2), nitroso (—NO), sulfo (—SO.sub.2—OH), sulfonate (—SO.sub.2—O.sup.−), C.sub.1-C.sub.24 alkylsulfanyl (—S-alkyl; also termed “alkylthio”), arylsulfanyl (—S-aryl; also termed “arylthio”), C.sub.1-C.sub.24 alkylsulfinyl (—(SO)-alkyl), C.sub.5-C.sub.20 arylsulfinyl (—(SO)-aryl), C.sub.1-C.sub.24 alkylsulfonyl (—SO.sub.2-alkyl), C.sub.5-C.sub.20 arylsulfonyl (—SO.sub.2-aryl), phosphono (—P(O)(OH).sub.2), phosphonato (—P(O)(O.sup.−).sub.2), phosphinato (—P(O)(O.sup.−)), phospho (—PO.sub.2), and phosphino (—PH.sub.2); and the hydrocarbyl moieties C.sub.1-C.sub.24 alkyl (preferably C.sub.1-C.sub.18 alkyl, more preferably C.sub.1-C.sub.12 alkyl, most preferably C.sub.1-C.sub.6 alkyl), C.sub.2-C.sub.24 alkenyl (preferably C.sub.2-C.sub.18 alkenyl, more preferably C.sub.2-C.sub.12 alkenyl, most preferably C.sub.2-C.sub.6 alkenyl), C.sub.2-C.sub.24 alkynyl (preferably C.sub.2-C.sub.18 alkynyl, more preferably C.sub.2-C.sub.12 alkynyl, most preferably C.sub.2-C.sub.6 alkynyl), C.sub.5-C.sub.20 aryl (preferably C.sub.5-C.sub.14 aryl), C.sub.6-C.sub.24 alkaryl (preferably C.sub.6-C.sub.18 alkaryl), and C.sub.6-C.sub.24 aralkyl (preferably C.sub.6-C.sub.18 aralkyl). In addition, the aforementioned functional groups may, if a particular group permits, be further substituted with one or more additional functional groups. By “(C.sub.x-C.sub.y)” (x and y being two different integers) is meant that the group contains x to y carbon atoms.

(49) Without wishing to be bound to any particular theory, applicant believes that, the sorting signal HX—R, e.g. HXC(HR.sub.1)C(O)-AA.sup.1, cleaved off from the first peptide is a non-substrate of the polypeptide having the ligase activity of butelase 1 (SEQ ID NO:1), consequently rendering the ligation process essentially irreversible.

(50) In various embodiments, Asx is Asp or Asn, X is O or S, R is —CH(R.sub.1)—CO-AA.sup.1, R.sub.1 is H, or any other side chain of a naturally occurring amino acid, and AA.sup.1 is any amino acid or is absent. Accordingly, the sorting signal HX—R (i.e. HX—C(HR.sub.1)—C(O)-AA.sup.1) is a modified peptide wherein the amino group of the first amino acid is substituted by —O— or —S—. When AA.sup.1 is absent, the sorting signal HX—C(HR.sub.1)C(O)-AA.sup.1 is HXC(HR.sub.1)C(O)OH.

(51) In preferred embodiments, Asx is Asn, X is S, R is —CH(R.sub.1)—CO-AA.sup.1, R.sub.1 is H, and AA.sup.1 is any amino acid or absent. In this case, the sorting signal is HS—CH.sub.2C(O)-AA.sup.1, which is a thiodepsipeptide.

(52) In particularly preferred embodiments, Asx is Asn, X is S, R is —CH(R.sub.1)—CO-AA.sup.1, R.sub.1 is H, and AA.sup.1 is Val. In this case, the sorting signal is H—S—CH.sub.2C(O)-Val, herein denoted as H-thioglc-Val. Accordingly, “thioglc”, as used herein, represents the structure —S—CH.sub.2C(O)—.

(53) A polypeptide according to the present invention possesses the ligase activity of butelase 1 (SEQ ID NO:1) as described in International Patent Publication No. WO2015163818 A1, which is hereby incorporated by reference in its entirety.

(54) The polypeptide is utilizable for enzymatic coupling and has an ability to site-specifically break a peptide bond and then reform a new bond with an incoming nucleophile. It is “Asx-specific” in that the amino acid C-terminal to which ligation occurs, i.e. the C-terminal end of the peptide that is ligated, is either Asn or Asp, preferably Asn. As set forth above, it recognizes the motif Asx-X—R, at the C-terminus of the first peptide of Formula (II), and mediates peptide ligation by cleaving off the sorting signal HX—R and ligating P.sup.1-Asx to the N-terminal residue of the second peptide Xaa.sup.1-Xaa.sup.2-P.sup.2 to form a ligated peptide P.sup.1-Asx-Xaa.sup.1-Xaa.sup.2-P.sup.2.

(55) In various embodiments, the polypeptide comprises or consists of the amino acid sequence as set forth in SEQ ID NO:1 (butelase 1).

(56) In various embodiments, the polypeptide comprises or consists of an amino acid sequence that is at least 60%, 65%, 70%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 90.5%, 91%, 91.5%, 92%, 92.5%, 93%, 93.5%, 94%, 94.5%, 95%, 95.5%, 96%, 96.5%, 97%, 97.5%, 98%, 98.5%, 99%, 99.25%, or 99.5% identical or homologous to the amino acid sequence set forth in SEQ ID NO:1 over its entire length. In some embodiments, it has an amino acid sequence that shares at least 60, preferably at least 70, more preferably at least 80, most preferably at least 90% sequence identity with the amino acid sequence set forth in SEQ ID NO:1 over its entire length or has an amino acid sequence that shares at least 80, preferably at least 90, more preferably at least 95% sequence homology with the amino acid sequence set forth in SEQ ID NO:1 over its entire length.

(57) In various embodiments, the polypeptide may be a precursor of the mature enzyme. In such embodiments, it may comprise or consist of the amino acid sequence set forth in SEQ ID NO:2. Also encompassed are polypeptides having an amino acid sequence that is at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 90.5%, 91%, 91.5%, 92%, 92.5%, 93%, 93.5%, 94%, 94.5%, 95%, 95.5%, 96%, 96.5%, 97%, 97.5%, 98%, 98.5%, 99%, 99.25%, or 99.5% identical or homologous to the amino acid sequence set forth in SEQ ID NO:2 over its entire length.

(58) The identity of nucleic acid sequences or amino acid sequences is generally determined by means of a sequence comparison. This sequence comparison is based on the BLAST algorithm that is established in the existing art and commonly used (cf. for example Altschul et al. (1990) “Basic local alignment search tool”, J. Mol. Biol. 215:403-410, and Altschul et al. (1997): “Gapped BLAST and PSI-BLAST: a new generation of protein database search programs”; Nucleic Acids Res., 25, p. 3389-3402) and is effected in principle by mutually associating similar successions of nucleotides or amino acids in the nucleic acid sequences and amino acid sequences, respectively. A tabular association of the relevant positions is referred to as an “alignment.” Sequence comparisons (alignments), in particular multiple sequence comparisons, are commonly prepared using computer programs which are available and known to those skilled in the art.

(59) A comparison of this kind also allows a statement as to the similarity to one another of the sequences that are being compared. This is usually indicated as a percentage identity, i.e. the proportion of identical nucleotides or amino acid residues at the same positions or at positions corresponding to one another in an alignment. The more broadly construed term “homology”, in the context of amino acid sequences, also incorporates consideration of the conserved amino acid exchanges, i.e. amino acids having a similar chemical activity, since these usually perform similar chemical activities within the protein. The similarity of the compared sequences can therefore also be indicated as a “percentage homology” or “percentage similarity.” Indications of identity and/or homology can be encountered over entire polypeptides or genes, or only over individual regions. Homologous and identical regions of various nucleic acid sequences or amino acid sequences are therefore defined by way of matches in the sequences. Such regions often exhibit identical functions. They can be small, and can encompass only a few nucleotides or amino acids. Small regions of this kind often perform functions that are essential to the overall activity of the protein. It may therefore be useful to refer sequence matches only to individual, and optionally small, regions. Unless otherwise indicated, however, indications of identity and homology herein refer to the full length of the respectively indicated nucleic acid sequence or amino acid sequence.

(60) In various embodiments, the polypeptide described herein comprises the amino acid residue Asn at the position corresponding to position 19 of SEQ ID NO:1; and/or the amino acid residue His at the position corresponding to position 124 of SEQ ID NO:1; and/or the amino acid residue Cys at the position corresponding to position 166 of SEQ ID NO:1. It has been found that these amino acid residues putatively play a role in the catalytic activity of the polypeptide. In preferred embodiments, the polypeptides thus comprise at least two, more preferably all three of the above indicated residues at the given or corresponding positions.

(61) While it is recognized that various polypeptides as described above may be suitable for the practice of the present invention, it is preferable to use one with potent protein ligase actively. In various embodiments, this means that it can ligate a given peptide with an efficiency of at least 50%, more preferably at least 70%, most preferably at least 90%. The protein ligation reaction is preferably comparably fast, i.e. said polypeptide can ligate two given peptides with a K.sub.m of 500 μM or less, preferably 250 μM or less; and/or a k.sub.cat of at least 0.05 s.sup.−1, preferably at least 0.5 s.sup.−1, more preferably at least 1.0 most preferably at least 1.5 s.sup.−1. Preferred polypeptides satisfy both requirements, i.e. the K.sub.m and k.sub.cat requirement. Methods to determine such Michaelis-Menten kinetics are well known in the art and can be routinely applied by those skilled in the art. It is preferred that the polypeptides of the invention have at least 50%, more preferably at least 70%, most preferably at least 90% of the protein ligase activity of the enzyme having the amino acid sequence of SEQ ID NO:1.

(62) Polypeptides according to the present application can comprise amino acid modifications, in particular amino acid substitutions, insertions, or deletions. Such polypeptides are, for example, further developed by targeted genetic modification, i.e. by way of mutagenesis methods, and optimized for specific purposes or with regard to special properties (for example, with regard to their catalytic activity, stability, etc.). The objective may be to introduce targeted mutations, such as substitutions, insertions, or deletions, into the known molecules in order, for example, to alter substrate specificity and/or improve the catalytic activity. For this purpose, in particular, the surface charges and/or isoelectric point of the molecules, and thereby their interactions with the substrate, can be modified. Alternatively or additionally, the stability of the polypeptide can be enhanced by way of one or more corresponding mutations, and its catalytic performance thereby improved. Advantageous properties of individual mutations, e.g. individual substitutions, can supplement one another.

(63) In various embodiments, the polypeptide may be characterized in that it is obtainable from a polypeptide as described above as an initial molecule by single or multiple conservative amino acid substitution. The term “conservative amino acid substitution” means the exchange (substitution) of one amino acid residue for another amino acid residue, where such exchange does not lead to a change in the polarity or charge at the position of the exchanged amino acid, e.g. the exchange of a nonpolar amino acid residue for another nonpolar amino acid residue. Conservative amino acid substitutions in the context of the invention encompass, for example, G=A=S, I=V=L=M, D=E, N=Q, K=R, Y=F, and S=T.

(64) Alternatively or additionally, the polypeptide may be characterized in that it is obtainable from a polypeptide contemplated herein as an initial molecule by fragmentation or by deletion, insertion, or substitution mutagenesis, and encompasses an amino acid sequence that matches the initial molecule over a length of at least 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 325, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, or 342 continuously connected amino acids. It is preferred that in such embodiments, the amino acids Asn19, His124 and Cys166 contained in the initial molecule are still present.

(65) In various embodiments, the present invention thus also relates to fragments of the polypeptides described herein, with said fragments retaining enzymatic activity. It is preferred that they have at least 50%, more preferably at least 70, most preferably at least 90% of the protein ligase and/or cyclase activity of the initial molecule, preferably of the polypeptide having the amino acid sequence of SEQ ID NO:1. The fragments are preferably at least 150 amino acids in length, more preferably at least 200 or 250, most preferably at least 300. It is further preferred that these fragments comprise the amino acids Asn, His and Cys at positions corresponding to positions 19, 124 and 166 of SEQ ID NO: 1. Preferred fragments therefore comprise amino acids 19-166, more preferably 10-200, most preferably 1-277 of the amino acid sequence set forth in SEQ ID NO:1.

(66) As set forth above, the peptides to be ligated in accordance with the present application may be modified by, for example, conjugation to a labeling component, either covalently or non-covalently. A labeling component may be any molecules such as, without limitation, an affinity tag, detectable label, solid support material, or scaffold molecule. The modified peptides may be prepared using standard techniques known to those skilled in the art of synthetic organic chemistry, or may be deduced by reference to the pertinent literature.

(67) In various embodiments, P.sup.1 or P.sup.2 is modified by an affinity tag, a detectable label, a solid support material, a scaffold molecule.

(68) In various embodiments, P.sup.1 or P.sup.2 is modified by a biotin, a fluorescent marker, a polymer resin, or a dendrimer.

(69) In various embodiments, P.sup.1 or P.sup.2 is modified by a dendrimer.

(70) In various embodiments, each dendrimer is conjugated to 2 or more copies of the second peptide via P.sup.2, such that the ligation of the first peptide and the second peptide results in a dendrimeric peptide assembly comprising 2 or more copies of the ligated peptide P.sup.1-Asx-Xaa.sup.1-Xaa.sup.2-P.sup.2.

(71) The term “affinity tag” as used herein refers to a moiety such as biotin that can be used to separate a molecule to which the affinity tag is attached from other molecules that do not contain the affinity tag.

(72) The term “detectable label” is intended to mean at least one label capable of directly or indirectly generating a detectable signal. In non-limiting examples, a detectable label can be an enzyme producing a detectable signal, for example by colorimetry, fluorescence or luminescence; a chromophore, such as a fluorescent, luminescent or dye compound, e.g. GFP; a group with an electron density detectable by electron microscopy or by virtue of their electrical property, such as conductivity, amperometry, voltammetry or impedance; detectable group, for example the molecules of which are sufficiently large to induce detectable modifications of their physical and/or chemical characteristics (this detection can be carried out by optical methods such as diffraction, surface plasmon resonance, surface variation or contact angle variation, or physical methods such as atomic force spectroscopy or the tunnel effect; or a radioactive molecule such as .sup.32P, .sup.35S or .sup.125I.

(73) The term “solid support material” as used herein refers to conventional solid supports for the synthesis of peptides, which are well known for the skilled in the art. The nature of the solid support is not particularly restricted and may be an inorganic substance or an organic substance such as a cross-linked polymer.

(74) The term “scaffold molecule” as used herein refers to a compound to which other moieties are attached (e.g., conjugated). Various scaffold molecules, e.g. dendrimers, are well known in the art.

(75) The term “dendrimer” refers to polymers having a regular branched structure of a fractal nature. Dendrimers are well known in the art. For the purpose of this application, dendrimers include, without limitation, hyperbranched polymers, dendrigraft polymers, tecto-dendrimers, core-shell (tecto)dendrimers, hybrid linear-dendritic copolymers, dendronized polymers, dendrimer-based supramolecular assemblies, and dendrimer-functionalized solid particles, which are within the purview of one of skill in the art.

(76) Dendrimers have a core from which the inner branches emanate. Further branches may emanate from the inner branches and so forth. Distal from the core are the terminal branches, i.e., branches from which no further branches emanate. The periphery is defined as that portion of the dendrimeric polymer attached to the distal branches from which no further branches emanate. The periphery consists of the collection of terminal chains, i.e., that portion of the dendrimeric polymer distal from the terminal branches and ending with the chain ends. As an inherent consequence of their fractal nature, dendrimers may have a large number of functional groups at their chain ends. It is the chain ends that interact with the environment of the dendrimer and impart the properties of the dendrimer. The terms “chain end” and “functional group” are somewhat synonymous. However, the term “chain end” emphasizes the physical location of a section of the dendrimer; and the term “functional group” emphasizes the physical properties imparted by the “chain end”. The “functional group” may be any chemical moiety compatible for use as “chain end”.

(77) Dendrimers possess many advantages including well-defined structure, mono-dispersity, multi-valency and ease of surface functionalization and provide a flexible polymeric scaffold to incorporate one or more types of peptides for enzymatic conjugation thereto.

(78) In preferred embodiments, the dendrimer is a lysyl dendrimer.

(79) Lysyl dendrimers according to the present invention are, as well known in the art, molecules with a tree-like structure whereby the branching is formed of repetitive lysine units. However, lysyl dendrimers may not exclusively consist of lysine units only, but may also involve other units as linkers such as 1,6-hexandiamine or dithioacetylhexan diamine between two lysine branches.

(80) In accordance with the present application, every terminal lysine of a lysyl dendrimer provides two amino groups that may be used for coupling of a second peptide of the present application, to which a first peptide carrying a C-terminal Asx motif of Formula (II) may be ligated as mediated by a polypeptide having the ligase activity of butelase 1 (SEQ ID NO:1) to generate a bi- or multi-valent peptide-dendrimer conjugate. Alternatively, the lysyl dendrimer may comprise a first peptide having a C-terminal Asx motif, while the peptide for conjugation to said dendrimer may bear a N-terminal acceptor sequence as described above.

(81) In addition, one skilled in the art would readily appreciate that, using the presently disclosed method, a dendrimer may be conjugated to 2 or more different types of peptides.

(82) In various embodiments, the first peptide is P.sup.1-Asn-thioglc-Val, and P.sup.1 is an antimicrobial peptide.

(83) The term “antimicrobial peptide” as used herein refers to any peptide with antimicrobial activity. The term “antimicrobial activity” refers to the ability of a peptide of the present invention to modify a function or metabolic process of a target microorganism, for example so as to at least partially affect replication, vegetative growth, toxin production, survival, viability in a quiescent state, or other attribute. In an embodiment, the term relates to inhibition of growth of a microorganism. In a particular embodiment, antimicrobial activity relates to the ability of a peptide to kill at least one bacterial species. Non-limiting examples of antimicrobial peptides include all those available in the APD (http://aps.unmc.edu/AP/main.php) and LAMP (http://biotechlab.fudan.edu.cn/database/lamp/) databases, which are hereby incorporated by reference in their entirety.

(84) In various embodiments, P.sup.1 is an antimicrobial peptide comprising a BHHB (each B represents a basic amino acid; each H represents a hydrophobic amino acid) tetrapeptide motif.

(85) In various embodiments, P.sup.1 is an antimicrobial peptide comprising an Arg-Leu-Tyr-Arg (SEQ ID NO:121) tetrapeptide.

(86) In various embodiments, the first peptide is Ac-Arg-Leu-Tyr-Arg-Asn-thioglc-Val (SEQ ID NO:120). By “Ac-Arg” is meant acetyl Arginine.

(87) In various embodiments, the second peptide is Arg-Ile-βAla conjugated to a lysyl dendrimer via βAla.

(88) In various embodiments, the first peptide is Ac-Arg-Leu-Tyr-Arg-Asn-thioglc-Val (SEQ ID NO:120), and each lysyl dendrimer is conjugated to 2 or more copies of the second peptide Arg-Ile-βAla via βAla, such that the ligation of the first peptide and the second peptide results in a dendrimeric peptide assembly comprising 2 or more copies of Ac-Arg-Leu-Tyr-Arg-Asn-Arg-Ile-βAla (SEQ ID NO:112).

(89) In a second aspect, the invention provides peptides prepared using the presently disclosed method.

(90) In a third aspect, the invention provides dendrimeric peptide assembly prepared using the presently disclosed method.

(91) In a fourth aspect, the invention provides use of the presently disclosed dendrimeric peptide assembly as a vaccine, medicament, or diagnostic agent. For administration, the composition may be dispersed in a pharmaceutically acceptable adjuvant or carrier.

(92) In a final aspect, the invention provides use of the presently disclosed dendrimeric peptide assembly as an antimicrobial agent.

(93) The present invention is further illustrated by the following examples. However, it should be understood, that the invention is not limited to the exemplified embodiments.

EXAMPLES

Example 1: Site-Specific N-Terminal Labeling of Peptides and Proteins Using Butelase 1 and Thiodepsipeptide

(94) A. Materials and Reagents

(95) Amino acids, coupling reagents and resins were obtained from Chemimpex, Novabiochem and GL Biochem. All other chemical reagents were of analytical grade, and were obtained from Sigma Aldrich, Alfa Aesar and Acros Organics. All solvents and chemicals were used as received without purification unless otherwise indicated. Mouse anti-ubiquitin antibody was obtained from Santa Cruz biotechnology, anti-mouse secondary antibody was purchased from Dako, and anti-biotin, HRP-linked antibody was from Cell Signaling Technology.

(96) B. High Performance Liquid Chromatography (HPLC)

(97) Analytical RP-HPLC was run on a Nexera LC-30AD instrument (Shimadzu) with an analytical column (Aeris peptide XB—C18, 4.6×250 mm). Semi-preparative HPLC was performed on a Shimadzu system using a Jupiter C18 column (5 micron, 10×250 mm). All HPLC runs were done using the mixture of two solutions, A (0.045% TFA in water) and B (0.045% TFA in acetonitrile). UV detection was carried out at 220 Inn wave length.

(98) C. Mass Spectrometry

(99) Electrospray ionisation mass spectrometry (ESI-MS) was performed on a Thermo Finnigan LCQ DECA XP MAX or a Q Exative hybrid quadrupole-Orbitrap (Thermo Fisher). The deconvoluted data were obtained using the software of MegTran 1.03 and ESIProt 1.0.

(100) D. Cloning and Expression of Recombinant Proteins

(101) TABLE-US-00001 Ubiquitin (Met-Gly-Ile-Ubiquitin-His.sub.6) (SEQ ID NO: 122): MGIMQIFVKTLIGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAG KQLEDGRTLSDYNIQKESTLHLVLRLRGGHHHHHH Green fluorescent protein (Met-Ile-His.sub.6-GFP): (SEQ ID NO: 123): MIHHHHHHSGVDLGTENLYFQSMSKGEELFTGVVPILVELDGDVNGHK FSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPD HMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELK GIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFIIRHNIEDGSV QLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTA AGITLGMDELYK Ubiquitin (Met-GISGSGS-Ubiquitin-His.sub.6) (SEQ ID NO: 124): MGISGSGSQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRL IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGHHHHHH

(102) Ubiquitin with two residues Gly-Ile added after the start codon (SEQ ID NO:122) was cloned into the pET3b vector (inserted residues were underlined). Green fluorescent protein with an additional Ile residue inserted after the start codon (SEQ ID NO:123) was cloned into the pNIC28-Bsa4 vector. The constructed plasmids were transformed into E. coli BL21 (DE3) competent cells for expression. Single colony was inoculated into 10 ml LB medium supplemented with ampicillin (for pET3b vector) or kanamycin (for pNIC28-Bsa4 vector) at 37° C. overnight. The cultures were transferred into 1 l of LB medium containing antibiotics until the OD600 reached ˜0.6. IPTG was then added to a final concentration of 0.3 mM to induce the expression of the recombinant proteins at 18° C. overnight. Cells were harvested and lysed in PBS buffer (10 mM sodium phosphate, 150 mM NaCl, pH 7.4) by sonication. The lysates were filtered and loaded into the Ni-NTA column (Qiagen) for affinity purification.

(103) E. Isolation and Purification of Butelase 1

(104) The entire purification process of butelase 1 was conducted at 4° C. to minimize protein degradation. About 500 gram pods of Clitoria ternatea was blended with one liter of extraction buffer (20 mM sodium phosphate, 1 mM EDTA, 1 mM PMSF, and 5 mM mercaptoethanol (β-ME), pH 6.0). The homogenate was centrifuged at 9000 rpm for 15 minutes by using Beckman coulter Avanti™ J-25 centrifuge, with JA-10 rotor. The supernatant was then filtered and ammonium sulfate was added to reach 15% saturation. The supernatant was then centrifuged and the precipitated proteins were discarded. Ammonium sulfate was further added to reach the final concentration of 85%. The solution was then centrifuged and the precipitated proteins were redissolved in 500 ml of extraction buffer. The dissolved solution was dialyzed against extraction buffer using Snakeskin dialysis tubing with a 10 kDa molecular weight cut-off (MWCO). The dialyzed extract was filtered and loaded to the flash chromatography column with Q Sepharose Fast Flow anion exchange resin (GE Healthcare). The column was washed with one litre of wash buffer (10 mM sodium phosphate, 1 mM EDTA and 5 mM β-ME, pH 6.0) and eluted with 500 ml elution buffer (0.5 M NaCl, 10 mM sodium phosphate, 1 mM EDTA and 5 mM β-ME, pH 6.0). The eluent was dialyzed against wash buffer and subject to fractionation by HPLC using a preparative anion exchange column (PolyWAX LP, PolyLC). Fractions contain ligase activity were pooled and concentrated to a final volume of 3 ml using Amicon Ultra centrifugal filter (Millipore Ireland Ltd) of 10 kDa MWCO. The concentrated solution was subjected to size exclusion chromatography using a Biosuite HPLC column (21.5×300 mm) and further purified by anion exchange chromatography using analytical PolyWax HPLC column (Poly LC, 4.6×250 mm). The purity of the isolated butelase 1 was determined by SDS-PAGE and silver staining (FIG. 12). Approximately 0.5 mg butelase 1 can be obtained from 500 gram plant materials.

(105) F. Synthesis of Trityl-Protected Thioglycolic Acid

(106) Triphenylmethanol (805 mg, 3 mmol) was mixed with thioglycolic acid (208.4 μl, 3 mmol) in the presence of neat trifluoroacetic acid (TFA, 4 mL). The reaction was stirred at room temperature for 30 min. After removal of TFA in vacuo, toluene was added to removal the residual water. After complete removal of solution in the reaction mixture, desired product was obtained as white powder in quantitative yield and it was used in the following SPPS without further purification.

(107) G. Peptide Synthesis

(108) All native peptides 3, 4, 5 were synthesized using standard Fmoc chemistry on rink-amide-MBHA resin (0.7 mmol/g). Before the synthesis, the resin was pre-swelled in dichloromethane (DCM) for 10 min. Fmoc group removal was done using 20% piperidine in dimethylformamide (DMF) for 2 min and another 20 min. After deprotection, the resin was washed with DMF, DCM, and DMF alternatively. For the coupling reaction, 4 eq. of Fmoc-AA-OH, 4 eq. of PyBOP were first dissolved in DMF/DCM mixture and added to the resin. 8 eq. of DIEA was then added in. Coupling reaction was carried out for about 60-90 min. Coupling efficiency could be monitored by using Kaiser test After the whole sequence was assembled, the peptide was cleaved from the solid support using a cleavage solution of 95% TFA, 2.5% water and 2.5% TIS for 1 h. Precipitated by cold ether, the crude peptides were purified by HPLC. The desired products were identified using ESI-MS. After lypholization, peptides were obtained in powder form, which could be used freshly or stored at −20° C. for further use.

(109) The depsipeptide 2 and 6 were also synthesized using standard Fmoc chemistry on rink amide MBHA resin. Building block used were Fmoc-Tyr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Asn(Trt)-OH, glycolic acid, Fmoc-Val-OH. The difference of this synthesis from the above native peptide synthesis was the coupling of glycolic acid and the subsequent Fmoc-Asn(Trt)-OH. As for glycolic acid coupling, 4 eq, of glycolic acid and 4 eq. of PyBOP dissolved in DMF/DCM were first added to the resin. 8 eq. of DIEA was subsequently added in. After coupling for 2 h, a 30 min treatment of 10% hydrazine/DMF was used for removal of the over-coupled glycolic acid. To couple the next amino acid Fmoc-Asn(Trt)-OH, instead of PyBOP, a stronger coupling condition DIC/HOBT was employed. The resin was first suspended in DCM/DMF mixture (9:1 v/v). 5 eq. of Fmoc-Asn(Trt)-OH and 5 eq. of HOBT were dissolved in a minimum amount of DMF facilitated by vortex and sonication. After adding the solution to the resin, 5 eq. of DIC was added followed by 0.1 eq. of DMAP. The reaction was shaken for overnight. 5% acetic anhydride in pyridine was used to cap the uncoupled hydroxyl groups for 30 min.

(110) Both thiodepsipeptides 1 and 8 were synthesized using standard Boc chemistry on MBHA resin (1.03 mmol/g). The Boc chemistry differs from Fmoc chemistry in the way of deprotection and final cleavage. For Boc deprotection, 30% TFA in DCM was used to remove Boc protecting group for 2 min and 20 min. For trityl removal, besides 30% TFA in DCM, TIS was also used. For substrate 1, the building blocks used were Boc-Tyr(2-Br—Z)—OH, Boc-Lys(2-Cl—Z)—OH, Boc-Asn(Trt)-OH, Trityl-protected thioglycolic acid, Boc-Val-OH. For substrate 6, building blocks used were biotin, Boc-Thr(Bzl)-OH, Boc-Tyr(2-Br—Z)—OH, Boc-Lys(2-Cl—Z)—OH, Boc-Asn(Trt)-OH, Trityl-protected thioglycolic acid, Boc-Val-OH. For cleavage (scale of 250 mg resin), first add 750 μl thioanisole/ethanedithiol mixture (2:1) on the ice, then add 5 ml TFA followed by 500 μl TFMSA. The cleavage was allowed to proceed for 1 h at room temperature.

(111) Fmoc chemistry has also been applied for the synthesis of the thiodepsipeptide 1. Since the thioester moiety is susceptible towards the nucleophilic piperidine, inventors used the modified Fmoc deprotection cocktail containing 25% 1-methylpyrrolidine, 2% hexamethyleneimine, 2% HOBT in NMP/DMSO (1:1) mixture as described previously (Tetrahedron Lett. 1998, 39, 8669).

(112) H. Butelase-Mediated Ligation and Kinetic Characterization

(113) Ligation assays were performed in 50-μl mixtures containing reaction buffer (1 mM EDTA, 20 mM phosphate buffer, pH 6.5), 0.1 μINA butelase 1, 1 mM GIGGIR (SEQ ID NO:114) and varying concentrations of peptides 1-4 (25 to 400 μM). The reactions were performed in triplicate at 42° C. and quenched by adding 5 μl of 1 M HCl solution. The peptides were separated by using a reversed-phase C18 analytical column (150×2.1 mm, Vydac) with a linear gradient from 5% to 40% acetonitrile over 15 min on a Nexera UHPLC system (Shimadzu). The ligation velocities were calculated by converting the HPLC-peak areas of remained linear precursors or the ligated products into concentrations. The identity of each HPLC peak was analyzed by MALDI-TOF MS (ABI 4800 MALDI TOF/TOF). The kinetic parameters (k.sub.cat and K.sub.m) for each peptide were obtained by the LineweaverBurk plot.

(114) I. Proteins Labeling with Thiodepsipeptides 1 and 8

(115) The labeling of proteins were performed in reaction buffer (1 mM EDTA, 20 mM phosphate buffer, pH 6.5) containing 100 μM protein and 0.1 μM butelase 1. One equivalent of thiodepsipeptide substrate was added every 30 min. For ubiquitin, 5 equivalents of thiodepsipeptide were added in total, as for GFP, 4 equivalents were added. The labeling reactions were monitored by HPLC and ESI-MS.

(116) Here inventors report the use of thiodepsipeptide as an acceptable sorting signal but a poor competing nucleophile after its release to render the butelase-mediated intermolecular ligation irreversible (FIG. 1). Inventors obtained quantitative ligation yields of >95% for a model peptide at 0.0005 molar equivalent of butelase 1 and two molar equivalents of the thiodepsipeptide. Inventors also successfully applied the proposed method to label ubiquitin and GFP with high yields. This method is based on inventors' previous work that incubation of butelase 1 with a model peptide KALVINHV (SEQ ID NO:125) with the dipeptide HV as a leaving group in the presence of various alkyl and aryl thiols did not lead to any detectable amount of peptide thioester (Nat Chem Biol 2014, 10, 732). This result suggested that thiol groups are poor competing nucleophiles than the HV dipeptide sorting signal. Thus, inventors hypothesized that intermolecular ligation reactions would be irreversible if the scissile asparaginyl amide bond is replaced by a thioester linkage. For comparison, inventors also synthesized a depsipeptide because it has been demonstrated that ligation yields were improved for sortase A using a depsipeptide substrate (Angew. Chem. Int. Ed. Engl. 2012, 51, 9377). However, the applications of depsipeptide for N-terminal protein labeling required 0.1-0.2 molar equivalents of sortase A and a time-consuming solution-phase synthesis of a depsipeptide precursor.

(117) To support this hypothesis, inventors prepared four different peptide substrates sharing a common sequence YKNXV (SEQ ID NO:126) 1-4 with a XV as a sorting signal (X=thio- or glycolic acid, His and Gly, respectively). Thiodepsipeptide 1 and depsipeptide 2 contain a S- and O-ester bond as a (S)GV and (O)GV analog, respectively, at the scissile bond compared with an amide bond in the two control peptides 3 (HV) and 4 (GV). Thiodepsipeptide 1 was prepared by a standard solid-phase synthesis (FIG. 2a). First, a mixture of an equal equivalent of thioglycolic acid and triphenylmethanol in the presence of neat trifluoroacetic acid yielded trityl-protected thioglycolic acid after solvent removal. This compound was used without further purification. Thiodepsipeptides were synthesized on MBHA resin with Boc-protected amino acids and the pre-made building block by Boc chemistry. Alternatively, the thiodepsipeptide 1 can also be prepared by Fmoc chemistry. Since the thioester moiety is susceptible towards piperidine, inventors used the modified Fmoc deprotection cocktail containing 25% 1-methylpyrrolidine, 2% hexamethyleneimine, 2% HOBT in NMP/DMSO (1:1) mixture (Tetrahedron Lett. 1998, 39, 8669). For depsipeptide 2, unlike previously reported method that required a carefully controlled solution-phase synthesis (Angew. Chem. Int. Ed. Engl. 2012, 51, 9377), inventors developed a fully solid-phase compatible and straightforward approach (FIG. 2b). The depsipeptides were synthesized on Rink amide MBHA resin with Fmoc amino acids and glycolic acid.

(118) Hydrazinolysis of the glycolic acid-coupled product removed all side products of oligomers because of their susceptibility to hydrazine, leaving only one glycolic acid attached to the preceding residue as a stable amide bond. Inventors' synthesis scheme provides a new convenient method for preparing depsipeptides.

(119) TABLE-US-00002 TABLE 1 List of peptide substrates and their corresponding molecular weight SEQ ID MW (MH .sup.+) Peptide NO: Sequence Calc. Obs. 1 110 YKN(S)GV 596.28 596.28 2 111 YKN(O)GV 580.30 580.19 3 112 YKNHV 659.36 659.27 4 113 YKNGV 579.32 579.16 5 114 GIGGIR 571.36 571.3 6 115 (O)GVYKV 565.33 565.28 7 116 ERLYRGRLYRRNHV 1888.05 1888.2 8 117 biotin-TYKN-thioglc-V 923.4 923.31

(120) Inventors evaluated the ligation efficiency of each peptide substrate to a model peptide GIGGIR (SEQ ID NO:114) 5 to form the ligated product YKNGIGGIR (SEQ ID NO:127) by HPLC. The reactions were performed in the presence of 100 μM GIGGIR (SEQ ID NO:114), one or two molar equivalents of each peptide substrate, and 50 nM of butelase 1 (0.0005 molar equivalent). Time-course analysis showed that thiodepsipeptide 1 was the most efficient substrate followed by depsipeptide 2. Peptide 3 and peptide 4 were the least efficient. All ligation reactions reached equilibrium after 60 min with marginal yield improvement after 90 min. At two molar equivalents of 1, >95% of peptide 5 was converted into the ligation product within 1 h (FIG. 3). In contrast, the ligation yields only reached 31%, 59% and 68%, respectively, for peptide 4, 3 and 2 under similar conditions.

(121) Even at one molar equivalent of thiodepsipeptide 1, the ligation yield still reached 73%, confirming thiodepsipeptide is the best of the four substrates. Table 2 shows a kinetic study to quantify the difference among peptides 1-4. The result was in agreement with the time-course experiments with thiodepsipeptide 1 having the highest catalytic efficiency (k.sub.cat/K.sub.m) and peptide 4 being the lowest.

(122) TABLE-US-00003 TABLE 2 Kinetic parameters of butelase 1 for peptides 1-4 SEQ ID k.sub.cat/K.sub.m Peptide NO: Sequence k.sub.cat (s.sup.−1) K.sub.m (mM) (M.sup.−1 s.sup.−1) 1 110 YKN-thioglc-V 56.5 ± 7.5  2.76 ± 0.3  20,480 2 111 YKN-glc-V 12.4 ± 0.32  0.74 ± 0.01 16,840 3 112 YKNHV 4.1 ± 0.65  0.3 ± 0.01 13,490 4 113 YKNGV 7.9 ± 0.72 0.88 ± 0.08 8,900

(123) Next inventors sought to determine what shifts the equilibrium to a higher yield for thiodepsipeptide 1 as compared to depsipeptide 2, because their leaving groups are a thiol or an alcohol, both of which are poor nucleophiles in a butelase-mediated ligation. It was found that the model peptide accepts glycerol as a nucleophile to give about 20% of the ligated product (FIG. 7). This observation suggests that butelase 1 can recognize an alcohol as an acceptor nucleophile. To demonstrate that butelase 1 indeed accepts an alcohol group, inventors synthesized peptide 6, (O)GVYKV (SEQ ID NO:115), with glycolic acid as the N-terminal residue. Ligation of peptide 6 with peptide 7 (ERLYRGRLYRRNHV; SEQ ID NO:116) led to a ligated product ERLYRGRLYRRN(O)GVYKV (SEQ ID NO:117) with about 25% yield (FIG. 8). No detectable ligation product was formed when ligated 7 with a (S)GV peptide under the same condition. These results indicate that the butelase-mediated ligation is reversible for depsipeptide and irreversible for thiodepsipeptide, which could explain for the higher yields of thiodepsipeptide 1 at equilibrium as compared to depsipeptide 2.

(124) To apply butelase 1 for N-terminal labeling of proteins, inventors used ubiquitin and green fluorescent protein (GFP) as examples (FIG. 4). Since butelase 1 prefers a hydrophobic amino acid (Ile/Leu/Val) or Cys at the P2″ position of an acceptor nucleophile, inventors prepared a recombinant ubiquitin protein (SEQ ID NO:122) with Gly-Ile at the N-terminus and His-tag at the C-terminus. It was also examined whether this method would work if His-tag was located at the N-terminus. Inventors thus prepared a recombinant GFP (SEQ ID NO:123) with an additional Ile inserted between the start codon and the N-terminal His-tag. Both proteins were labeled with the model thiodepsipeptide 1 in the presence of 0.001 molar equivalent of butelase 1. The labeling of proteins was slower as compared to the labeling of peptide 5, probably due to large differences in size between the model peptide and proteins. Furthermore, the N-terminal amino group of proteins may have a lower accessibility to butelase 1 as compared to peptides. Additionally, it was also found that the half-life of the thiodepsipeptide labeling reagent was relatively short mainly due to hydrolysis and aspartimide formation which was associated with the nature of the asparagine residue. The half-life of thiodepsipeptide 1 in inventors' reaction buffer is about 75 min in the absence of butelase 1 and 40 min in the presence of 0.0005 molar equivalent of butelase 1 (FIG. 9). For depsipeptide 2, the half-life is 45 min and 37 min in the absence and presence of butelase 1, respectively. This feature poses a problem when the ligation proceeds slowly, and a moderate yield (˜60%) was obtained after five equivalents of thiodepsipeptide 1 being completely consumed in the reaction. Due to the instability of the thiodepsipeptide, one molar equivalent of the labeling reagent was added to the reaction every thirty minutes instead of adding them all at once. This strategy improved the ubiquitin labeling to 82% yield with five molar peptide equivalents after 2.5 h (FIG. 4). Comparatively, <10% ligation product observed when ligating ubiquitin with LPETGG peptide (SEQ ID NO:128) when using sortase A. This result suggests that the N-terminal of ubiquitin may be buried and less accessible for ligation than small peptides, a finding in agreement with a previous study that sortase A is unable to modify myoglobin and fly pumilio RNA binding domain (Angew. Chem. hit. Ed. Engl. 2012, 51, 9377). Using the same strategy, 70% of GFP was labelled with four molar peptide equivalents (FIG. 9). This is also first example to explore the application of butelase 1 for protein labeling.

(125) To improve the ligation yield by introducing an additional linker to the N-terminal of proteins, another recombinant ubiquitin (SEQ ID NO:124) with a short liker peptide GISGSGS (SEQ ID NO:129) was expressed. Inventors obtained quantitative labeling for ubiquitin (˜95%) with four equivalents of the thiodepsipeptide 1 in the presence of 0.001 molar equivalent of butelase 1 in 100 min (FIG. 5a). The ligation yield also reached >90% yield for sortase A after introducing the linker peptide (GGSGSGS) (SEQ ID NO: 130), a result consistent with a literature precedent (Angew. Chem. Int. Ed. Engl. 2012, 51, 9377; Nat. Protoc. 2013, 8, 1800). However, sortase A required 0.1 molar equivalent of enzyme to catalyze the ligation as compared to 0.001 molar equivalent of butelase 1.

(126) With the success on the model thiodepsipeptide, conjugation with biological functional groups was also investigated. A thiodepsipeptide 8 carrying a biotin functional group at its N-terminus was synthesized. Successful labeling was achieved on both ubiquitin and GFP with the biotinylated thiodepsipeptide 8 (FIGS. 5b, 11), demonstrating the applicability of the presently disclosed method to introduce a functional tag into peptides and proteins. The labeling yields are comparable between thiodepsipeptides 1 and 8, which indicates that the biotin group does not affect the labeling efficiency.

(127) In conclusion, inventors have developed a novel method for butelase-mediated ligation using thiodepsipeptides as substrates. The ligation yield of >95% could be achieved for the model peptide and ubiquitin with a small excess of substrate. The developed method is also applicable for introducing a functional group such as biotin into proteins. The ligation efficiency was greatly improved as the (S)GV byproduct is a poor recognizing substrate in the reverse direction. Furthermore, the preparation of the labeling reagent and the use of this method are simple and straight forward. Inventors anticipate a broad application of this method for N-terminal modification of peptides and proteins.

Example 2: Bioconjugation: Efficient Butelase-Mediated Synthesis of Peptide Dendrimers and their Application as Antimicrobials

(128) A. Materials and Reagents

(129) For peptide synthesis, all the amino acids, coupling reagents and resins were obtained from chemimpex and GL biochem. All other chemical reagents were of analytical grade, obtained from Sigma Aldrich, alfa aesar and Acros Organics. All solvents and chemicals were used as received without purification unless otherwise indicated.

(130) The materials for radial diffusion assay were prepared as following:

(131) Trypticase soy broth (TSB): Full-strength broth contains 30 grams of TSB powder per liter of deionized water. It was autoclaved at 120° C. for 20 min and stored at room temperature.

(132) Underlay gel: 50 mL of 100 mm sodium phosphate buffer, 5 ml full-strength TSB and 5 g agarose were mixed in a beaker followed by addition of deionized water to 500 mL. The medium was autoclaved at 120° C. for 20 min. Before use, it was maintained at 42° C. to prevent from solidifying.

(133) Overlay gel: One liter of overlay gel contains 60 g of TSB powder and 10 g of agarose. The medium was autoclaved at 120° C. for 20 min. To prevent from solidifying, it was maintained at 42° C. before use.

(134) B. High Performance Liquid Chromatography (HPLC)

(135) The analytical HPLC analyses were carried out on a SHIMADZU NexraX.sub.2 LC-30AD system with an analytical column (Aeris peptide XB—C18, 4.6×250 mm for peptide analysis. The peptide purifications were performed using Shimadzu HPLC equipped with a semi-preparative HPLC column (Jupiter C18, 5 μM, 10×250 mm). All the HPLC runs were done using the mixture of two solutions, A (0.045% TFA in water) and B (0.039% TFA in acetonitrile/water (9/1) mixture). Flow rate was 0.8 ml/min for analysis and 2.5 ml/min for purification. UV detection was carried out at 220 nm.

(136) C. Mass Spectrometry

(137) Peptides ESI mass spectra data were obtained on both ESI (Thermo Finnigan LCQ DECA XP MAX) and MALDI TOF MS (ABI 4800 MALDI TOF/TOF system).

(138) D. Peptide Synthesis

(139) The peptides RYRLNHV—NH.sub.2 (SEQ ID NO:140), RLYR—NH.sub.2 (SEQ ID NO:139), (RIβA).sub.2KY—NH.sub.2, (RIβA).sub.4K.sub.2KY—NH.sub.2 and (RIβA).sub.8K.sub.4K.sub.2KY—NH.sub.2 were prepared by standard Fmoc chemistry using Rink Amide MBHA resin. Prior to use, resin was swelled with DCM for 5 min. Before coupling the first residue, an Fmoc deprotection was performed using 20% piperidine in dimethylformamide (DMF) for 2 min, followed by another 20 min treatment. For standard coupling reactions, 4 eq. of Fmoc-AA-OH, 4 eq. of PyBOP were first mixed in DCM/DMF mixture and added to the resins. 8 eq. of DIEA was added subsequently. Coupling reaction mixtures were shaken on the belly dancer for 60 to 90 min, efficiency monitored by Kaiser test. Between couplings and deprotections, resins were washed with DMF and DCM alternatively. For efficient synthesis of the dendrons, it is recommended to perform acetic anhydride capping (0.5 eq to the coupling capacity) after the deprotection of the first residue. The building blocks used for the peptides mentioned above were Fmoc-Tyr(tbu)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Leu-OH, Fmoc-Asn(Trt)-OH, Fmoc-His(Trt)-OH, Fmoc-Val-OH, Fmoc-Ile-OH, Fmoc-βAla-OH, Fmoc-Lys(Fmoc)-OH. Upon completion of peptide assembling, peptides were cleaved from the resin using a mixture containing 95% TFA, 2.5% TIS and 2.5% water. Peptides were precipitated from the cleavage reaction using cold ether.

(140) Thiodepsipeptides RYRLN-thioglc-V (SEQ ID NO:142), Ac-RYRLN-thioglc-V—NH.sub.2 (SEQ ID NO:137) and Ac-RLYRN-thioglc-V—NH.sub.2 (SEQ ID NO:138) were prepared by Boc chemistry using MBHA resin. Coupling procedures were the same as Fmoc. For Boc deprotection, 30% TFA in DCM was used. The building blocks used were Boc-Arg(Mts)-OH, Boc-Leu-OH.H.sub.2O, Boc-Asn(Trt)-OH, Boc-Tyr(2-Br—Z)—OH, trityl-protected thioglycolic acid, Boc-Val-OH. Acetic anhydride was used to introduce an acetyl group at the N-terminus. For the final cleavage (scale of 100 mg resin), 450 μl mixture of thioanisole/ethanethiol was first added to the resin, 3 ml of TFA was subsequently added to the reaction chilled on ice. After 10 min, 300 μl of TFMSA was added dropwise and the reaction was stirred at room temperature for 1 h.

(141) E. Butelase 1 Preparation

(142) A four-step chromatographic procedure was used to extract butelase 1 from the plant Clitoria ternatea. 1 kg of freshly collected Clitoria ternatea pods were homogenized with 1 l of extraction buffer EB1 (20 mM sodium phosphate, 2 ml of 0.5 M EDTA, 174 mg of PMSF, 0.35 ml of β-ME, pH 6.0). After removing the plant debris by filtration, ammonium sulfate solid was added to 15% saturation. The undesired large proteins were precipitated and removed by centrifuge. Ammonium sulfate was further added to 85% saturation and the precipitated proteins were collected after centrifuge. The extraction buffer EB1 was added to redissolve the proteins. The protein solution was dialyzed for overnight against extraction buffer EB2 (20 mM sodium phosphate, 1 mM EDTA and 5 mM (3-ME, pH 6.0).

(143) On the second day, the dialyzed protein solution was subjected to the flash chromatography column containing 300 ml slurry of Q Sepharose Fast Flow anion exchange resin (GE Healthcare). The column was first washed with EB2 and then eluted with 500 ml of elution buffer (EB2+200 mM NaCl). The eluent was dialyzed against EB2 for 4 h and fractionated using preparative PolyWax anion-exchange column (PolyLC, 21×250 mm). Fractions containing ligase activity were determined by testing on a cyclizable linear peptide substrate (GRCTKISPPICFPNHV, SEQ ID NO:141). All the fractions containing ligase activity were combined and concentrated using centrifugal filter with a MWCO of 10 kDa. The concentrated samples were first purified by a size-exclusion chromatography with Biosuite HPLC column and further purified by analytical anion-exchange chromatography using 4.6×200 mm PolyWax column. The purity of the isolated butelase 1 was determined by SBS-PAGE and silver staining, the enzyme showing a band at 37 kDa in SDS-gel. The concentration of butelase 1 was determined by OD280 based on the modeling. Around 5 mg of enzyme was obtained from the starting 1 kg of pods. FIG. 24 shows the SDS-PAGE (silver staining) of isolated butelase 1 (left lane) and protein markers (right lane).

(144) F. Ligation Protocol

(145) For all analytical reactions, a total system of 100 μl was used. Before the reaction, the stocks of thiodepsipeptides and butelase 1 were placed on the ice. The order of addition was: pH 6.5 phosphate buffer (20 mM), TCEP (1 mM), dendron core (50 μM), thiodepsipeptide (1.5 eq. per branch), butelase 1 (0.001 eq. per branch). After all reagents were added, the reaction was heated at 42° C. in a heating bath. A volume of 20 μl was taken out for HPLC analysis.

(146) G. Radial Diffusion Assay

(147) The following protocol was applied to the radial diffusion assay.

(148) 1. A single colony was picked and transferred into a 5 ml tube containing 2.5 ml TSB. The culture was shaken at 37° C. for 18 h.

(149) 2. 50 μl of the stationary phase culture was diluted to 2.5 mL of autoclaved TSB (1:50 dilution) and shaken at 37° C. for another 3 h.

(150) 3. This subculture was centrifuged at 5000 rpm for 5 min and the supernatant was discarded. The residual cells were washed with cold sterile 10 mM phosphate buffer, pH 7.4 and the buffer was discarded after centrifuge. 5 ml of the same buffer was added to resuspend the cells and its bacteria concentration was determined by measuring its optical density at 620 nm.

(151) 4. 10 ml of antoclaved, molten underlay gel agar was transferred to a 15-ml eppendorf tube and mixed with 4×10.sup.6 CFU of bacteria by vortexing. The mixture was then poured into a petri dish and gelled in less than 3 mM. Wells were punched against the gel using a Pasteur pippette.

(152) 5. Peptides to be tested were serially diluted and 3.5 μl of each sample was added to the well. The plates were incubated at 37° C. for 3 h with gel-side up.

(153) 6. Next, each underlay gel was covered with 10 ml of overlay gel. After the gel solidified, the plates were turned gel-side up and incubated at 37° C. for overnight.

(154) 7. The following morning, all the plates were taken out and the zone diameters were measured with ruler. All the samples were tested in duplicates and the results were averaged. The final minimum inhibition concentration (MIC) was determined using excel.

(155) Conjugation methods are enabling tools for biochemical studies. Their applications include labeling proteins with a biophysical probe or a bioactive cargo to enable structural studies, drug development as well as preparing biomaterials and immobilizing peptides and proteins on solid supports (Bioconjug Chem. 2014, 25, 825-839; Curr Org Chem. 2010, 14, 138-147).

(156) Chemical strategies for a site-selective protein conjugation often utilize classic acylation or alkylation chemistries, taking advantages of the side-chain functionalities of Lys, Asp/Glu, and Cys residues (Chem Rev. 2015, 115, 2174-2195). A limitation of these methods is that they are not site-specific because proteins often carry multiple copies of these “selective” residues. Consequently, they lead to heterogeneous products. Recent advances have addressed this limitation including the use of recombinant methods to incorporate unnatural amino acids with unique chemical activities to allow both site-selective and site-specific conjugation on proteins in the presence of other natural amino acids to render a modified protein product homogenous (Nat Rev Mol Cell Biol. 2006, 7, 775-782).

(157) Ligases, peptide-bond forming enzymes, provide an exciting complementary strategy through a ligase-mediated bioconjugation to the existing chemical conjugation methods. Bioconjugation, because of the inherent chemoselectivity of a ligase, produces exquisite site-selectivity and site-specificity (Bioconjug Chem. 2013, 24, 1277-1294). Current peptide ligases include sortase A (Chemistry. 2014, 20, 8516-8529) and subtiligase (Proc Natl Acad Sci USA. 1994, 91, 12544-12548). Recently, a new peptide ligase, namely butelase 1, was isolated from a cyclotide-producing plant Clitoria ternatea (Nat Chem Biol. 2014 10, 732-738). butelase 1 is the enzyme responsible for the macrocyclization of cliotides, cyclotides from C. ternatea, during their biosynthesis and recognizes a linear precursor with a C-terminal tripeptide motif Asn/Asp(Asx)-His-Val. It cleaves the bond between Asx and His to accept an N-terminal residue Xaa, resulting in a new Asx-Xaa bond in the cyclized peptide. butelase 1 exhibits not only the highest catalytic kinetics among all the peptide ligases found so far, but also a broad substrate specificity for the N-terminal amino acid, Xaa which can be any amino acid except Pro, making it an attractive tool for bioconjugation and peptide ligation (Chem Commun (Camb). 2015, 51, 17289-17292; Angew Chem Int Ed Engl. 2015, 54, 15694-15698; J Am Chem Soc. 2015, 137, 15398-15401).

(158) Multiple antigen peptide system (MAP), a strategy to present multiple functional peptides in a clustered dendrimeric format, was first developed by Tam to amplify the immunogenecity of small antigenic peptides (J Biol Chem. 1988, 263, 1719-1725; Proc Natl Acad Sci USA. 1988, 85, 5409-5413). This chemical platform has also found wide applications in peptide-based therapeutics and biomaterials (J Biotechnol. 2002, 90, 195-229). A common MAP design contains a scaffold, a branching oligolysine dendron core, to which various copies of a functional peptide are attached. Often, stepwise solid phase peptide synthesis (SPPS) or a convergent synthetic strategy is used to prepare such peptide dendrimers (Mol Immunol. 1991, 28, 623-630). For many applications, stepwise SPPS suffices; however, as the size of a MAP increases, the likelihood of synthetic errors such as residue deletion also increases, making purification a challenge to arrive at a homogeneous product from a synthetic mixture. Although this problem could be partially mitigated by an optimized SPPS methodology, increased attentions have been focused on employing a convergent strategy in which the dendron core and the antigenic peptides are separately synthesized and purified to homogeneity and then brought together using chemoselective conjugation reactions. Conjugation chemistries developed thus far include disulfide (Int J Pept Protein Res. 1991, 37, 27-32), thioether (Int J Pept Protein Res. 1992, 40, 214-221), thiazolidine (J Am Chem Soc. 1994, 116, 6975-6976), oxime (Mol Immunol. 1995, 32, 1031-1037), hydrazine (Int J Pept Prot Res. 1995, 45, 78-85), maleimide (Bioconjug Chem. 2013, 24, 578-585) and native chemical ligation (Biopolymers. 2008, 90, 624-632). Compared with the stepwise SPPS method, the convergent strategy often gives higher yield and greater purity of the final MAP products.

(159) Inventors envisioned that, with its exquisite site-specificity and site selectivity, butelase 1 would be useful for peptide dendrimer synthesis whereby a peptide as an acyl donor could be bioconjuated to a lysyl dendron core containing appropriate N-terminal acceptor amino acids to form a multi-valent dendrimeric product (FIGS. 19 and 20). An enzymatic synthesis of a highly clustered peptide dendrimer (such as the octavalent one) would present a stringent test of a butelase-mediated ligation (BML) and help to advance the development of peptide-based vaccines and therapeutics.

(160) In a trial reaction in which a conventional peptide substrate containing the C-terminal —NHV motif (peptide 4, Table 3) was used to bioconjugate to a bivalent lysyl dendron core (entry 2, Table 3), a sluggish reaction even with an excess of the monomeric peptide 4 and in a prolonged period was observed. Inventors attributed this poor outcome to the reversibility of the BML reaction because the released dipeptide His-Val acts as a competing nucleophile (FIG. 19A). Prompted by this observation, inventors sought to use thiodepsipeptides as acyl donors for peptide dendrimer synthesis to overcome the reversibility issue. It has been previously shown that thiodepsipeptides are superior substrates for butelase-mediated N-terminal labeling of proteins (Angew Chem Int Ed Engl. 2015, 54, 15694-15698). The use of thiodepsipeptide has two advantages. First, it contains a thioester linkage as the scissile bond which is more susceptible to enzymatic cleavage compared to its amide bond counterpart. Second, after the reaction, it releases a thiol byproduct which, unlike its native dipeptide counterpart, is a poor acyl-acceptor substrate of butelase 1, essentially rendering the BML reaction irreversible (FIG. 19B).

(161) TABLE-US-00004 TABLE 3 Sequences of the used peptides. SEQ ID Number NO: Sequence  1 118 Ac-RYRLN-thioglc-V  2 (RIβA).sub.2KY  3 (Ac-RYRLNRIβA).sub.2KY  4 119 RYRLNHV  5 (RYRLNRIβA).sub.2KY  6 (RIβA).sub.4K.sub.2KY  7 (RIβA).sub.8 K.sub.4K.sub.2KY  8 (Ac-RYRLNRIβA).sub.4K.sub.2KY  9 (Ac-RYRLNRIβA).sub.8K.sub.4K.sub.2KY 10 120 Ac-RLYRN-thioglc-V 11 121 RLYR 12 (Ac-RLYRNRIβA).sub.2KY 13 (Ac-RLYRNRIβA).sub.4K.sub.2KY

(162) To test this hypothesis, inventors first conducted a bioconjuation between an N-acetylated thiodepsipeptide 1 (Table 3) and the bivalent lysyl scaffold 2. The N-terminus of the thiodepsipeptide was acetylated because inventors found self-ligation of N-terminus-free thiodepsipeptide as a minor side reaction (FIG. 23) possibly due to high reactivity of the thioester. Thiodepsipeptide 1 was conveniently prepared by Boc chemistry as previously reported (Angew Chem Int Ed Engl. 2015, 54, 15694-15698). Using HPLC, the ligation reaction of 1 with 2 in forming the bivalent product 3 was evaluated (FIG. 20A). The reaction was performed in the presence of 50 μM scaffold 2, 150 μM thiodepsipeptide 1 (1.5 equiv. per branch), 100 nM butelase 1 (0.001 equiv. per branch), 1 mM TCEP, pH 6.5 phosphate buffer at 42° C. The dendron core was consumed in 30 min and the desired product 3 was formed in >95% yield based on HPLC analysis (FIG. 21A). This is in strong contrast to the sluggish ligation between the native peptide 4 which contains the NHV motif and the scaffold 2. Under similar conditions, >50% of the starting materials were not consumed after 2 h (FIG. 21B). HPLC analysis showed that the monovalent product was the major product (peak c′ in FIG. 2B) whereas the desired bivalent product was a minor product (peak d′ in FIG. 21B). Side reactions due to self-ligation of the unacetylated peptide 4 were not observed.

(163) To further test enzymatic multimerization of peptides at a higher density level, tetra- and octavalent lysly dendron cores 6 and 7 with four and eight branches, respectively, were then prepared by SPPS using a low-loading resin. Under similar reaction conditions, clean and efficient ligations of thiodepsipeptide 1 with these two dendron cores were observed in HPLC profiles and dendron cores 6 and 7 were consumed after 45 min and 180 mM (FIG. 22), respectively, to give the corresponding tetra- and octavalent products 8 and 9 (peak b and b′ in FIGS. 22A and B) in excellent yields (>85%). It should be noted that upon completion of the reaction, few intermediate low-order ligation products were found, a desirable scenario for purification purpose to achieve high product homogeneity. The synthesis of these MAPs with four and eight peptide branches showed the powerful nature of the butelase-mediated ligation reaction. To the best of inventors' knowledge, this is the first time that a peptide ligase has been used for the synthesis of an octabranched dendrimeric peptide. Moreover, the presently disclosed bioconjugation method forms native peptide bonds between the monomeric peptides and lysyl dendron cores, as opposed to most chemical conjugation methods which form non-peptidic linkages.

(164) There is a growing interest to develop peptide-based antibiotics (Annu Rev Immunol. 1995, 13, 61-92; J Intern Med. 2003, 254, 197-215; Cent Eur J Biol 2007, 2, 1-33; Int J Pept Res Ther. 2010, 16, 199-213) because, compared with conventional antibiotics, they are less likely to develop drug resistance and have fewer side effects (J Med Chem. 2015, 58, 6533-6548; Biochemistry-Us. 2000, 39, 7159-7169; Eur J Biochem. 2000, 267, 3289-3300; Nucleic Acids Res. 2012, 40, W199-204). To apply the presently disclosed enzymatic method in preparing dendrimeric antimicrobials, inventors synthesized two antimicrobials 12 (bivalent) and 13 (tetravalent) (MS shown in supporting information) which harbored a tetrapeptide RLYR (SEQ ID NO:121) as the antibacterial sequence (Eur J Biochem. 2002, 269, 923-932) by ligating N-acetylated thiodepsipeptide 10 Ac-RLYRN-thioglc-V (SEQ ID NO:120) with dendron core 2 and 6 respectively. The RLYR (SEQ ID NO:121) tetrapeptide contains a BHHB motif (B=basic, H=hydrophobic) which is commonly found in certain potent and broad-spectrum β-stranded antimicrobial peptides (BioDrugs. 2013, 27, 479-493) such as PG (protegrins) (Febs Lett. 1993, 327, 231-236) and RTD-1 (rhesus monkey theta defensin) (Science. 1999, 286, 498-502). This consensus motif with positive charged and hydrophobic residues was successfully used as a dendrimeric antimicrobial in 2002 (Eur J Biochem. 2002, 269, 923-932). Such short peptide-based dendrimeric antimicrobials are broad-spectrum antibiotics and kill bacterial cells through electrostatic and hydrophobic interactions with the negatively charged microbial cytoplasmic membranes (Biochemistry-Us. 2009, 48, 5642-5657). Using a radial diffusion assay, inventors tested the antimicrobial activities against E. coli and S. aureus of these two dendrimeric peptides together with prototypical monomer 11 RLYR (SEQ ID NO:121), mono-, tri-lysine dendron core 2 and 6 for comparison. All assays were performed under a high-salt condition (100 mM NaCl) to simulate physiological conditions. The monomeric peptide 11 showed no appreciable activity against either E. coli or S. aureus (Table 4). However, significant antimicrobial activities were observed with the bivalent product 12 which had a MIC of 18.3 μM against E. coli and 3.4 μM against S. aureus. The tetravalent dendrimeric structure 13 had further improved antimicrobial activities with MICs<3 μM against both strains. When testing 13 against several drug-resistant strains under high-salt condition, the tetramer construct was broadly active against all six tested strains with MICs ranging from 0.87 to 4.8 μM. The results suggest that MAP-based dendrimeric peptides, which can be easily prepared using BML, are an effective platform for the design of antimicrobial agents. A possible reason for this success is that the dendrimeric structure increases the effective molarity of the functional monomeric units and reduces the entropy cost associated with peptide self-assembly on bacterial plasma membranes (Eur J Biochem. 2002, 269, 923-932).

(165) TABLE-US-00005 TABLE 4 Antimicrobial activity of different peptides against E. coli and S. aureus. MIC (μM) Peptide E. coli S. aureus Monomer 11 >300 >300 Bivalent dendron core 2 >150 >150 Tetravalent dendron core 6 >150 >150 Dimer 12 18.3 3.4 Tetramer 13 2.4 1.4

(166) TABLE-US-00006 TABLE 5 Antimicrobial activity of tetramer 13 against different drug-resistant strains. Organism MIC (μM) E. cloacae DM 09800 0.9 K. species DR 13779 1.5 E. coli DM 04604 4.5 S. aureus DB 14329 4.8 P. aeruginosa DM 14158 2.3 E. coli DU 09777 2.2

(167) In conclusion, inventors have developed a novel method to prepare peptide dendrimers using butelase 1 as the catalyst for bioconjugation of thiodepsipeptides with a lysyl dendron core. Using a small excessive of a monomeric peptide substrate (1.5 equiv. per branch to the dendron core) and a low catalytic amount of the enzyme butelase 1 (0.001 equiv.), inventors obtained very efficient synthesis of the bi-, tetra- and octavalent dendrimers. No other peptide ligases have been used for the synthesis of such dendrimeric peptides. Inventors further used this bioconjugation method to evaluate the polyvalent feature of peptide dendrimers as antimicrobials. Inventors found that a tetravalent dendrimer containing a tetrapeptide sequence with the BHHB motif is a potent broad-spectrum antimicrobial (MICs<5 μM), including several drug-resistant bacterial strains. The presently disclosed butelase-mediated bioconjuation method works under mild conditions and is user-friendly as it requires no complicated chemistry operations. Inventors anticipate this method to be a useful tool in preparing peptide dendrimers.

(168) The invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein. Other embodiments are within the following claims. In addition, where features or aspects of the invention are described in terms of Markush groups, those skilled in the art will recognize that the invention is also thereby described in terms of any individual member or subgroup of members of the Markush group.

(169) One skilled in the art would readily appreciate that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. Further, it will be readily apparent to one skilled in the art that varying substitutions and modifications may be made to the invention disclosed herein without departing from the scope and spirit of the invention. The compositions, methods, procedures, treatments, molecules and specific compounds described herein are presently representative of preferred embodiments are exemplary and are not intended as limitations on the scope of the invention. Changes therein and other uses will occur to those skilled in the art which are encompassed within the spirit of the invention are defined by the scope of the claims. The listing or discussion of a previously published document in this specification should not necessarily be taken as an acknowledgement that the document is part of the state of the art or is common general knowledge.

(170) The invention illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms “comprising”, “including,” containing”, etc. shall be read expansively and without limitation. The word “comprise” or variations such as “comprises” or “comprising” will accordingly be understood to imply the inclusion of a stated integer or groups of integers but not the exclusion of any other integer or group of integers. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by exemplary embodiments and optional features, modification and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention.

(171) The content of all documents and patent documents cited herein is incorporated by reference in their entirety.