HEPAROSAN SYNTHASES AND USE THEREOF FOR SACCHARIDE SYNTHESIS
20210040458 ยท 2021-02-11
Inventors
Cpc classification
C12P19/04
CHEMISTRY; METALLURGY
C12P19/00
CHEMISTRY; METALLURGY
International classification
Abstract
Heparosan synthase variants having improved expression levels, enhanced thermal stability, and/or reduced reverse glycosylation activity are provided. Methods for making oligosaccharides and polysaccharides, including heparin analogs and heparan sulfate analogs, are also described.
Claims
1. A truncated heparosan synthase variant.
2. A Pasteurella multocida heparosan synthase 2 (PmHS2) variant comprising a polypeptide having at least 70% identity to the amino acid sequence set forth in SEQ ID NO:1.
3. The PmHS2 variant of claim 2, which consists of the polypeptide having at least 70% identity to the amino acid sequence set forth in SEQ ID NO:1.
4. The PmHS2 variant of claim 2 or 3, which comprises a mutation at one or more positions corresponding to Y165, R184, L185, F187, I188, T189, D211, N237, K379, L462, T464, T466, V467, 5485, G486, M487, and D489 in SEQ ID NO:1.
5. A Pasteurella multocida heparosan synthase 2 (PmHS2) variant comprising a polypeptide having at least 70% identity to the amino acid sequence set forth in SEQ ID NO:3.
6. The PmHS2 variant of claim 5, which consists of the polypeptide having at least 70% identity to the amino acid sequence set forth in SEQ ID NO:3.
7. The PmHS2 variant of claim 5 or 6, which comprises a mutation at one or more positions corresponding to Y176, R195, L196, F198, I199, T200, D222, N248, K390, L473, T475, T477, V478, 5496, G497, M498, and D500 in SEQ ID NO:3.
8. The PmHS2 variant of any one of claims 5 to 7, which comprises one or more mutations corresponding to Y176A, R195A, L196A, F198A, I199A, T200A, D222N, N248A, K390A, L473A, T475A, T477A, V478A, S496N, S496A, G497 deletion, M498A, and D500N in SEQ ID NO:3.
9. The PmHS2 variant of claim 8, which comprises the mutation D222N or D500N in SEQ ID NO:3.
10. The PmHS2 variant of claim 8, which comprises the mutations D410N, D412N, and D500N in SEQ ID NO:3.
11. The PmHS2 variant of claim 8, which comprises the mutation with G497 deletion in SEQ ID NO:3.
12. The PmHS2 variant of claim 8, which comprises the mutations Y176A, R195A, L196A, F198A, I199A, T200A, and/or N248A in SEQ ID NO:3.
13. The PmHS2 variant of claim 8, which comprises the mutations K390A, L473A, T475A, T477A, and/or V478A in SEQ ID NO:3.
14. The PmHS2 variant of claim 8, which comprises the mutations S496N, S496A, and/or M498A in SEQ ID NO:3.
15. A method of preparing an oligosaccharide, the method comprising: forming a mixture comprising (i) a heparosan synthase variant of claim 1 or a PmHS2 variant of any one of claims 2 to 13, (ii) an acceptor sugar, and (iii) a nucleotide sugar comprising a nucleotide moiety and a donor sugar moiety, and maintaining the mixture under conditions sufficient to transfer the donor sugar moiety to the acceptor sugar.
16. The method of claim 5, wherein the nucleotide sugar in the mixture is formed by converting a sugar starting material to the nucleotide sugar.
17. The method of claim 5 or claim 16, wherein the acceptor sugar is selected from the group consisting of a monosaccharide, a disaccharide, a trisaccharide, a tetrasaccharide, a pentasaccharide, a hexasaccharide, a heptasaccharide, an octasaccharide, and a nonasaccharide.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
DETAILED DESCRIPTION OF THE INVENTION
[0048] Provided herein are Pasteurella multocida heparosan synthase 2 (PmHS2) variants having improved functional properties. We disclose here the identification of PmHS2 mutants with desired improved functions.
[0049] An N-terminal His.sub.6-tagged (SEQ ID NO: 14) and N-terminal 80 amino acid-truncated PmHS2 (His.sub.6-80PmHS2) was initially designed. This truncated enzyme was found to possess enhanced thermal stability and expression level compared to WT His.sub.6-PmHS2. His.sub.6-80PmHS2 showed a 3-4 fold increase in expression level (60-80 mg/L) compared to WT (17-20 mg/L). The Tso (the temperature at which the enzyme retains 50% of maximum activity) was increased by approximately 7 C. for His.sub.6-80PmHS2 compared to WT, indicating a high likelihood for improved stability. The efficacy of His.sub.6-80PmHS2 was demonstrated by gram-scale synthesis of heparosan oligosaccharides ranging from disaccharides to hexasaccharides.
[0050] Similar to WT His.sub.6-PmHS2, His.sub.6-80PmHS2 retained significant reverse glycosylation activity, especially when the size of the heparosan oligosaccharide acceptor has length equal to or larger than hexasaccharide, which contributed to lower yields of oligosaccharides with a lengths longer than heptasaccharides. To minimize byproduct formation during enzymatic and chemoenzymatic synthesis of heparosan oligosaccharides, Asp291 and Asp569 were identified as the key catalytic residues associated with the transfer of GlcA and GlcNAc, respectively. Furthermore, His.sub.6-80PmHS2_D222N and His.sub.6-80PmHS2_D500N mutants were designed as mono-functional GlcNAc transferase and GlcA transferase, respectively. The mutants remarkably reduced the reverse glycosylation while retaining the substrate promiscuity of His.sub.6-PmHS2 for the synthesis of longer heparosan oligosaccharides, heparin, and heparan sulfate oligosaccharide analogs.
[0051] To increase the substrate promiscuity of His.sub.6-PmHS2 and His.sub.6-80PmHS2, Y176, R195, L196, F198, I199, T200, and/or N248 were identified as hot spot amino acid residues for tolerating UDP-GlcA2N3 as a donor substrate. More specifically, Y176A, R195A, L196A, F198A, I199A, T200A, and/or N248A were proposed for tolerating UDP-GlcA2N3 as a donor substrate.
[0052] In addition, K390, L473, T475, T477, and V478 were identified as hot spot amino acid residues for incorporating GlcNAc3N3. It is believed that mutations of one or more of these residue to a smaller amino acid residue such as Alanine (A) would lead to the tolerance of UDP-GlcNAc3N.sub.3 as a donor substrate.
[0053] Lastly, S496, G497, and M498 were identified as hot spots for tolerating UDP-GlcNAc6S as a donor substrate. S496N, S496A, G497 deletion mutations, and M498A would lead to the tolerance of UDP-GlcNAc6S as a donor substrate.
[0054] Identical and identity, in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same. Sequences are substantially identical to each other if they have a specified percentage of nucleotides or amino acid residues that are the same (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. These definitions also refer to the complement of a nucleic acid test sequence.
[0055] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. For sequence comparison of nucleic acids and proteins, the BLAST and BLAST 2.0 algorithms and the default parameters discussed below can be used. The BLAST and BLAST 2.0 algorithms are described in Altschul et al., (1990) J Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available at the National Center for Biotechnology Information website, ncbi.nlm.nih.gov. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word size (W) of 28, an expectation (E) of 10, M=1, N=2, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a word size (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see, e.g., Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).
[0056] In certain embodiments, a 80PmHS2 variant according to the present disclosure will comprise a polypeptide having at least about 70%, e.g., at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to the amino acid sequence set forth in SEQ ID NO:1.
TABLE-US-00001 (80PmHS2) SEQIDNO:1 10203040 FEKIYTYNQALEAKLEKDKQTTSITDLYNEVAKSDLGLVK 50607080 ETNSANPLVSIIMTSHNTAQFIEASINSLLLQTYKNIEII 90100110120 IVDDDSSDNTFEIASRIANTTSKVRVFRLNSNLGTYFAKN 130140150160 TGILKSKGDIIFFQDSDDVCHHERIERCVNILLANKETIA 170180190200 VRCAYSRLAPETQHIIKVNNMDYRLGFITLGMHRKVFQEI 210220230240 GFFNCTTKGSDDEFFHRIAKYYGKEKIKNLLLPLYYNTMR 250260270280 ENSLFTDMVEWIDNHNIIQKMSDTRQHYATLFQAMHNETA 290300310320 SHDFKNLFQFPRIYDALPVPQEMSKLSNPKIPVYINICSI 330340350360 PSRIAQLQRIIGILKNQCDHFHIYLDGYVEIPDFIKNLGN 370380390400 KATVVHCKDKDNSIRDNGKFILLEELIEKNQDGYYITCDD 410420430440 DIIYPSDYINTMIKKLNEYDDKAVIGLHGILFPSRMTKYF 450460470480 SADRLVYSFYKPLEKDKAVNVLGTGTVSFRVSLFNQFSLS 490500510520 DFTHSGMADIYFSLLCKKNNILQICISRPANWLTEDNRDS 530540550560 ETLYHQYRDNDEQQTQLIMENGPWGYSSIYPLVKNHPKFT 570571 DLIPCLPFYFL
[0057] Also provided herein are N-terminal His.sub.6-tagged (SEQ ID NO: 14) N-terminal 80 amino acid truncated Pasteurella multocida heparosan synthase 2 (His.sub.6-80PmHS2) variants comprising a polypeptide having at least 70% identity to the amino acid sequence set forth in SEQ ID NO:3.
[0058] In some embodiments, the His.sub.6-80PmHS2 variant consists of the polypeptide having at least 70% identity to the amino acid sequence set forth in SEQ ID NO:3. In certain embodiments, the His.sub.6-80PmHS2 variant comprises a mutation at one or more positions corresponding to Y176, R195, L196, F198, I199, T200, D222, N248, K390, L473, T475, T477, V478, S496, G497, M498, and D500 in SEQ ID NO:3. In certain embodiments, the His.sub.6-80PmHS2 variant comprises one or more mutations corresponding to Y176A, R195A, L196A, F198A, I199A, T200A, D222N, N248A, K390A, L473A, T475A, T477A, V478A, S496N, S496A, G497 deletion, M498A, and D500N in SEQ ID NO:3.
[0059] In particular embodiments, the PmHS2 variant comprises the mutation D222N or D500N in SEQ ID NO:3. In particular embodiments, the His.sub.6-80PmHS2 variant comprises the mutations D410N, D412N, and D500N in SEQ ID NO:3. In particular embodiments, the PmHS2 variant comprises the mutation with G497 deletion in SEQ ID NO:3. In particular embodiments, the His.sub.6-80PmHS2 variant comprises the mutations Y176A, R195A, L196A, F198A, I199A, T200A, and/or N248A in SEQ ID NO:3. In particular embodiments, the His.sub.6-80PmHS2 variant comprises the mutations K390A, L473A, T475A, T477A, and/or V478A in SEQ ID NO:3. In particular embodiments, the PmHS2 variant comprises the mutations S496N, S496A, and/or M498A in SEQ ID NO:3.
[0060] Also provided herein are methods for preparing oligosaccharides and polysaccharides, including heparin analogs and heparan sulfate analogs. In some embodiments, the methods include: forming a mixture containing (i) a heparosan synthase variant as described herein, (ii) an acceptor sugar, and (iii) a nucleotide sugar comprising a nucleotide moiety and a donor sugar moiety; and maintaining the mixture under conditions sufficient to transfer the donor sugar moiety to the acceptor sugar.
[0061] In some embodiments, the nucleotide sugar in the mixture is formed by converting a sugar starting material to the nucleotide sugar. One or more additional enzymes can be used to convert a sugar starting material (e.g., a monosaccharide) to a nucleotide sugar or another sugar intermediate useful in the preparation of the desired end product. Such enzymes may include, but are not limited to, glycosyltransferases, nucleotide-sugar pyrophosphorylases, kinases, and dehydrogenases, examples of which are described in WO 2013/013244. Such enzymes can be used in conjunction with the heparosan synthase variants of the present disclosure in one-pot, multi-enzyme reactions.
[0062] In some embodiments, the sugar starting material is selected from:
[0063] In some embodiments, the acceptor sugar is selected from the group consisting of a monosaccharide, a disaccharide, a trisaccharide, a tetrasaccharide, a pentasaccharide, a hexasaccharide, a heptasaccharide, an octasaccharide, and a nonasaccharide.
[0064] In some embodiments, the sugar starting material is selected from substituted or unsubstituted glucose (Glc), substituted or unsubstituted glucose-1-phosphate (Glc-1-P), substituted or unsubstituted glucuronic acid (GlcA), substituted or unsubstituted glucuronic acid-1-phosphate (GlcA-1-P), substituted or unsubstituted iduronic acid (IdoA), substituted or unsubstituted iduronic acid-1-phosphate (IdoA-1-P), substituted or unsubstituted N-acetylglucosamine (GlcNAc), substituted or unsubstituted N-acetylglucosamine-1-phosphate (GlcNAc-1-P), substituted or unsubstituted glucosamine (GlcNH.sub.2), substituted or unsubstituted glucosamine-1-phosphate (GlcNH.sub.2-1-P), substituted or unsubstituted galactose (Gal), substituted or unsubstituted galactose-1-phosphate (Gal-1-P), substituted or unsubstituted galacturonic acid (GalA), substituted or unsubstituted galacturonic acid-1-phosphate (GalA-1-P), substituted or unsubstituted N-acetylgalactosamine (GalNAc), substituted or unsubstituted N-acetylgalactosamine-1-phosphate (GalNAc-1-P), substituted or unsubstituted galactosamine (GalNH.sub.2), substituted or unsubstituted galactosamine-1-phosphate (GalNH.sub.2-1-P), substituted or unsubstituted mannose (Man), substituted or unsubstituted mannose-1-phosphate (Man-1-P), and substituted or unsubstituted N-acetylmannosamine (ManNAc), substituted or unsubstituted N-acetylmannosamine-1-phosphate (ManNAc-1-P), substituted or unsubstituted mannosamine (ManNH2), and substituted or unsubstituted mannosamine-1-phosphate (ManNH2-1-P).
[0065] In some embodiments, the sugar starting material is GlcNAc, a GlcNAc analog, GlcA, or a GcA analog.
[0066] In some embodiments, the sugar starting material is a GlcNAc analog having a formula:
##STR00001##
wherein R is selected from the group consisting of acetyl and trifluoroacetyl, and each R is independently selected from OH and N.sub.3.
[0067] In some embodiments, the sugar starting material is a GlcA analog having a formula:
##STR00002##
wherein R is selected from OH and N.sub.3.
[0068] Ins some embodiments, the sugar starting material is selected from
##STR00003##
[0069] In some embodiments, preparing the saccharide end product includes converting an N.sub.3 group in a sugar starting material or a sugar intermediate to an NHSO.sub.3.sup. group.
EXAMPLES
Example 1 Generation of His.SUB.6.-80PmHS2
[0070] Analyzing PmHS2 protein sequence using XtalPredRF.sup.31 (
Example 2 Substrate Testing
[0071] To facilitate reaction monitoring, product purification, and allow easy removal from the products for downstream conjugation with proteins or other molecules, a fluorophore tag was introduced to two possible monosaccharide substrates. GlcAr3ProNHFmoc (O1) and GlcNAcaProNHFmoc were synthesized from the corresponding glycosylpropylazides GlcAflProN.sub.3.sup.18 and GlcNAcaProN3.sup.33 by catalytic hydrogenation followed by coupling with N-(9-fluorenylmethoxycarbonyloxy)succinimide (Fmoc-Suc) (see ESI).
[0072] Activity comparison (Table 1) showed that GlcAflProNHFmoc (O1) was a more efficient substrate than GlcNAcaProNHFmoc for both His.sub.6-PmHS2 (157-fold) and His.sub.6-80PmHS2 (130-fold) in disaccharide production. Apparent kinetics studies with GlcAPAA (Table 2) showed that His.sub.6-PmHS2 (3.40.2 s-1) and His.sub.6-80PmHS2 (3.50.2 s-1) have similar kcat values while His.sub.6-PmHS2 (4.00.6 mM) has a lower KM value than His.sub.6-80PmHS2 (5.30.7 mM), resulting in a slightly higher catalytic efficiency for His.sub.6-PmHS2 (0.9 s-1 mM-1) than His.sub.6-80PmHS2 (0.7 s-1 mM-1). Comparision of His.sub.6-PmHS2 and His.sub.6-80PmHS2 activities using GlcAflProNHFmoc (O1) or GlcNAcaProNHFmoc as an acceptor to form the corresponding disaccharide product GlcNAcal-4GlcAPProNHFmoc or GlcA1-4GlcNAcaProNHFmoc (Percentage conversions for 30 min reactions determined by HPLC with an diode array detector are shown). Table 2 shows apparent kinetic parameters for His.sub.6-PmHS2 and His.sub.6-80PmHS2 using GlcAPAA as the acceptor. Data for repeated experiments of triplicates are shown.
TABLE-US-00002 TABLE 1 Enzyme GlcNAc1- GlcA1- concentration Enzyme 4GlcAProNHFmoc (%) 4GlcNAcProNHFmoc (%) 0.06 mg/mL His.sub.6-PmHS2 64.5 1.0 ND His.sub.6-80PmHS2 50.8 6.0 ND 1.5 mg/mL His.sub.6-PmHS2 100 10.3 0.3 His.sub.6-80PmHS2 100 9.8 0.4
TABLE-US-00003 TABLE 2 k.sub.cat (s.sup.1) K.sub.M (mM) k.sub.cat/K.sub.M (s.sup.1 mM.sup.1) His.sub.6-PmHS2 3.4 0.2 4.0 0.6 0.9 His.sub.6-80PmHS2 3.5 0.2 5.3 0.7 0.7
Example 3 Oligosaccharide Synthesis
[0073] Starting from GlcAflProNHFmoc (O1), His.sub.6-80PmHS2 with improved expression and stability permitted size-controlled gram-scale synthesis of heparosan oligosaccharides ranging from disaccharide (O2) to hexasaccharide (O6) in excellent yields using a sequential one-pot multienzyme (OPME) platform. In this platform (
[0074] As shown in
[0075] OPME reactions of GlcNAc activation and transfer to glucuronides O1, O3, and O5 (OPME1) were highly efficient and N-acetylglucosaminides O2, O4, and O6 were obtained in nearly quantitative yields (96-99%). In the case of OPME reactions of GlcA activation and transfer to N-acetylglucosaminides O2 and O4 (OPME2) for the formation of glucuronides O3 and O5, the reaction with O2 went well and O3 was obtained in an excellent 99% yield. However, when tetrasaccharide O4 (an N-acetylglucosaminide longer than O2) was used as an acceptor for the formation of O5, the presence of O3 byproduct was observed, indicating that the terminal GlcNAc in the acceptor O4 was removed in the reaction. The side product formation was minimized by monitoring the reaction progress carefully and stopping the reaction promptly to obtain O5 in 87% yield.
[0076] Overall, the sequential OPME platform containing His.sub.6-80PmHS2 was efficient in gram-scale synthesis of heparosan oligosaccharides up to hexasaccharide O6 from monosaccharide O1. When hexasaccharide O6 (an N-acetylglucosaminide even longer than O4) was used as the acceptor substrate for the 1-4-GlcAT activity of His.sub.6-80PmHS2, the formation of both longer and shorter oligosaccharide byproducts (
Example 4 Reverse Glycosylation Activity of His.SUB.6.-80PmHS2
[0077] It was hypothesized that the formation of longer and shorter oligosaccharide byproducts in the OPME reaction for the synthesis of O7 from O6 was due to the reverse glycosylation activity of His.sub.6-80PmHS2. Such activity was reported for some glycosyltransferases involved in natural product glycosylation,.sup.38-39 mammalian sialyltransferases,.sup.40 and bacterial sialyltransferases Pasteurella multocida sialyltransferase 1 (PmST1) and Photobacterium damselae 2-6-sialyltransferase (Pd2,6ST),.sup.41-42 but was not observed for others..sup.40 Such activity, however, has never been shown for polysaccharide synthases. To test the hypothesis, hexasaccharide O6 was incubated with His.sub.6-80PmHS2 in the absence or the presence of different concentrations of uridine 5-diphosphate (UDP). As shown in Table 3, the amounts of His.sub.6-80PmHS2 reverse glycosylation products (oligosaccharides of various sizes ranging from mono- to dodecasaccharide) increased and the concentration of O6 decreased significantly with the increase of UDP concentration. The same effects were observed for His.sub.6-PmHS2 (Table 3), demonstrating that the reverse glycosylation property was not introduced by the N-terminal protein sequence truncation in His.sub.6-80PmHS2. The chain reactions caused by the forward and reverse glycosylation reactions of His.sub.6-80PmHS2 in the presence of O6 and UDP are illustrated in
TABLE-US-00004 TABLE 3 UPD O1 O2 O3 O4 O5 O6 O7 O8 O9 O10 O11 O12 (nM) (%) (%) (%) (%) (%) (%) (%) (%) (%) (%) (%) (%) His.sub.6- 0 ND ND ND ND ND 100 ND ND ND ND ND ND 80PmHS2 1 ND ND ND 6.7 2.6 81.6 ND 7.9 ND 0.8 ND ND 0.1 0.4 0.1 0.1 0.1 5 3.4 1.5 0.6 16.9 4.2 58.0 0.4 12.8 ND 1.9 ND 0.2 0.4 0.5 0.1 1.7 1.0 2.7 0.1 1.2 0.1 0.1 10 3.4 7.8 1.5 18.9 3.8 38.0 1.8 18.6 0.7 4.2 ND 1.1 0.2 1.5 0.5 0.5 0.1 1.6 0.2 1.3 0.1 1.0 0.1 His.sub.6- 0 ND ND ND ND ND 100 ND ND ND ND ND ND PmHS2 1 3.3 2.7 1.4 9.6 3.0 64.2 ND 13.5 ND 1.9 ND ND 0.2 0.2 0.1 0.4 0.6 0.2 0.3 0.1 5 3.9 5.5 1.1 8.8 4.8 52.3 0.4 16.0 ND 5.7 ND 0.7 0.2 0.7 0.2 0.6 2.4 0.1 0.1 0.4 0.8 0.2 10 3.1 9.0 0.6 17.7 9.1 36.2 1.1 16.3 0.4 4.6 ND 1.3 0.1 0.3 0.1 0.7 0.1 0.4 0.2 0.3 0.1 0.4 0.1 ND: not detected.
[0078] Time course studies using GlcNAc-terminated O6 as the substrate for His.sub.6-80PmHS2 (
[0079] The formation of UDP-GlcNAc by reverse glycosylation of O6 using His.sub.6-80PmHS2 in the presence of UDP was further confirmed by a coupled enzyme assay (
[0080] Table 4 shows HPLC-based indirect detection of UDP-GlcNAc formed from the reverse glycosylation activity of His.sub.6-80PmHS2 from O6 and UDP by a coupled enzymatic assay with NmLgtA in the presence of LacMU (Reaction 1). The production of other oligosaccharide by-products from the reversed glycosylation activities of His.sub.6-80PmHS2 was also shown. Negative controls include reactions lacking NmLgtA (Reaction 2), His.sub.6-80PmHS2 (Reaction 3), or UDP (Reaction 4). As shown below, GlcNAc1-3LacMU, the expected product of NmLgtA-catalyzed glycosylation of LacMU, was produced only in Reaction 1 containing all required components. The positive control reaction (Reaction 5) for NmLgtA (6 M) with UDP-GlcNAc (1 mM) and LacMU (1 mM) converted LacMU completely to the glycosylated product GlcNAc1-3LacMU.
TABLE-US-00005 TABLE 4 His.sub.6- UDP- LacMU GlcNAc1- O2 O3 Reaction NmLgtA 80PmHS2 UPD GlcNAc (%) 3LacMU (%) (%) (%) 1 + + + 90.3 9.7 9.3 1.0 0.6 0.6 1.3 0.1 2 + + 100 ND 11.4 0.7 1.6 0.2 3 + + 100 ND ND ND 4 + + 100 ND ND ND 5 + + ND 100 O4 O5 O6 O7 O8 O9 O10 O11 O12 Reaction (%) (%) (%) (%) (%) (%) (%) (%) (%) 1 16.2 4.4 36.2 3.0 20.4 0.6 7.3 ND 1.7 0.3 0.3 3.2 0.5 0.4 0.1 0.5 0.5 2 23.7 5.1 35.1 1.2 15.8 0.5 5.1 ND 1.2 7.3 2.9 4.3 0.3 1.5 0.2 0.3 0.1 3 ND ND 100 ND ND ND ND ND ND 4 ND ND 100 ND ND ND ND ND ND 5 ND: not detected.
Example 5 Mutagenesis of His.SUB.6.-80PmHS2
[0081] Since reverse 1-4-GlcNAcT and 1-4-GlcAT activities of His.sub.6-80PmHS2 cause challenges in size-controlled enzymatic synthesis and purification of longer oligosaccharide products, mutagenesis studies of His.sub.6-80PmHS2 were planned to generate single-function glycosyltransferases by mutating the key catalytic base residues of the other glycosyltransferase domains. The previously reported strategy of generating single-functional glycosyltransferases of PmHS2.sup.14 and PmHS1.sup.23 by mutating the glycosyltransferase DXD motifs was not adopted due to the significant decrease of the stability of the PmHS2 mutants.sup.14 which would adversely affect their application in synthesis. In the absence of known PmHS2 crystal structures, a 80PmHS2 I-TASSER.sup.46-47 model was generated. The 1-4-GlcAT domain in 80PmHS2 I-TASSER model aligned well with the GalNAcT and GlcAT domains of Escherichia coli K4 chondroitin polymerase (EcKfoC) (PDB ID: 2Z86 and 2Z87).sup.48 (
[0082] D222N and D500N (in SEQ ID NO:3) mutants of His.sub.6-80PmHS2 were generated (
[0083] His.sub.6-80PmHS2 D500N mutant was used as a single function 1-4-GlcAT (lacking both forward and reverse 1-4-GlcNAcT activities) in high-yield OPME synthesis (OPME2) (
[0084] Various NMR experiments for O1-O10 including .sup.1H and .sup.13C NMR, HSQC, and HSQC-TOCSY (90 ms and 10 ms) enabled signal assignments and the observation of key correlations. HSQC spectra provided CH coupling information, and HSQC-TOCSY with 90 ms and 10 ms mixing times indicated independent coupling correlations of terminal and internal GlcA or GlcNAc residues. In the example of O3 containing two GlcA residues, the chemical shifts of the internal GlcA are more downfield for H3 (differ by 0.30 ppm), H4 (differ by 0.17 ppm), H5 (differ by 0.07 ppm), C1 (differ by 0.11 ppm), C2 (differ by 0.73 ppm), C3 (differ by 0.34 ppm), C4 (differ by 4.95 ppm), and C5 (differ by 3.18 ppm), but more upfield for H-1 (differ by 0.18 ppm) than that of the terminal GlcA.
[0085] In conclusion, N-terminal truncated His.sub.6-80PmHS2 with improved expression level and stability was shown to be an efficient catalyst for gram-scale sequential OPME synthesis of heparosan oligosaccharides up to hexasaccharide O6. Reverse glycosylation activities of His.sub.6-80PmHS2 were characterized and shown to be responsible for poor yields and complications in His.sub.6-80PmHS2-involved OPME synthesis of longer oligosaccharides. Key catalytic base residues for the 1-4-GlcAT and the 1-4-GlcNAcT activities of His.sub.6-80PmHS2 were identified. His.sub.6-80PmHS2 D500N and His.sub.6-80PmHS2 D222N mutants were generated as single functional 1-4-GlcAT and al-4-GlcNAcT with significantly decreased reverse 1-4-GlcNAcT and reverse 1-4-GlcAT glycosyltransferase activities, respectively. They have been used as efficient catalysts for sequential OPME synthesis of longer length heparosan oligosaccharides (O7-O10). The study draws attention to the consideration of reverse glycosylation activities of glycosyltransferases including polysaccharide synthases when applying them in the synthesis of oligosaccharides and polysaccharides. The mutagenesis strategy has the potential to be extended to other multifunctional polysaccharide synthases with reverse glycosylation activities, especially those use sugar nucleotides containing the same nucleotide component, to generate catalysts with improved synthetic efficiency.
Example 6-[0085] Designing His.SUB.6.-80PmHS2 Mutants to Accommodate UDP-GlcNAc Derivatives
[0086] This example describes the design of His.sub.6-80PmHS2 mutants to accommodate UDP-GlcNAc derivatives with modification at C-6 of GlcNAc, such as UDP-6-O-sulfo-GlcNAc (UDP-GlcNAc60S) and/or UDP-6-N-sulfo-GlcNAc (UDP-GlcNAc6NS).
[0087] Residues (S496, G497, M498 in SEQ ID NO:3) of His.sub.6-80PmHS2 were chosen for mutagenesis to better accommodate C-6-modification at the GlcNAc in UDP-GlcNAc. The mutant deleting G497 was shown by high-resolution mass spectrometry to be able to catalyze the formation of GlcNAc60Sa1-4GlcAr3proNHFmoc from GlcAproNHFmoc and UDP-GlcNAc60S. It retains both 1-4GlcA-transferase and 1-4GlcNAc-transferase activities.
Example 7Designing His.SUB.6.-80PmHS2 Mutants to Accommodate UDP-GlcA Derivatives
[0088] This example describes the design of His.sub.6-80PmHS2 mutants to accommodate UDP-GlcA derivatives with modification at C-2 of GlcA such as UDP-GlcA2N3.
[0089] Residues of His.sub.6-80PmHS2 located at a -strand (Y176 in SEQ ID NO:3), a loop (R195, L196, F198, I199, T200 in SEQ ID NO:3), and N248 in SEQ ID NO:3 near the C-2 position of GlcA in UDP-GlcA were chosen for mutagenesis. Mutants including Y176A, R195A, L196A, I199A, or T200A retained the 1-4GlcA-transferase activity.
Example 8Designing His.SUB.6.-80PmHS2 Mutants to Accommodate UDP-GlcNAc Derivatives
[0090] This example describes the design of His.sub.6-80PmHS2 mutants to accommodate UDP-GlcNAc derivatives with modification at C-3 of GlcNAc, such as UDP-3-O-sulfo-GlcNAc (UDP-GlcNAc30S), UDP-3-azido-GlcNAc (UDP-GlcNAc3N3), and/or UDP-3-N-sulfo-GlcNAc (UDP-GlcNAc3NS).
[0091] Residues (K390, L473, T475, T477, and V478 in SEQ ID NO:3) of His.sub.6-80PmHS2 were chosen for mutagenesis to better accommodate C-3-modification at the GlcNAc in UDP-GlcNAc. T475A and T477A mutants retained al-4-GlcNAc-transferase activity.
Example 9DXD Motif Mutation
[0092] The triple mutant His.sub.6-80PmHS2 D410N-D412N-D500N in SEQ ID NO:3 was generated. It was shown to reduce the forward and the reverse 1-4-GlcNAc-transferase activities while retained the 1-4GlcA-transferase activity of His.sub.6-80PmHS2.
Example 10 Experimental Methods
[0093] Materials and general methods. Chemicals were purchased and used without further purification. .sup.1H NMR and .sup.13C NMR spectra were recorded on 800 MHz Bruker Avance III spectrometers. High resolution electrospray ionization (ESI) mass spectra were obtained using Thermo Electron LTQ-Orbitrap Hybrid MS at the Mass Spectrometry Facility in the University of California, Davis. Silica gel 60 (230-400 mesh, Sorbent Technologies) was used for flash column chromatography. Discover C18 cartridges were bought from Sigma. Thin-layer chromatography (TLC, Sorbent Technologies) was performed on silica gel plates using anisaldehyde sugar staining or 5% sulfuric acid in ethanol staining for detection. Bifidobacterium longum strain ATCC55813 N-acetylhexosamine-1-kinase (BLNahK),.sup.2 Pasteurella multocida N-acetylglucosamine uridyltransferase (PmGlmU),.sup.3 Pasteurella multocida inorganic pyrophosphatase (PmPpA),.sup.4 Arabidopsis thaliana glucuronokinase (AtGlcAK),.sup.5 and Bifidobacterium longum UDP-sugar pyrophosphorylase (BLUSP).sup.6 were expressed and purified as described previously. GlcA2AA.sup.7 was synthesized as reported previously.
[0094] Bacterial strains, plasmids, and materials. Nickel-nitrilotriacetic acid agarose (Ni.sup.2+-NTA agarose) was purchased from Qiagen (Valencia, Calif., USA). Vector pET-15b was from EMD Millipore (Billerica, Mass., USA). Chemically competent DH5 and BL21 (DE3) cells were purchased from Invitrogen (Carlsbad, Calif., USA).
[0095] His.sub.6-80PmHS2 cloning. His.sub.6-80PmHS2 was cloned into pET15b vector using His.sub.6-PmHS2 in pET-15b vector.sup.7 as a template. Primers used were: forward 5-ATCACAGCTTTGAAAAAATATATACCT ATAATCAAGCATTAGAAGC-3 (SEQ ID NO: 8) and reverse 5-GATGATGATGATGGCTGCTACCC-3 (SEQ ID NO: 9). Polymerase chain reactions (PCRs) were performed in a reaction mixture of 50 L containing the His.sub.6-PmHS2-pET15b gene (72 ng), forward and reverse primers (1 M each), 5Phusion HF reaction buffer (10 L), dNTP mixture (2 mM), and Phusion DNA polymerase (1 U, 0.5 PCR procedure included an initial denaturing at 98 C. for 30 s, followed by 35 cycles of 10 s at 98 C., 20 s at 60 C., and 3 min at 72 C. For the final extension, the reaction was held at 72 C. for 10 min. The resulting PCR product was treated with DPN1 enzyme for 3 h at 37 C. The digested and purified PCR product was ligated, and transformed into Z-Competent E. coli DH5 cells. Positive plasmids (determined by DNA sequencing) were selected and transformed into E. coli BL21 (DE3) chemical competent cells.
[0096] Cloning of His.sub.6-A80PmHS2 D291N and D569N mutants. His.sub.6-80PmHS2-pET-15b was used as a template for mutagenesis. The primers used for D291N mutant were: forward 5-TAAAGGCTCAAACGATGAGTTTTTTC-3 (SEQ ID NO: 10) and reverse 5-GTCGTACAATTGAAGAAAC-3 (SEQ ID NO: 11). The primers used for D291N mutant were: forward 5-TCAGGCATGGCTAATATCTATTTCTCTCTCTTGTG-3 (SEQ ID NO: 12) and reverse 5-ATGGGTAAAGTCAGAAAGAGAAAATTGATTAAAGAGAC-3 (SEQ ID NO: 13). Polymerase chain reactions (PCRs) were performed in a reaction mixture of 50 L including the His.sub.6-80PmHS2 pET-15b gene (10 ng), forward and reverse primers (0.5 M each), 5Phusion HF reaction buffer (10 L), dNTP mixture (2 mM), and Phusion DNA polymerase (1 U, 0.5 L). The PCR procedure included an initial denaturing at 98 C. for 30 s, followed by 30 cycles of 10 s at 98 C., 30 s at 63 C., and 4 min at 72 C. For the final extension, the reaction was held at 72 C. for 10 min. The linearized purified PCR product was subjected to Kinase-Ligase-Dpn1 (KLD) enzyme reactions followed by transformation into chemical competent E. coli DH5 cells. Positive plasmids were selected and transformed into E. coli BL21 (DE3) chemical competent cells.
[0097] Protein expression and purification. The plasmid-bearing E. coli BL21(DE3) cells were cultured in 1 L of LB-rich media (10 g/L tryptone, 5 g/L yeast extract and 10 g/L NaCl) supplemented with ampicillin (100 g/mL). Expression of the target protein was achieved by inducing the E. coli culture with 0.1 mM of isopropyl-1-thio--D-galactopyranoside (IPTG) when OD.sub.600 nm reached 0.8-1.0, followed by incubating at 20 C. for 20 h with shaking at 250 rpm in a C25KC incubator shaker (New Brunswick Scientific, Edison, N.J.). Histidine-tagged target proteins were purified from cell lysate. To obtain the cell lysate, cell pellet harvested by centrifugation at 2,795 g for 50 min was resuspended (25 mL/L cell culture) in lysis buffer (Tris-HCl, 100 mM, pH 8.0 with 0.1% Triton X-100). Sonication protocol was 2 s (sonication)/3 s (rest) for a total of 6 min on ice. Lysed cells were centrifuged at 5,000 g for 50 min and the supernatant (lysate) was collected. Purification of histidine-tagged proteins from the lysate was achieved using a Ni-resin column. The column was pre-equilibrated with 10 column volumes of binding buffer (5 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). The lysate was then loaded, and the column was washed with 10 column volumes of binding buffer and 10 column volumes of washing buffer (16 mM imidazole, 0.5 M NaCl, 50 mM Tris-HCl, pH 7.5). The target protein was eluted with Tris-HCl buffer (50 mM, pH 7.5) containing imidazole (200 mM) and NaCl (0.5 M). The fractions containing the purified enzymes were collected, and stored at 4 C.
[0098] Relative activity comparison of His.sub.6-PmHS2 and His.sub.6-80PmHS2 using GlcAProNHFmoc (O1) or GlcNAcProNHFmoc as an acceptor to form the corresponding disaccharide product GlcNAc1-4GlcAProNHFmoc or GlcA1-4GlcNAcProNHFmoc. Reactions were carried out in triplicate at 37 C. for 30 min in a reaction mixture (20 L) containing MES buffer (100 mM, pH 6.5), MnCl.sub.2 (10 mM), a donor substrate (UDP-GlcA or UDP-GlcNAc, 1 mM), a monosaccharide acceptor (GlcAProNHFmoc O1 or GlcNAcProNHFmoc, 1 mM, see below for their synthesis), and enzyme His.sub.6-PmHS2 or His.sub.6-80PmHS2 (0.06 or 1.5 mg/mL). Reactions were stopped by heating reaction mixtures at 70 C. for 10 min, followed by incubation on ice for 30 min and centrifugation at 11,337 g for 15 min. Chromatographic separation and detection were achieved with an Infinity 1290 II HPLC equipped with 1260 Infinity II Diode Array Detector WR (monitored at 254 nm, Agilent Technologies, CA) with a ZORBAX Eclipse Plus C18 Rapid Resolution HD column (1.8 m particle, 2.150 mm, Agilent Technologies, CA) and an isocratic flow (0.7 mL/min) of a mixed solvent (27% acetonitrile/73% of water with 0.1% TFA).
[0099] Kinetics studies of His.sub.6-PmHS2 and His.sub.6-80PmHS2 using GlcA2AA as the acceptor substrate. All kinetics reactions were performed in triplicates at 37 C. for 30 min in MES buffer (200 mM, pH 6.5) containing UDP-GlcNAc (1 mM), MnCl.sub.2 (10 mM), GlcA2AA (0, 0.2, 0.5, 1.0, 2.0, 4.0, 100, 15.0 mM for His.sub.6-PmHS2; and 0, 0.2, 0.5, 1.0, 2.0, 4.0, 8.0, 10.0, 15.0 mM for His.sub.6-80PmHS2), and enzyme His.sub.6-PmHS2 (175 nM) or His.sub.6-80PmHS2 (164 nM). Reactions were stopped by heating reaction mixtures at 70 C. for 10 min, followed by incubation on ice for 30 min and centrifugation at 11,337 g for 15 min. Reactions were stopped and assayed similarly to that described above for relative activity comparison studies using two different monosaccharide acceptors except for an isocratic flow (0.5 mL/min) of a mixed solvent (19% acetonitrile/81% of water with 0.1% TFA) was used for UHPLC assays. Apparent kinetic parameters for reactions with a fixed concentration (1 mM) of UDP-GlcNAc and varying GlcA2AA concentrations were determined in GraFit 5.0 by non-linear regression. Data for repeated experiments were obtained.
[0100] Thermostability assays. His.sub.6-PmHS2 (0.6 M) or His.sub.6-80PmHS2 (0.5 M) was incubated at different temperatures ranging from 25 C. to 50 C. for 30 min followed by incubation on ice for 10 min before the samples were centrifuged and the supernatants were used for activity assays at 37 C. for 30 min in duplicate in a reaction mixture containing the enzyme, UDP-GlcNAc (1 mM), GlcA2AA (1 mM), MnCl.sub.2 (10 mM) in MES buffer (200 mM, pH 6.5). UHPLC detection was carried out similarly as described above for kinetics studies.
[0101] Survival of lyophilization assays. Purified His.sub.6-80PmHS2 samples were dialyzed against Tris-HCl buffer (20 mM, pH 7.5) at 4 C. and lyophilized. The resulting powders were stored at 80 C. for 3 days. For activity assays, the dried powder was dissolved in water. The activity assays were carried out in duplicate at 37 C. for 10 min in a total volume of 20 containing MES buffer (100 mM, pH 6.5), UDP-GlcNAc (1 mM), GlcAProNHFmoc O1 (1 mM), MnCl.sub.2 (10 mM), and His.sub.6-80PmHS2 (3 g). Chromatographic separation and detection were achieved similarly as described above for the kinetics studies except that an isocratic flow (0.3 mL/min) of a mixed solvent (32% acetonitrile/68% water with 0.1% TFA) was used for elution.
[0102] pH Profile assays. The assays were performed in duplicate in a reaction mixture (20 L) containing a buffer (200 mM) with a pH in the range of 3.0-11.0, UDP-GlcNAc (1 mM), GlcA2AA (1 mM), MnCl.sub.2 (10 mM), and His.sub.6-80PmHS2 (0.5 g). Buffers used were: citrate, pH 3.0-4.0; ammonium acetate, pH 4.5; MES, pH 5.0-6.5; Tris-HCl, pH 7.0-9.0; N-cyclohexyl-3-aminopropanesulfonic acid (CAPS), pH 9.5-11.0. Reactions were allowed to proceed for 30 min at 37 C. and were stopped by adding 20 L of cold methanol to each reaction mixture. Chromatographic separation and detection were achieved similarly to that described above for kinetics studies.
[0103] Donor substrate specificity assays. All reactions were performed in duplicate in a reaction mixture (20 L) containing MES buffer (200 mM, pH 6.5), a UDP-GlcNAc derivative (1 mM), GlcA2AA (1 mM), MnCl.sub.2 (10 mM), and an enzyme (16 M) at 37 C. for 1 h and 13 h, respectively. Chromatographic separation and detection were achieved similarly to that described above for kinetics studies.
[0104] The effect of UDP concentration on the reverse glycosylation activities of His.sub.6-PmHS2 and His.sub.6-80PmHS2. Reactions were carried out in triplicate at 37 C. for 15 h in reaction mixtures (20 L) containing MES buffer (100 mM, pH 6.5), MnCl.sub.2 (10 mM), O6 (1 mM), UDP with a concentration varying from 0, 1, 5, and 10 mM, and enzyme (His.sub.6-PmHS2 or His.sub.6-80PmHS2, 15 M). Reactions were stopped by heating reaction mixtures at 70 C. for 10 min followed by incubation on ice for 30 min, and centrifugation at 11,337 g for 15 min. Supernatants were analyzed using an Infinity 1290 II HPLC equipped with 1260 Infinity II Diode Array Detector WR (monitored at 254 nm, Agilent Technologies, CA). An AdvanceBio Glycan Mapping column (1.8 m particle, 2.1150 mm, Agilent Technologies, CA) was used with a gradient (13 min) of 0.5 mL/min for 90% to 70% acetonitrile and a solution of water with 0.1% TFA for analysis.
[0105] Coupled-enzyme reverse glycosylation assay. Reactions (20 L) were carried out in triplicate at 37 C. for 15 h in MES buffer (100 mM, pH 6.5) containing MnCl.sub.2 (10 mM), O6 (1 mM), UDP (10 mM), Lac MU (1 mM), NmLgtA (2 M), and His.sub.6-80PmHS2 (15 M). Negative control reactions without NmLgtA, His.sub.6-80PmHS2, or UDP and a positive control reaction for NmLgtA (6 M) with UDP-GlcNAc (1 mM) and Lac MU (1 mM) were carried out at the same time. Reactions were stopped by heating reaction mixtures at 70 C. for 10 min followed by incubation on ice for 30 min and centrifuged at 11,337 g for 15 min. Supernatants were analyzed similarly to that described above for the effect of UDP concentration on reverse glycosylation activity of His.sub.6-80PmHS2. Fmoc-containing compounds (O6 and oligosaccharides formed by reverse glycosylation reaction of His.sub.6-80PmHS2) and MU-containing compounds were monitored at 254 nm and 315 nm, respectively.
[0106] Time-course reverse glycosylation assays. Reactions were carried out in duplicate at 37 C. for 15 h in reaction mixtures (120 L) containing MES buffer (100 mM, pH 6.5), MnCl.sub.2 (10 mM), O6 or O5 (1 mM), UDP (10 mM), and His.sub.6-80 PmHS2 (15 M). An aliquot of reaction mixture (20 L) was withdrawn at different reaction times (30 min, 1 h, 2 h, 6 h, and 13 h, respectively), heated at 70 C. for 10 min, incubated on ice for 30 min, centrifuged at 11,337 g for 15 min, and the supernatants were analyzed similarly to that described above for the effect of UDP concentration on reverse glycosylation activity of 80PmHS2 except that a 9 min gradient was used for HPLC analysis.
[0107] 1-4-GlcNAcT activity comparison of His.sub.6-80PmHS2 and its D222N and D500N mutants. Reactions were carried out in duplicate at 37 C. for 30 min (when 0.68 M enzyme was used) or 1 h (when 30 M enzyme was used) in reaction mixtures (20 L) containing MES buffer (100 mM, pH 6.5), MnCl.sub.2 (10 mM), GlcAProNHFmoc O1 (1 mM), UDP-GlcNAc (1 mM), and an enzyme (His.sub.6-80PmHS2, His.sub.6-80PmHS2 D222N, His.sub.6-80PmHS2 D500N, 0.68 M or 30 M). Reactions were stopped by heating reaction mixture at 70 C. for 10 min, followed by incubation on ice for 30 min and centrifugation at 11,337 g for 15 min. Supernatants were analyzed similarly to that described above for survival of lyophilization assays.
[0108] 1-4-GlcAT activity comparisons of His.sub.6-80PmHS2 and its D222N and D500N mutants. Reactions were carried out in duplicate at 37 C. for 30 min (when 0.68 M enzyme was used) or 1 h (when 30 M enzyme was used) in a reaction mixture (20 L) containing MES buffer (100 mM, pH 6.5), MnCl.sub.2 (10 mM), disaccharide O2 (1 mM), UDP-GlcA (1 mM), and an enzyme (His.sub.6-80PmHS2, His.sub.6-80PmHS2 D222N, or His.sub.6-80PmHS2 D500N, 0.68 M or 30 M). Reactions were stopped by heating reaction mixtures at 70 C. for 10 min, followed by incubation on ice for 30 min and centrifugation at 11,337 g for 15 min. Supernatants were analyzed similarly to that described above for the coupled-enzyme reverse glycosylation assay.
[0109] Reverse glycosylation assay comparison for His.sub.6-80PmHS2 and its D222N or D500N mutants mimicking synthetic conditions (with 30 mM UDP) and in the presence of a higher concentration of UDP (100 mM). Reactions were carried out in triplicate at 37 C. for 15 h in a reaction mixture (20 L) containing Tris-HCl buffer (100 mM, pH 7.5), MgCl.sub.2 (20 mM), hexasaccharide O6 or pentasaccharide O5 (20 mM), UDP (30 mM or 100 mM), and an enzyme (His.sub.6-80PmHS2 D291N, His.sub.6-80PmHS2 D569N, or His.sub.6-80PmHS2, 4.5 M). Reactions were stopped by heating reaction mixtures at 70 C. for 10 min, followed by incubation on ice for 30 min and centrifugation at 11,337 g for 15 min. Supernatants were analyzed similarly to that described above for time-course reverse glycosylation assays.
[0110] Synthesis of GlcAProNHFmoc (O1).
##STR00004##
[0111] 1-O-(3-Azidoopropyl)--D-glucopyranuronic acid (GlcAProN3).sup.7 (1.05 g, 4.58 mmol) was dissolved in MeOH (100 mL) and Pd/C (200 mg) was added. The mixture was stirred at room temperature under an H.sub.2 atmosphere for 2 h, then filtered and concentrated. The obtained amine residue was dissolved in aqueous 10% Na.sub.2CO.sub.3 (40 mL) and dioxane (30 mL). Fmoc-OSu (1 eq., 1.7 g, 5.04 mmol) was dissolved in dioxane (30 mL) and added drop-wisely to the mixture at 0 C. The resulting mixture was stirred at room temperature for 2 h before it was concentrated. The resulting residue was purified by silica gel chromatography (EtOAc:MeOH:H.sub.2O=8:2:1, by volume) to produce O1 as a white solid (1.88 g, 83%). .sup.1H NMR (800 MHz, MeOD) 7.70 (d, J=7.2 Hz, 2H), 7.57 (dd, J=7.2 Hz, 1H), 7.56 (dd, J=7.2 Hz, 1H), 7.29 (t, J=7.2 Hz, 2H), 7.22 (t, J=7.2 Hz, 1H), 7.21 (t, J=7.2 Hz, 1H), 4.24 (d, J=7.2 Hz, 2H, CHCH.sub.2O_.sub.Fmoc), 4.17 (t, J=7.2 Hz, 1H, H.sub.GlcA-1), 4.11 (t, J=7.2 Hz, 1H, CHCH.sub.2O_.sub.Fmoc), 3.93-3.90 (m, 1H, OCH.sub.2CH.sub.2CH.sub.2N), 3.50-3.47 (m, 1H, OCH.sub.2CH.sub.2CH.sub.2N), 3.48 (d, J=8.8 Hz, 1H, H.sub.GlcA-5), 3.34 (t, J=8.8 Hz, 1H, H.sub.GlcA-4), 3.32 (t, J=8.8 Hz, 1H, H.sub.GlcA-3), 3.20-3.11 (m, 3H, OCH.sub.2CH.sub.2CH.sub.2N, H.sub.GlcA-2), 1.71-1.66 (m, 2H, OCH.sub.2CH.sub.2CH.sub.2N); .sup.13C NMR (200 MHz, MeOD) 175.45, 157.52, 143.91, 143.86, 141.11, 141.10, 127.26, 126.67, 124.76, 124.72, 119.51, 119.40, 102.77 (C.sub.GlcA-1), 76.37(C.sub.GlcA-3), 74.36(C.sub.GlcA-5), 73.44(C.sub.GlcA-2), 72.22(C.sub.GlcA-4), 66.39 (OCH.sub.2CH.sub.2CH.sub.2N), 66.11 (CHCH.sub.2O_.sub.Fmoc), 47.10 (CHCH.sub.2O_.sub.Fmoc), 36.96 (OCH.sub.2CH.sub.2CH.sub.2N), 29.29 (OCH.sub.2CH.sub.2CH.sub.2N). HRMS (ESI) m/z: [MH].sup. calculated for C.sub.24H.sub.26NO.sub.9 472.1613; found 472.1608.
[0112] Synthesis of GlcNAcProNHFmoc.
##STR00005##
[0113] GlcNAcProN.sub.3.sup.4 (110 mg, 0.36 mmol) was dissolved in MeOH (7 mL) and Pd/C (15 mg) was added. The mixture was stirred at room temperature under an H.sub.2 atmosphere for overnight. The reaction mixture was then filtered and concentrated. The obtained amine residue was dissolved in MeOH (10 mL). Et.sub.3N (101 L, 0.72 mmol) and Fmoc-OSu (182 mg, 0.54 mmol) was added and the resulting mixture was stirred at room temperature for overnight. After concentration, the resulting residue was purified by silica gel chromatography (EtOAc:MeOH=4:1, by volume) to produce the product GlcNAcProNHFmoc as a white solid (157 mg, 87%). .sup.1HNMR (800 MHz, MeOD) 7.67 (d, J=7.2 Hz, 2H), 7.52 (dd, J=7.2 Hz, 2H), 7.27 (t, J=7.2 Hz, 2H), 7.19 (t, J=7.2 Hz, 2H), 4.66 (d, J=3.2 Hz, 1H, H.sub.GlcNAc-1), 4.25 (d, J=7.2 Hz, 2H, CHCH.sub.2O.sub.F_moc), 4.11 (t, J=7.2 Hz, 1H, CHCH.sub.2O_.sub.Fmoc), 3.82 (dd, J=4.0 and 11.2 Hz, 1H), 3.74 (dd, J=2.4 and 12.0 Hz, 1H), 3.65-3.48 (m, 4H), 3.31-3.08 (m, 4H), 1.90 (s, 3H); 1.68-1.65 (m, 2H); .sup.13C NMR (200 MHz, MeOD) 173.60, 172.46, 157.59, 143.96, 143.90, 141.19, 127.41, 126.77, 124.76, 124.75, 119.58, 97.16, 72.48, 71.65, 70.97, 66.18, 64.44, 61.36, 47.11, 37.25, 29.33, 24.93, 21.34. HRMS (ESI) m/z: [M+H].sup.+ calculated for C.sub.26H.sub.33N.sub.2O.sub.8 501.2237; found 501.2242.
[0114] General procedures for adding GlcNAc via the one-pot four-enzyme GlcNAc-glycosylation system. Reactions were carried out in an incubator shaker at 30 C. for 1-2 days with agitation at 100 rpm. Reaction mixtures contain Tris-HCl buffer (100 mM, pH 7.5), MgCl.sub.2 (20 mM), an acceptor substrate (O1, O3, O5, O7, or O9, 20 mM), D-GlcNAc (1.5 equiv.), ATP (1.5 equiv.), UTP (1.5 equiv.), BLNahK (0.25 mg/mL), PmGlmU (0.20 mg/mL), PmPpA (0.20 mg/mL), and a glycosyltransferase (0.30 mg/mL) selected from His.sub.6-80PmHS2 (for O1, O3, or O5) and His.sub.6-80PmHS2 D222N (for O7 or O9). The product formation was monitored by mass spectrometry. When an optimal yield was achieved, the reaction was quenched by adding a same volume of ice-cold ethanol followed by incubating the mixture at 4 C. for 30 min. The mixture was centrifuged and the precipitates were removed. The supernatant was concentrated and the residue was purified using an ODS-SM column (51 g, 50 m, 120 , Yamazen) on a CombiFlash Rf 200i system. After loading the sample, the column was washed with water for 5 min and the product was eluted with a gradient (25 min) of 0-100% acetonitrile in water (v/v). The glycan-containing fractions were analyzed by TLC and MS and the fractions containing pure products were collected and lyophilized to obtain the desired product as a white powder.
[0115] General procedures for adding GlcA via the one-pot four-enzyme GlcA-glycosylation system. Reactions were carried out in an incubator shaker at 30 C. for 24 h with agitation at 100 rpm. Reaction mixtures contain Tris-HCl buffer (100 mM, pH 8.0), MgCl.sub.2 (20 mM), an acceptor substrate (O2, O4, O6, or O8, 20 mM), D-GlcA (1.4 equiv.), ATP (1.5 equiv.), UTP (1.5 equiv.), AtGlcAK (0.5 mg/mL), BLUSP (0.6 mg/mL), PmPpA (0.20 mg/mL), and a glycosyltransferase (0.25 mg/mL) selected from His.sub.6-80PmHS2 (for O2, or O4) and His.sub.6-80PmHS2 D500N (for O6 or O8). The product formation was monitored by mass spectrometry. When an optimal yield was achieved, the reaction was quenched by adding a same volume of ice-cold ethanol followed by incubating the mixture at 4 C. for 30 min. The mixture was centrifuged and the precipitates were removed. The supernatant was concentrated and the residue was purified using an ODS-SM column (51 g, 50 m, 120 , Yamazen) on a CombiFlash Rf 200i system. After loading the sample, the column was washed with water for 5 min and the product was eluted with a gradient (25 min) of 0-100% acetonitrile in water (v/v). The glycan-containing fractions were analyzed by TLC and MS and the fractions containing pure products were collected and lyophilized to obtain the desired product as a white powder.
[0116] GlcNAc1-4GlcAProNHFmoc (O2). 2.12 g, 96%. .sup.1H NMR (800 MHz, MeOD) 7.68 (d, J=7.2 Hz, 2H), 7.54 (dd, J=8.0 Hz, 2H), 7.28 (t, J=7.2 Hz, 2H), 7.21 (t, J=7.2 Hz, 2H), 5.29 (d, J=4.0 Hz, 1H, H.sub.GlcNAc-1), 4.24 (d, J=7.2 Hz, 2H, CHCH.sub.2O_.sub.Fmoc), 4.16 (d, J=7.2 Hz, 1H, H.sub.GlcA-1), 4.09 (t, J=7.2 Hz, 1H, CHCH.sub.2O_.sub.Fmoc), 3.81-3.78 (m, 3H, H.sub.GlcNAc-2, H.sub.GlcNAc-6a, OCH.sub.2CH.sub.2CH.sub.2N), 3.69 (t, J=8.0 Hz, 1H, H.sub.GlcA-4), 3.67-3.65 (m, 1H, H.sub.GlcNAc-5), 3.61 (d, J=9.6 Hz, 1H, H.sub.GlcA-5), 3.58-3.54 (m, 2H, H.sub.GlcNAc-6b, H.sub.GlcNAc-3), 3.51 (t, J=8.0 Hz, 1H, H.sub.GlcA-3), 3.45-3.42 (m, 1H, OCH.sub.2CH.sub.2CH.sub.2N), 3.19-3.08 (m, 4H, H.sub.GlcA-2, H.sub.GlcNAc-4, OCH.sub.2CH.sub.2CH.sub.2N), 1.91 (s, 3H), 1.68-1.64 (m, 2H, OCH.sub.2-C{right arrow over (H)}.sub.2CH.sub.2N); .sup.13C NMR (200 MHz, MeOD) 174.93, 172.30, 157.46, 143.87, 143.85, 141.11, 127.28, 126.67, 124.73, 124.69, 119.43, 102.83 (C.sub.GlcA-1), 96.97 (C.sub.GlcNAc-1), 77.13 (C.sub.GlcA-5), 76.61 (C.sub.GlcA-3), 76.52 (C.sub.GlcA-4), 73.93 (C.sub.GlcA-2), 72.37 (C.sub.GlcNAc-5), 71.60 (C.sub.GlcNAc-3), 71.18 (C.sub.GlcNAc-4), 66.51 (OCH.sub.2CH.sub.2CH.sub.2N), 66.10 (CHCH.sub.2O_.sub.Fmoc), 61.41 (C.sub.GlcNAc-6), 54.04 (C.sub.GlcNAc-2), 47.03 (CHCH.sub.2O_.sub.Fmoc), 37.10 (OCH.sub.2CH.sub.2CH.sub.2N), 29.33 (OCH.sub.2CH.sub.2CH.sub.2N), 21.39 (CH.sub.3). HRMS (ESI) m/z: [MH].sup. calculated for C.sub.32H.sub.39N.sub.2O.sub.14 675.2407; found 675.2411.
[0117] GlcA1-4GlcNAc1-4GlcAProNHFmoc (O3). 1.94 g, 99%. .sup.1H NMR (800 MHz, MeOD) 7.74 (d, J=7.2 Hz, 2H), 7.60 (d, J=7.2 Hz, 2H), 7.34 (t, J=7.2 Hz, 2H), 7.27 (t, J=7.2 Hz, 2H), 5.35 (d, J=4.0 Hz, 1H, H-1), 4.40 (d, J=8.0 Hz, 1H, H-1), 4.30 (d, J=7.2 Hz, 2H, CHCH.sub.2O_.sub.Fmoc), 4.22 (d, J=7.2 Hz, 1H, H-1), 4.15 (t, J=7.2 Hz, 1H, CHCH.sub.2O_.sub.Fmoc), 3.90 (dd, J=4.0 and 12.0 Hz, 1H, H-2), 3.87-3.83 (m, 4H, H-5, H-6a, H-6b, OCH.sub.2CH.sub.2CH.sub.2N), 3.74 (t, J=9.6 Hz, 2H, H-3, H-3), 3.66 (d, J=9.6 Hz, 1H, H-5), 3.61 (t, J=9.6 Hz, 1H, H-4), 3.59 (d, J=9.6 Hz, 1H, H-5), 3.57 (t, J=8.8 Hz, 1H, H-4), 3.51-3.48 (m, 1H, OCH.sub.2CH.sub.2CH.sub.2N), 3.41 (t, J=8.8 Hz, 1H, H-3), 3.39 (t, J=8.8 Hz, 1H, H-4), 3.26-3.14 (m, 4H, H-2, H-2, OCH.sub.2CH.sub.2CH.sub.2N), 1.98 (s, 3H), 1.74-1.70 (m, 2H, OCH.sub.2CH.sub.2CH.sub.2N); .sup.13C NMR (200 MHz, MeOD) 175.09, 174.67, 172.45, 157.46, 143.87, 143.85, 141.12, 141.11, 127.27, 126.67, 124.73, 124.69, 119.42, 102.82 (C-1), 102.72 (C-1), 96.95 (C-1), 77.66 (C-4), 77.05 (C-5), 76.89 (C-4), 76.21 (C-3), 75.86 (C-3), 73.94 (C-2), 73.87 (C-5), 73.22 (C-2), 71.94 (C-4), 71.18 (C-5), 69.87 (C-3), 66.41 (OCH.sub.2CH.sub.2CH.sub.2N), 66.09 (CHCH.sub.2O_.sub.Fmoc), 59.66 (C-6), 53.91 (C-2), 47.03 (CHCH.sub.2O_.sub.Fmoc), 37.08 (OCH.sub.2CH.sub.2CH.sub.2N), 29.31 (OCH.sub.2CH.sub.2CH.sub.2N), 21.41 (CH.sub.3). HRMS (ESI) m/z: [M2H].sup.2 calculated for C.sub.38H.sub.46N.sub.2O.sub.20 425.1327; found 425.1321; [MH].sup. calculated for C.sub.38H.sub.47N.sub.2O.sub.20 851.2721; found 851.2711.
[0118] GlcNAc1-4GlcA1-4GlcNAc1-4GlcAProNHFmoc (O4). 1.87 g, 98%. .sup.1H NMR (800 MHz, MeOD) 7.69 (d, J=7.2 Hz, 2H), 7.55 (dd, J=7.2 Hz, 2H), 7.29 (t, J=7.2 Hz, 2H), 7.21 (t, J=7.2 Hz, 2H), 5.35 (d, J=4.0 Hz, 1H, H-1), 5.31 (d, J=4.0 Hz, 1H, H-1), 4.33 (d, J=8.0 Hz, 1H, H-1), 4.24 (d, J=7.2 Hz, 2H, CHCH.sub.2O_.sub.Fmoc), 4.15 (d, J=8.0 Hz, 1H, H-1), 4.10 (t, J=7.2 Hz, 1H, CHCH.sub.2O_.sub.Fmoc), 3.82-3.74 (m, 6H, H-2, H-2, H-6a, H-6b, H-6a, OCH.sub.2CH.sub.2CH.sub.2N), 3.72-3.62 (m, 5H, H-5, H-5, H-3, H-3, H-4), 3.60-3.53 (m, 5H, H-5, H-5, H-2, H-3, H-6b), 3.50-3.46 (m, 2H, H-4, H-4), 3.44-3.41 (m, 1H, OCH.sub.2CH.sub.2CH.sub.2N), 3.22 (t, J=8.8 Hz, 1H, H-3), 3.17-3.07 (m, 4H, H-4, H-2, OCH.sub.2CH.sub.2CH.sub.2N), 1.92 (s, 6H), 1.68-1.64 (m, 2H, OCH.sub.2CH.sub.2CH.sub.2N); .sup.13C NMR (200 MHz, MeOD) 174.63, 172.28, 157.45, 143.87, 143.85, 141.12, 127.28, 126.67, 124.72, 124.69, 119.42, 102.81 (C-1), 102.71 (C-1), 96.85 (C-1), 96.57 (C-1), 77.01, 76.19, 73.90, 73.67, 72.41, 71.51, 71.12, 70.82, 66.42 (OCH.sub.2CH.sub.2CH.sub.2N), 66.09 (CHCH.sub.2O_.sub.Fmoc), 61.41, 59.59, 53.97, 53.66, 47.02 (CHCH.sub.2O_.sub.Fmoc), 37.10 (OCH.sub.2CH.sub.2CH.sub.2N), 29.28 (OCH.sub.2CH.sub.2CH.sub.2N), 21.36 (2CH3). HRMS (ESI) m/z: [M2H].sup.2 calculated for C.sub.46H.sub.59N.sub.3O.sub.25 526.6724; found 526.6712; [MH].sup. calculated for C.sub.46H.sub.60N.sub.3O.sub.25 1054.3521; found 1054.3501.
[0119] GlcA1-(4GlcNAc1-4GlcA1).sub.2-ProNHFmoc (O5). 1.52 g, 87%. .sup.1H NMR (800 MHz, MeOD) 7.70 (d, J=8.0 Hz, 2H), 7.55 (dd, J=7.2 Hz, 2H), 7.29 (t, J=7.2 Hz, 2H), 7.22 (t, J=7.2 Hz, 2H), 5.35 (d, J=3.2 Hz, 1H, H-1), 5.30 (d, J=3.2 Hz, 1H, H-1), 4.33-4.32 (m, 2H, H-1, H-1), 4.25 (d, J=7.2 Hz, 2H, CHCH.sub.2O_.sub.Fmoc), 4.15 (d, J=8.0 Hz, 1H, H-1), 4.10 (t, J=7.2 Hz, 1H, CHCH.sub.2O_.sub.Fmoc), 3.85-3.32 (m, 23H), 3.24-3.08 (m, 5H), 1.92 (s, 3H), 1.91 (s, 3H), 1.68-1.64 (m, 2H, OCH.sub.2CH.sub.2CH.sub.2N); .sup.13C NMR (200 MHz, MeOD) 175.17, 174.81, 174.37, 172.43, 172.27, 157.45, 143.88, 143.86, 141.12, 127.27, 126.67, 124.72, 124.69, 119.41, 102.80 (C-1), 102.73 (C-1, C1), 96.85 (C-1), 96.68 (C-1), 78.45, 77.69, 77.17, 76.94, 76.46, 76.28, 75.87, 75.57, 73.94, 73.90, 73.74, 73.22, 71.97, 71.19, 70.82, 69.75, 69.68, 66.37 (OCH.sub.2CH.sub.2CH.sub.2N), 66.08 (CHCH.sub.2O_.sub.Fmoc), 59.82, 59.77, 53.86, 53.66, 47.03 (CHCH.sub.2O_.sub.Fmoc), 37.09 (OCH.sub.2CH.sub.2CH.sub.2N), 29.29 (OCH.sub.2CH.sub.2CH.sub.2N), 21.39 (CH.sub.3), 21.35 (CH.sub.3). HRMS (ESI) m/z: [M2H].sup.2 calculated for C.sub.52H.sub.67N.sub.3O.sub.31 614.6885; found 614.6872; [MH].sup. calculated for C.sub.52H.sub.68N.sub.3O.sub.31 1230.3842; found 1230.3837.
[0120] GlcNAc1-(4GlcA1-4GlcNAc1).sub.2-4GlcAProNHFmoc (O6). 1.60 g, 99%. .sup.1H NMR (800 MHz, MeOD) 7.69 (d, J=8.0 Hz, 2H), 7.55 (dd, J=8.0 Hz, 2H), 7.29 (t, J=7.2 Hz, 2H), 7.21 (t, J=7.2 Hz, 2H), 5.34 (d, J=3.2 Hz, 2H, H-1, H-1), 5.30 (d, J=4.0 Hz, 1H, H-1), 4.33-4.32 (m, 2H, H-1, H-1), 4.25 (d, J=6.4 Hz, 2H, CHCH.sub.2O_.sub.Fmoc), 4.15 (d, J=7.2 Hz, 1H, H-1), 4.10 (t, J=7.2 Hz, 1H, CHCH.sub.2O_.sub.Fmoc), 3.83-3.41 (m, 28H), 3.24-3.08 (m, 6H), 1.92 (s, 3H), 1.91 (s, 3H), 1.90 (s, 3H), 1.68-1.64 (m, 2H, OCH.sub.2CH.sub.2CH.sub.2N); .sup.13C NMR (200 MHz, MeOD) 174.79, 174.55, 174.40, 172.36, 172.32, 172.30, 157.46, 143.88, 143.86, 141.12, 141.11, 127.27, 126.72, 126.67, 124.73, 124.69, 119.42, 102.80 (C-1)_, 102.63 (C-1), 102.54 (C-1), 96.85 (C-1), 96.59 (C-1), 96.51 (C-1), 78.22, 77.15, 76.90, 76.40, 76.30, 76.13, 75.63, 73.92, 73.74, 72.39, 71.53, 71.19, 70.94, 70.88, 69.76, 69.66, 66.41 (OCH.sub.2CH.sub.2CH.sub.2N), 66.09 (CHCH.sub.2O_.sub.Fmoc), 61.43, 59.83, 59.73, 53.98, 53.71, 53.68, 47.03 (CHCH.sub.2O_.sub.Fmoc), 37.08 (OCH.sub.2CH.sub.2CH.sub.2N), 29.30 (OCH.sub.2CH.sub.2CH.sub.2N), 21.39, 21.38. HRMS (ESI) m/z: [M2H].sup.2 calculated for C.sub.60H.sub.80N.sub.4O.sub.36 716.2281; found 716.2260.
[0121] GlcA1-(4GlcNAc1-4GlcA1)3ProNHFmoc (O7). 566 mg, 98%. .sup.1H NMR (800 MHz, D20/MeOD) 7.80 (d, J=8.0 Hz, 2H), 7.64 (dd, J=7.2 Hz, 2H), 7.40 (t, J=7.2 Hz, 2H), 7.32 (t, J=7.2 Hz, 2H), 5.44-5.43 (m, 2H, H-1, H-1), 5.41 (d, J=3.2 Hz, 1H, H-1), 4.44-4.43 (m, 3H, H-1, H-1, H-1), 4.35 (d, J=7.2 Hz, 2H, CHCH.sub.2O_.sub.Fmoc), 4.29 (d, J=8.0 Hz, 1H, H-1), 4.19 (t, J=7.2 Hz, 1H, CHCH.sub.2O_.sub.Fmoc), 3.94-3.44 (m, 32H), 3.35-3.16 (m, 6H), 2.03 (s, 3H), 2.02 (s, 3H), 2.01 (s, 3H), 1.77-1.74 (m, 2H, OCH.sub.2CH.sub.2CH.sub.2N); .sup.13C NMR (200 MHz, D20/MeOD) 175.23, 174.79, 174.49, 174.48, 173.04, 172.96, 172.92, 157.73, 143.85, 143.82, 141.13, 134.34, 127.54, 126.93, 124.84, 124.81, 120.07, 119.60, 102.69 (C-1), 102.64 (C-1, C1, C-1), 96.69 (C-1), 96.65 (C-1), 96.61 (C-1), 78.61, 78.52, 78.23, 77.11, 76.96, 76.57, 76.54, 76.48, 76.47, 75.89, 75.66, 75.51, 75.47, 74.33, 73.88, 73.73, 73.21, 72.01, 71.06, 70.88, 70.85, 69.60, 69.51, 69.46, 66.83 (OCH.sub.2CH.sub.2CH.sub.2N), 66.27 (CHCH.sub.2O_.sub.Fmoc), 61.43, 59.78, 59.58, 53.73, 53.58, 53.55, 47.03 (CHCH.sub.2O_.sub.Fmoc), 37.20 (OCH.sub.2CH.sub.2CH.sub.2N), 29.26 (OCH.sub.2CH.sub.2CH.sub.2N), 21.67, 21.63. HRMS (ESI) m/z: [M2H].sup.2 calculated for C.sub.64H.sub.88N.sub.4O.sub.42 804.2442; found 804.2420.
[0122] GlcNAc1-(4GlcA1-4GlcNAc1).sub.3-4GlcAProNHFmoc (O8). 504 mg, 99%. .sup.1H NMR (800 MHz, D20/MeOD) 7.79 (d, J=7.2 Hz, 2H), 7.61 (dd, J=8.0 Hz, 2H), 7.40 (t, J=7.2 Hz, 2H), 7.32 (t, J=7.2 Hz, 2H), 5.41 (d, J=4.0 Hz, 1H), 5.39 (d, J=3.2 Hz, 2H), 5.37 (d, J=4.0 Hz, 1H), 4.43 (d, J=7.2 Hz, 1H), 4.42 (d, J=7.2 Hz, 2H), 4.35 (d, J=7.2 Hz, 2H, CHCH.sub.2O_.sub.Fmoc), 4.30 (d, J=7.2 Hz, 1H, H-1), 4.17 (t, J=7.2 Hz, 1H, CHCH.sub.2O_.sub.Fmoc), 3.87-3.52 (m, 37H), 3.24-3.08 (m, 7H), 2.01 (s, 3H), 2.00 (s, 9H), 1.73-1.71 (m, 2H, OCH.sub.2CH.sub.2CH.sub.2N); .sup.13C NMR (200 MHz, D.sub.2O/MeOD) 174.71, 174.60, 174.50, 174.48, 173.51, 173.45, 173.41, 157.91, 143.81, 143.79, 141.10, 127.70, 127.09, 124.87, 124.85, 119.74, 102.55, 102.52, 102.51, 96.68 (C-1), 96.63 (C-1, C-1, C-1), 78.79, 78.76, 77.07, 76.86, 76.63, 76.39, 76.30, 75.94, 75.74, 75.48, 73.75, 73.63, 72.23, 71.06, 70.78, 70.76, 70.43, 69.38, 69.34, 67.17 (OCH.sub.2CH.sub.2CH.sub.2N), 66.29 (CHCH.sub.2O_.sub.Fmoc), 61.49, 60.83, 59.76, 59.52, 53.90, 53.46, 53.43, 47.04 (CHCH.sub.2O_.sub.Fmoc), 37.23 (OCH.sub.2CH.sub.2CH.sub.2N), 29.15 (OCH.sub.2CH.sub.2CH.sub.2N), 21.81, 21.79. HRMS (ESI) m/z: [M2H].sup.2 calculated for C.sub.74H.sub.103N.sub.5O.sub.47 905.7838; found 905.7812.
[0123] GlcA1-(4GlcNAc1-4GlcA1).sub.4-ProNHFmoc (O9). 445 mg, 96%. .sup.1H NMR (800 MHz, D.sub.2O/MeOD) 7.78 (d, J=7.2 Hz, 2H), 7.59 (dd, J=8.0 Hz, 2H), 7.39 (t, J=7.2 Hz, 2H), 7.31 (t, J=7.2 Hz, 2H), 5.34 (d, J=4.0 Hz, 3H), 5.33 (d, J=3.2 Hz, 1H), 4.41 (d, J=8.0 Hz, 1H), 4.40 (d, J=8.0 Hz, 3H), 4.35 (d, J=6.4 Hz, 2H, CHCH.sub.2O_.sub.Fmoc), 4.29 (d, J=8.0 Hz, 1H, H-1), 4.16 (t, J=6.4 Hz, 1H, CH-CH.sub.2O_.sub.Fmoc), 3.88-3.42 (m, 41H), 3.30-3.07 (m, 7H), 1.98 (s, 3H), 1.97 (s, 9H), 1.69-1.66 (m, 2H, OCH.sub.2CH.sub.2CH.sub.2N); .sup.13C NMR (200 MHz, D20/MeOD) 174.99, 174.59, 174.35, 173.23, 173.18, 173.14, 157.82, 143.81, 143.78, 141.12, 127.63, 127.01, 124.86, 124.83, 119.66, 102.61, 102.57, 96.67 (C-1), 96.62 (C-1, C-1, C-1), 78.78, 78.70, 78.64, 76.96, 76.90, 76.52, 76.42, 75.85, 75.62, 75.59, 75.55, 73.79, 73.67, 73.16, 71.98, 70.89, 70.79, 69.49, 69.35, 69.32, 66.99 (OCH.sub.2CH.sub.2CH.sub.2N), 66.28 (CH-CH.sub.2O_.sub.Fmoc), 62.77, 61.46, 59.72, 59.49, 53.59, 53.48, 53.45, 47.03 (CHCH.sub.2O_.sub.Fmoc), 37.20 (OCH.sub.2CH.sub.2CH.sub.2N), 29.19 (OCH.sub.2CH.sub.2CH.sub.2N), 21.72, 21.69. HRMS (ESI) m/z: [M2].sup.2 calculated for C.sub.80H.sub.109N.sub.5O.sub.53 993.7999; found 993.7973.
[0124] GlcNAc1-(4GlcA1-4GlcNAc1).sub.4-4GlcAProNHFmoc (O10). 430 mg, 98%. .sup.1H NMR (800 MHz, D.sub.2O) 7.88 (d, J=8.0 Hz, 2H), 7.66 (dd, J=8.0 Hz, 2H), 7.46 (t, J=8.0 Hz, 2H), 7.39 (t, J=8.0 Hz, 2H), 5.38 (d, J=4.0 Hz, 1H), 5.36 (d, J=4.0 Hz, 3H), 5.35 (d, J=3.2 Hz, 1H), 4.61-4.55 (m, 6H), 4.33 (d, J=8.0 Hz, 1H, H-1), 4.26 (t, J=6.4 Hz, 1H, CHCH.sub.2O_.sub.Fmoc), 3.90-3.62 (m, 46H), 3.47 (t, J=11.4 Hz, 1H), 3.44-3.40 (m, 1H), 3.36-3.32 (m, 3H), 3.24 (t, J=8.8 Hz, 1H), 3.06-3.29 (m, 2H), 2.04-2.00 (m, 15H), 1.61-1.55 (m, 2H, OCH.sub.2CH.sub.2CH.sub.2N); .sup.13C NMR (200 MHz, D20) 174.39, 174.32, 174.29, 174.05, 174.00, 173.92, 143.83, 141.00, 127.98, 127.41, 124.95, 120.08, 118.85, 102.27, 102.22, 97.07, 96.86, 78.27, 76.34, 76.17, 76.07, 76.04, 76.02, 75.90, 75.72, 75.67, 73.38, 73.34, 73.26, 71.97, 70.68, 70.59, 69.53, 68.92, 67.51 (OCH.sub.2CH.sub.2CH.sub.2N), 65.70 (CHCH.sub.2O_.sub.Fmoc), 61.41, 59.96, 59.27, 59.25, 53.59, 53.25, 53.20, 47.31 (CHCH.sub.2O_.sub.Fmoc), 36.77 (OCH.sub.2CH.sub.2CH.sub.2N), 28.52 (OCH.sub.2CH.sub.2CH.sub.2N), 21.86. HRMS (ESI) m/z: [M3H].sup.3 calculated for C.sub.88H.sub.121N.sub.6O.sub.58 729.8901; found 729.8904; [M2H].sup.2 calculated for C.sub.88H.sub.122N.sub.6O.sub.58 1095.3391; found 1095.3393.
REFERENCES
[0125] (1) Xu, D.; Esko, J. D. Demystifying Heparan Sulfate-Protein Interactions. Annu. Rev. Biochem. 2014, 83, 129-257. [0126] (2) Lindahl, U.; Couchman, J.; Kimata, K.; Esko, J. D. Proteoglycans And Sulfated Glycosaminoglycans. In Essentials of Glycobiology, 3.sup.rd Ed.; Varki, A.; Cummings, R. D.; Esko, J. D.; Stanley, P.; Hart, G. W.; Aebi, M.; Darvill, A. G.; Kinoshita, T.; Packer, N. H.; Prestegard, J. H.; Schnaar, R. L.; Seeberger, P. H. Eds. Cold Spring Harbor (N.Y.), 2015; pp 207-221. [0127] (3) Yu, H.; Chen, X. Carbohydrate Post-Glycosylational Modifications. Org. Biomol. Chem. 2007, 5, 865-872. [0128] (4) Chavaroche, A. A.; van den Broek, L. A.; Eggink, G. Production Methods for Heparosan, A Precursor of Heparin And Heparan Sulfate. Carbohydr. Polym. 2013, 93, 38-47. [0129] (5) Li, P.; Sheng, J.; Liu, Y.; Li, J.; Liu, J.; Wang, F. Heparosan-Derived Heparan Sulfate/Heparin-Like Compounds: One Kind of Potential Therapeutic Agents. Med. Res. Rev. 2013, 33, 665-692. [0130] (6) Lanzi, C.; Cassinelli, G. Heparan Sulfate Mimetics in Cancer Therapy: The Challenge to Define Structural Determinants and the Relevance of Targets for Optimal Activity. Molecules 2018, 23, 2915. [0131] (7) Maciej-Hulme, M. L.; Skidmore, M. A.; Price, H. P. The Role of Heparan Sulfate in Host Macrophage Infection by Leishmania species. Biochem Soc Trans 2018, 46, 789-796. [0132] (8) Sinay, P.; Jacquinet, J.-C.; Petitou, M.; Duchaussoy, P.; Lederman, I.; Choay, J.; Torri, G. Total Synthesis of A Heparin Pentasaccharide Fragment Having High Affinity for Antithrombin III. Carbohydr. Res. 1984, 132, C5-C9. [0133] (9) Zong, C.; Venot, A.; Li, X.; Lu, W.; Xiao, W.; Wilkes, J. L.; Salanga, C. L.; Handel, T. M.; Wang, L.; Wolfert, M. A.; Boons, G. J. Heparan Sulfate Microarray Reveals That Heparan Sulfate-Protein Binding Exhibits Different Ligand Requirements. J. Am. Chem. Soc. 2017, 139, 9534-9543. [0134] (10) Hung, S. C.; Lu, X. A.; Lee, J. C.; Chang, M. D.; Fang, S. L.; Fan, T. C.; Zulueta, M. M.; Zhong, Y. Q. Synthesis of Heparin Oligosaccharides And Their Interaction with Eosinophil-Derived Neurotoxin. Org. Biomol. Chem. 2012, 10, 760-772. [0135] (11) Huang, T. Y.; Irene, D.; Zulueta, M. M.; Tai, T. J.; Lain, S. H.; Cheng, C. P.; Tsai, P. X.; Lin, S. Y.; Chen, Z. G.; Ku, C. C.; Hsiao, C. D.; Chyan, C. L.; Hung, S. C. Structure of The Complex Between A Heparan Sulfate Octasaccharide And Mycobacterial Heparin-Binding Hemagglutinin. Angew. Chem., Int. Ed. 2017, 56, 4192-4196. [0136] (12) Hu, Y.-P.; Lin, S.-Y.; Huang, C.-Y.; Zulueta, M. M. L.; Liu, J.-Y.; Chang, W.; Hung, S.-C. Synthesis of 3-O-Sulfonated Heparan Sulfate Octasaccharides That Inhibit The Herpes Simplex Virus Type 1 HostCell Interaction. Nat. Chem. 2011, 3, 557-563. [0137] (13) Liu, J.; Linhardt, R. J. Chemoenzymatic Synthesis of Heparan Sulfate And Heparin. Nat. Prod. Rep. 2014, 31, 1676-1685. [0138] (14) Chavaroche, A. A.; van den Broek, L. A.; Springer, J.; Boeriu, C.; Eggink, G. Analysis of The Polymerization Initiation And Activity of Pasteurella multocida Heparosan Synthase PmHS2, An Enzyme with Glycosyltransferase And UDP-Sugar Hydrolase activity. J. Biol. Chem. 2011, 286, 1777-1785. [0139] (15) Chavaroche, A. A.; Springer, J.; Kooy, F.; Boeriu, C.; Eggink, G. In vitro Synthesis of Heparosan Using Recombinant Pasteurella multocida Heparosan Synthase PmHS2. Appl. Microbiol. Biotechnol. 2010, 85, 1881-1891. [0140] (16) Xu, Y.; Masuko, S.; Takieddin, M.; Xu, H.; Liu, R.; Jing, J.; Mousa, S. A.; Linhardt, R. J.; Liu, J. Chemoenzymatic Synthesis of Homogeneous Ultralow Molecular Weight Heparins. Science 2011, 334, 498-501. [0141] (17) Liu, R.; Xu, Y.; Chen, M.; Weiwer, M.; Zhou, X.; Bridges, A. S.; DeAngelis, P. L.; Zhang, Q.; Linhardt, R. J.; Liu, J. Chemoenzymatic Design of Heparan Sulfate Oligosaccharides. J. Biol. Chem. 2010, 285, 34240-34249. [0142] (18) Chen, Y.; Li, Y.; Yu, H.; Sugiarto, G.; Thon, V.; Hwang, J.; Ding, L.; Hie, L.; Chen, X. Tailored Design and Synthesis of Heparan Sulfate Oligosaccharide Analogues Using Sequential One-Pot Multienzyme Systems. Angew. Chem., Int. Ed. 2013, 52, 11852-11856. [0143] (19) Vann, W. F.; Schmidt, M. A.; Jann, B.; Jann, K. The Structure of The Capsular Polysaccharide (K5 Antigen) of Urinary-Tract-Infective Escherichia coli 010:K5:H4. A Polymer Similar to Desulfo-Heparin. Eur. J. Biochem. 1981, 116, 359-364. [0144] (20) DeAngelis, P. L.; White, C. L. Identification And Molecular Cloning of A Heparosan Synthase from Pasteurella multocida Type D. J. Biol. Chem. 2002, 277, 7209-7213. [0145] (21) Wu, J. R.; Chen, P. Y.; Shien, J. H.; Shyu, C. L.; Shieh, H. K.; Chang, F.; Chang, P. C. Analysis of The Biosynthesis Genes And Chemical Components of The Capsule of Avibacterium paragallinarum. Vet. Microbiol. 2010, 145, 90-99. [0146] (22) DeAngelis, P. L.; White, C. L. Identification of A Distinct, Cryptic Heparosan Synthase from Pasteurella multocida Types A, D, and F. J. Bacteriol. 2004, 186, 8529-8532. [0147] (23) Kane, T. A.; White, C. L.; DeAngelis, P. L., Functional Characterization of PmHS1, A Pasteurella multocida Heparosan Synthase. J. Biol. Chem. 2006, 281, 33192-33197. [0148] (24) Sismey-Ragatz, A. E.; Green, D. E.; Otto, N. J.; Rejzek, M.; Field, R. A.; DeAngelis, P. L. Chemoenzymatic Synthesis with Distinct Pasteurella heparosan Synthases: Monodisperse Polymers And Unnatural Structures. J. Biol. Chem. 2007, 282, 28321-28327. [0149] (25) Wu, B.; Wei, N.; Thon, V.; Wei, M.; Yu, Z.; Xu, Y.; Chen, X.; Liu, J.; Wang, P. G.; Li, T. Facile Chemoenzymatic Synthesis of Biotinylated Heparosan Hexasaccharide. Org. Biomol. Chem. 2015, 13, 5098-5101. [0150] (26) DiGabriele, A. D.; Lax, I.; Chen, D. I.; Svahn, C. M.; Jaye, M.; Schlessinger, J.; Hendrickson, W. A. Structure of A Heparin-Linked Biologically Active Dimer of Fibroblast Growth Factor. Nature 1998, 393, 812-817. [0151] (27) Xu, D.; Young, J. H.; Krahn, J. M.; Song, D.; Corbett, K. D.; Chazin, W. J.; Pedersen, L. C.; Esko, J. D. Stable RAGE-Heparan Sulfate Complexes Are Essential for Signal Transduction. ACS Chem. Biol. 2013, 8, 1611-1620. [0152] (28) Ricard-Blum, S.; Beraud, M.; Raynal, N.; Farndale, R. W.; Ruggiero, F. Structural Requirements for Heparin/Heparan Sulfate Binding to Type V Collagen. J. Biol. Chem. 2006, 281, 25195-25204. [0153] (29) Vanpouille, C.; Denys, A.; Carpentier, M.; Pakula, R.; Mazurier, J.; Allain, F. Octasaccharide Is The Minimal Length Unit Required for Efficient Binding of Cyclophilin B to Heparin And Cell Surface Heparan Sulphate. Biochem. J. 2004, 382 (Pt 2), 733-740. [0154] (30) Smith, R. A. A.; Murali, S.; Rai, B.; Lu, X.; Lim, Z. X. H.; Lee, J. J. L.; Nurcombe, V.; Cool, S. M. Minimum Structural Requirements for BMP-2-Binding of Heparin Oligosaccharides. Biomaterials 2018, 184, 41-55. [0155] (31) Slabinski, L.; Jaroszewski, L.; Rodrigues, A. P.; Rychlewski, L.; Wilson, I. A.; Lesley, S. A.; Godzik, A. The Challenge of Protein Structure Determination-Lessons from Structural Genomics. Protein Sci. 2007, 16, 2472-2482. [0156] (32) Li, Y.; Yu, H.; Thon, V.; Chen, Y.; Muthana, M. M.; Qu, J.; Hie, L.; Chen, X. Donor Substrate Promiscuity of The N-Acetylglucosaminyltransferase Activities of Pasteurella multocida Heparosan Synthase 2 (PmHS2) and Escherichia coli K5 KfiA. Appl. Microbiol. Biotechnol. 2014, 98, 1127-1134. [0157] (33) Lau, K.; Thon, V.; Yu, H.; Ding, L.; Chen, Y.; Muthana, M. M.; Wong, D.; Huang, R.; Chen, X. Highly Efficient Chemoenzymatic Synthesis of beta1-4-Linked Galactosides with Promiscuous Bacterial beta1-4-Galactosyltransferases. Chem. Commun. 2010, 46, 6066-6068. [0158] (34) Li, Y.; Yu, H.; Chen, Y.; Lau, K.; Cai, L.; Cao, H.; Tiwari, V. K.; Qu, J.; Thon, V.; Wang, P. G.; Chen, X. Substrate Promiscuity of N-Acetylhexosamine 1-Kinases. Molecules 2011, 16, 6396-6407. [0159] (35) Chen, Y.; Thon, V.; Li, Y.; Yu, H.; Ding, L.; Lau, K.; Qu, J.; Hie, L.; Chen, X. One-Pot Three-Enzyme Synthesis of UDP-GlcNAc Derivatives. Chem. Commun. 2011, 47, 10815-10817. [0160] (36) Muthana, M. M.; Qu, J.; Xue, M.; Klyuchnik, T.; Siu, A.; Li, Y.; Zhang, L.; Yu, H.; Li, L.; Wang, P. G.; Chen, X. Improved One-Pot Multienzyme (OPME) Systems for Synthesizing UDP-Uronic Acids And Glucuronides. Chem. Commun. 2015, 51, 4595-4598. [0161] (37) Muthana, M. M.; Qu, J.; Li, Y.; Zhang, L.; Yu, H.; Ding, L.; Malekan, H.; Chen, X. Efficient One-Pot Multienzyme Synthesis of UDP-Sugars Using A Promiscuous UDP-Sugar Pyrophosphorylase from Bifidobacterium longum (BLUSP). Chem. Commun. 2012, 48, 2728-2730. [0162] (38) Zhang, C.; Griffith, B. R.; Fu, Q.; Albermann, C.; Fu, X.; Lee, I. K.; Li, L.; Thorson, J. S. Exploiting The Reversibility of Natural Product Glycosyltransferase-Catalyzed Reactions. Science 2006, 313, 1291-1294. [0163] (39) Gantt, R. W.; Peltier-Pain, P.; Cournoyer, W. J.; Thorson, J. S. Using Simple Donors to Drive The Equilibria of Glycosyltransferase-Catalyzed Reactions. Nat. Chem. Biol. 2011, 7, 685-691. [0164] (40) Chandrasekaran, E. V.; Xue, J.; Xia, J.; Locke, R. D.; Matta, K. L.; Neelamegham, S. Reversible Sialylation: Synthesis of Cytidine 5-Monophospho-N-Acetylneuraminic Acid from Cytidine 5-Monophosphate with alpha2,3-Sialyl O-Glycan-, Glycolipid-, And Macromolecule-Based Donors Yields Diverse Sialylated Products. Biochemistry 2008, 47, 320-330. [0165] (41) Mehr, K.; Withers, S. G. Mechanisms of The Sialidase And Trans-Sialidase Activities of Bacterial Sialyltransferases from Glycosyltransferase Family 80. Glycobiology 2016, 26, 353-359. [0166] (42) McArthur, J. B.; Yu, H.; Tasnima, N.; Lee, C. M.; Fisher, A. J.; Chen, X. Alpha2-6-Neosialidase: A Sialyltransferase Mutant as A Sialyl Linkage-Specific Sialidase. ACS Chem. Biol. 2018, 13, 1228-1234. [0167] (43) Chavaroche, A. A.; van den Broek, L. A.; Boeriu, C.; Eggink, G. Synthesis of Heparosan Oligosaccharides by Pasteurella multocida PmHS2 Single-Action Tansferases. Appl. Microbiol. Biotechnol. 2012, 95, I199-1210. [0168] (44) Li, Y.; Xue, M.; Sheng, X.; Yu, H.; Zeng, J.; Thon, V.; Chen, Y.; Muthana, M. M.; Wang, P. G.; Chen, X. Donor Substrate promiscuity of bacterial beta1-3-N-acetylglucosaminyltransferases and acceptor substrate flexibility of beta1-4-galactosyltransferases. Bioorg. Med. Chem. 2016, 24, 1696-1705. [0169] (45) Yu, H.; Chokhawala, H.; Karpel, R.; Yu, H.; Wu, B.; Zhang, J.; Zhang, Y.; Jia, Q.; Chen, X. A Multifunctional Pasteurella multocida Sialyltransferase: A Powerful Tool for The Synthesis of Sialoside Libraries. J. Am. Chem. Soc. 2005, 127, 17618-17619. [0170] (46) Yang, J.; Yan, R.; Roy, A.; Xu, D.; Poisson, J.; Zhang, Y. The I-TASSER Suite: Protein Structure And Function Prediction. Nat. Meth. 2015, 12, 7-8. [0171] (47) Roy, A.; Kucukural, A.; Zhang, Y. I-TASSER: A Unified Platform for Automated Protein Structure And Function Prediction. Nat. Protoc. 2010, 5, 725-738. [0172] (48) Osawa, T.; Sugiura, N.; Shimada, H.; Hirooka, R.; Tsuji, A.; Shirakawa, T.; Fukuyama, K.; Kimura, M.; Kimata, K.; Kakuta, Y. Crystal Structure of Chondroitin Polymerase from Escherichia coli K4. Biochem. Biophys. Res. Commun. 2009, 378, 10-14. [0173] (49) Persson, K.; Ly, H. D.; Dieckelmann, M.; Wakarchuk, W. W.; Withers, S. G.; Strynadka, N. C. Crystal Structure of The Retaining Galactosyltransferase LgtC from Neisseria meningitidis in Complex with Donor And Acceptor Sugar Analogs. Nat. Struct. Biol. 2001, 8, 166-175. [0174] (50) Lairson, L. L.; Chiu, C. P.; Ly, H. D.; He, S.; Wakarchuk, W. W.; Strynadka, N. C.; Withers, S. G. Intermediate Trapping on A Mutant Retaining Alpha-Galactosyltransferase Identifies An Unexpected Aspartate Residue. J. Biol. Chem. 2004, 279, 28339-28344. [0175] (51) Gomez, H.; Polyak, I.; Thiel, W.; Lluch, J. M.; Masgrau, L. Retaining Glycosyltransferase Mechanism Studied by QM/MM Methods: Lipopolysaccharyl-Alpha-1,4-Galactosyltransferase C Transfers Alpha-galactose via An Oxocarbenium Ion-Like Transition State. J. Am. Chem. Soc. 2012, 134, 4743-4752. [0176] (52) Jamaluddin, H.; Tumbale, P.; Withers, S. G.; Acharya, K. R.; Brew, K. Conformational Changes Induced by Binding UDP-2F-Galactose to Alpha-1,3 Galactosyltransferase-Implications for Catalysis. J. Mol. Biol. 2007, 369, 1270-1281.
[0177] Although the foregoing has been described in some detail by way of illustration and example for purposes of clarity and understanding, one of skill in the art will appreciate that certain changes and modifications can be practiced within the scope of the appended claims. All publications, patents, patent applications, and sequence accession numbers cited herein are hereby incorporated by reference in their entirety for all purposes.