Consequences of a defective switch in cutaneous squamous cell carcinoma
11053496 ยท 2021-07-06
Assignee
Inventors
Cpc classification
A61K31/7088
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
G01N33/5308
PHYSICS
G01N2800/52
PHYSICS
A61K31/713
HUMAN NECESSITIES
C12N2320/35
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K48/00
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
A61K31/713
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The present invention refers to a method of treating a carcinoma by administration of one or more of an oligonucleotide comprising the sequence of miR-198 (SEQ ID NO: 1) or a functional part thereof, or an oligonucleotide which reduces expression of Follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) or Urokinase-type plasminogen activator (PLAU). Preferably, the at least one or more oligonucleotides directed against FSTL1, DIAPH1, LAMC2 or PLAU is a shRNA or siRNA. Also provided is a method of determining the presence of carcinoma in a subject, comprising detecting and comparing the presence of miR-198 and/or at least one of FSTL1, DIAPH1, LAMC2 or PLAU, miR-181a, epidermal growth factor (EGF), and epidermal growth factor receptor (EGFR), and comparing the detected levels with that in a control sample.
Claims
1. A method of treating cutaneous squamous cell carcinoma or head and neck squamous cell carcinoma, wherein the method comprises administration of one or more oligonucleotides comprising or consisting of the sequence of miR-198 (SEQ ID: 1), a functional part thereof, or a combination thereof, an siRNA or shRNA molecule which reduces expression of follistatin-related protein 1 (FSTL1), wherein the siRNA or shRNA molecule comprises the sequence of SEQ ID NO: 7, wherein the functional part comprises or consists of 5GTCCAGAG 3 (SEQ ID NO: 2).
2. The method of claim 1, wherein the oligonucleotide is unmodified, or is modified with one or more chemical groups selected from the group consisting of 2O-methoxy, phosphorothioate, locked nucleic acid and cholesterol.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The invention will be better understood with reference to the detailed description when considered in conjunction with the non-limiting examples and the accompanying drawings, in which:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
DETAILED DESCRIPTION OF THE PRESENT INVENTION
(26) Carcinomas, for example squamous cell carcinomas (SCC), result from the uncontrolled growth of squamous cells, a subtype of epithelial cell. For example, Head and neck squamous cell carcinomas (HNSCC) develop from mucosal linings of the upper aero-digestive tract, mainly in the nasal cavity, paranasal sinuses, nasopharynx, larynx, trachea, oropharynx and oral cavity.
(27) The molecular switch disclosed herein is based on the concept that the status of a cell can have an impact, not only on the expression level of a specific gene, but also on what product is expressed by said gene. By way of an explanation, in on example the gene FSTL1 can produce either the pro-migratory FSTL1 protein, or the anti-migratory miR-198, depending on the state of the cell. It is shown, for example, the carcinoma cells have an increased level of FSTL1 protein, which, in itself is, understood to result in the pro-migratory behaviour of carcinoma cells. Carcinoma-free cells, on the contrary, are understood to express higher levels of miR-198, which contributes to the non-migratory behaviour that is observed in most disease/carcinoma free (in other words, healthy) cells. Therefore, one possible treatment method is to shift a state of a diseased cell into a state akin to a disease-free cell, thereby targeting the regulatory pathways of various targets, for example, but not limited to, any of the target proteins disclosed herein, or RNA targets disclosed herein.
(28) Disclosed herein is a molecular switch, which is essential in wound healing, but is hijacked or mis-regulated in squamous cell carcinoma (SCC). In one example, the cancer is comprised of cells, in which a molecular switch comprises, but is not limited to, the genes and/or nucleic acids involved in wound healing. In one example, the genes are, but are not limited to, genes encoding follistatin-related protein 1 (FSTL1), genes encoding Protein diaphanous homolog 1 (DIAPH1), genes encoding Laminin subunit gamma-2 (LAMC2), genes encoding Urokinase-type plasminogen activator (PLAU) and combinations thereof. In another example, the molecular switch comprises miR-198. In another example, the molecular switch comprises miR-198, and a gene, which is, but is not limited to, follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) or Urokinase-type plasminogen activator (PLAU). In yet another example, the molecular switch comprises the gene follistatin-related protein 1 (FSTL1), and a second gene, which is, but is not limited to, miR-198, Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) or Urokinase-type plasminogen activator (PLAU). In a further example, the molecular switch comprises the gene follistatin-related protein 1 (FSTL1), miR-198 and a third gene, which is, but is not limited to, Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) or Urokinase-type plasminogen activator (PLAU).
(29) The present application shows that rectification of the defective switch results in the reduction of invasive properties of, for example squamous cell carcinoma (SCC), indicating this is a strategy for the treatment of carcinomas. Thus, in one example, disclosed herein is a method of treating a carcinoma, wherein the method comprises administration of at least one or more oligonucleotides and/or at least one or more RNA molecules, wherein the one or more oligonucleotides is homologous in sequence to the nucleic acid sequence of miR-198 or a functional part thereof. In another example, the method is as disclosed herein, wherein the one or more RNA molecules reduce the level of and/or inhibit gene expression of an RNA target of, for example, miR-198. In one example, the one or more RNA molecules are, but are not limited to siRNA (small interfering RNA), shRNA (short hairpin RNA), RNAi (interfering RNA) and combinations thereof. In another example, the one or more RNA molecules are shRNA or siRNA. In yet another example, the siRNA comprises one or more sequences consisting of SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9 and SEQ ID NO: 10 and combinations thereof. In another example, the one or more RNA molecules is/are shRNA directed against FSTL1, or a combination of shRNAs which are directed against one or more targets. In another example, the one or more RNA molecules is/are siRNA directed against FSTL1, or a combination of siRNAs which are directed against one or more targets.
(30) As used herein, the term oligonucleotide refers to single-stranded or double-stranded nucleic acid polymers. In certain examples, the nucleotides comprising the polynucleotide can be ribonucleotides or deoxyribonucleotides or a modified form of either type of nucleotide. Said modifications include base modifications such as bromouridine and inosine derivatives, ribose modifications such as 2,3-dideoxyribose, and internucleotide linkage modifications such as phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phoshoraniladate and phosphoroamidate. The term includes single and double stranded forms of DNA, and single and double stranded forms of RNA. Oligonucleotides may also refer to sense or antisense oligonucleotides, depending on the context in which the term is used.
(31) As used herein, the term siRNA refers to a single-stranded RNA molecule, produced by the cleavage and processing of double-stranded RNA. The siRNA can be from 21 to 25 nucleotides in length, but can also be longer or shorter, as there is no convention in the art in regards to the length of siRNA. siRNA bind to complementary sequences in, for example, mRNA or any other RNA targets, and bring about the cleavage and degradation of the target, for example, mRNA. Other functions of siRNAs are for example, their binding to complementary sequences in DNA and bringing about their methylation.
(32) As used herein, the term shRNA refers to a short hairpin RNA or small hairpin RNA (shRNA/Hairpin Vector), which is an artificial RNA molecule with a tight hairpin turn that can be used to silence target gene expression via RNA interference. A hairpin turn, also known as a stem-loop, is an intramolecular structure that can occur in oligonucleotides, for example DNA and RNA, and is due to base pairing patterns that occur within the DNA or RNA sequence.
(33) As used herein, the term RNAi refers to RNA interference, which is a biological process in which RNA molecules inhibit gene expression or translation, by neutralizing targeted RNA molecules, for example mRNA. Two types of ribonucleic acid (RNAs) are considered to fall under the term RNAi, namely miRNA (microRNA) and siRNA (small interfering RNA).
(34) As used herein, the term functional, when used in relation to oligonucleotide sequences, refers to the capability of a fragment oligonucleotide to mimic and act in the same manner as the wild type, naturally occurring counterpart. The term functional also depends on the function that is to be achieved. For example, when referring to a protein (which also functions as an enzyme) to say that a fragment thereof is functional, that is to say that the peptide fragment functions in the same way as the full-length peptide, in spite of being only a fragment of the full-length peptide.
(35) Also disclosed herein, in one example, is a method of treating a carcinoma, wherein the method comprises administration of one or more oligonucleotides homologous in sequence to the nucleic acid sequence of miR-198 (SEQ ID NO: 1), or a functional part thereof, in combination with an inhibitor of an RNA target of miR-198, wherein the inhibitor is selected from the group consisting of siRNA, shRNA and RNAi, wherein the RNA target is selected from the group consisting of group consisting of follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), laminin subunit gamma-2 (LAMC2), urokinase-type plasminogen activator (PLAU) and combinations thereof. In other words, disclosed herein is a method of treating a carcinoma, wherein the method comprises administration of A) one or more of an oligonucleotide comprising or consisting of the sequence of miR-198 (SEQ ID NO: 1), a functional part thereof, or a combination thereof; and/or B) at least one oligonucleotide which reduces expression of any one or more of the following target proteins: follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) or Urokinase-type plasminogen activator (PLAU).
(36) In another example, a method of treating carcinoma using siRNA and/or shRNA directed against any part of follistatin-related protein 1 (FSTL1) and/or Protein diaphanous homolog 1 (DIAPH1) and/or laminin subunit gamma-2 (LAMC2) and/or urokinase-type plasminogen activator (PLAU) sequence provided in SEQ ID NOs: 3, 4, 5 and 6, and combinations thereof, is disclosed. In one example, the treatment is directed towards any part of follistatin-related protein 1 (FSTL1). In another example, the treatment is directed towards any part of. In another example, the treatment is directed towards any part of Protein diaphanous homolog 1 (DIAPH1). In another example, the treatment is directed towards any part of laminin subunit gamma-2 (LAMC2). In another example, the treatment is directed towards any part of urokinase-type plasminogen activator (PLAU).
(37) As used herein, the term modified refers the alteration of a compound, usually chemically, to add or remove functional groups to or from the chemical structure of the compound. Such a modification usually pertains to the covalent addition of a reagent or a functional group to the compound. Conversely, unmodified refers to the fact that a compound has not been chemically altered from the form it which it is most commonly found and/or which is found in nature or under standard conditions. Such modifications are can be found in proteins, and such modifications include, but are not limited to acylation (for example, myristoylation, palmitoylation), isoprenylation or prenylation, glypiation, glycosylphosphatidylinositol (GPI) anchor addition, lipoylation, addition of a flavin moiety (for example, FMN or FAD), addition of a heme group, phosphopantetheinylation, retinylidene Schiff base, glycosylation, fucosylation, alkylation, amidation, amide bond formation, hydroxylation, phosphate ester (O-linked) or phosphoramidate (N-linked) formation, pegylation, biotinylation, carbamylation, oxidation and combinations thereof. In one example, the oligonucleotide is unmodified, or is modified, with one or more chemical groups being one or more of 2O-methoxy, phosphorothioate, locked nucleic acid and cholesterol.
(38) Without being bound by theory, various methods are encompassed in the present disclosure for targeting and influencing or changing the level of gene expression of target genes. The influence of gene expression, as disclosed herein, can be an increase or decrease in the level of a target gene, for example, or any downstream product of a target gene.
(39) As used herein, the terms increase and decrease refer to the relative alteration of a chosen trait or characteristic, for example gene expression level or protein levels in a subject, in a subset of a population (for example, of cells) in comparison to the same trait or characteristic as present in the whole population. In one example, the comparison is made between diseased cells and disease-free cells. In other words, the comparison is made between diseased cells and cells from a healthy, disease-free subject. An increase, for example, in expression level, thus indicates a change on a numerically positive scale, whereas a decrease indicates a change on a numerically negative scale. The term change, as used herein, also refers to the difference between a chosen trait or characteristic of an isolated population subset (for example, a diseased population) in comparison to the same trait or characteristic in the population as a whole, or the same trait or characteristic in a disease-free, healthy population. These terms are used without valuation of the difference seen. Thus, in one example, the control sample is a sample obtained from a carcinoma-free subject.
(40) Also disclosed herein is a method of determining if a subject has a carcinoma, wherein the method comprises providing a sample comprising nucleic acids from a subject and detecting the absence or presence of miR-198; and/or detecting the absence or presence of at least one or more biomarkers in the same sample; and comparing the detected level of miR-198 with the level of miR-198 detected in a control sample; and/or comparing the detected level of the at least one or more biomarkers with the level of the at least one or more biomarkers detected in a control sample. In one example, the at least one or more biomarkers is, but not limited to, of follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), laminin subunit gamma-2 (LAMC2), urokinase-type plasminogen activator (PLAU) and combinations thereof. In another example, the biomarker is FSTL1.
(41) In another example, method of determining if a subject has a carcinoma, wherein the method comprises providing a first sample comprising nucleic acids from a subject and a. detecting the absence or presence of miR-198 in the first sample; and/or b. comparing the detected level of miR-198 with the level of miR-198 detected in a control sample; and/or providing a second sample comprising tissue from a subject and c. detecting the absence or presence of at least one or more biomarkers in the second sample; and d. comparing the detected level of the at least one or more biomarkers with the level of the at least one or more biomarkers detected in a control sample. In one example, the one or more biomarkers are one or more of the biomarkers as disclosed herein. In another example, the at least one or more biomarkers is, but is not limit to, miR-181a, epidermal growth factor (EGF) and epidermal growth factor receptor (EGFR), or a combination thereof.
(42) In the methods disclosed herein, wherein the absence or the presence of one or more biomarkers is determined, the presence of the carcinoma in question is correlated to the increase or decrease of said biomarker. In one example, the presence of a decreased level of miR-198, compared to the control sample, is indicative of the presence of carcinoma cells. In another example, the presence of an increased level of miR-198, compared to the control sample, is indicative of the absence of carcinoma cells. This effect can also be correlated to other biomarkers, as disclosed herein, which can also be present in the sample. In a further example, the presence of an increased level of at least one or more of the following biomarkers follistatin-related protein 1 (FSTL1), protein diaphanous homolog 1 (DIAPH1), laminin subunit gamma-2 (LAMC2) and urokinase-type plasminogen activator (PLAU), compared to levels of the same one or more biomarkers in a control sample, is indicative of the presence of carcinoma cells in the sample. In another example, the presence or absence of at least two or more of the biomarkers as disclosed herein is required to determine the presence or absence of carcinoma cells. In one example, the presence of an increased level of follistatin-related protein 1 (FSTL1), protein diaphanous homolog 1 (DIAPH1), laminin subunit gamma-2 (LAMC2) and urokinase-type plasminogen activator (PLAU), compared to the control sample, is indicative of the presence of carcinoma cells in the sample. In a further example, the presence of an increased level of FSTL1, compared to a control sample, is indicative of the presence of carcinoma cells in the sample. In one example, the presence of an increased level of miR-181a, EGF and EGFR, compared to a control sample, is indicative of the presence of carcinoma cells in the sample.
(43) In one example, the presence of a decreased level of at least one or more of the following biomarkers follistatin-related protein 1 (FSTL1), protein diaphanous homolog 1 (DIAPH1), laminin subunit gamma-2 (LAMC2) and urokinase-type plasminogen activator (PLAU), compared to levels of the same one or more biomarkers in a control sample, is indicative of the absence of carcinoma cells. In another example, the presence of a decreased level of follistatin-related protein 1 (FSTL1), protein diaphanous homolog 1 (DIAPH1), laminin subunit gamma-2 (LAMC2) and urokinase-type plasminogen activator (PLAU), compared to the control sample, is indicative of the absence of carcinoma cells. In another example, the presence of a decreased level of FSTL1, compared to a control sample, is indicative of the absence of carcinoma cells in the sample. In another example, the presence of a decreased level of miR-181a, EGF and EGFR, compared to a control sample, is indicative of the presence of carcinoma cells in the sample. In another example, at least the presence or absence of FSTL1 and DIAPH1 is used to determine the presence or absence of carcinoma cells. In yet another example, at least the presence or absence of miR-181a, EGF and EGFR are used to determine the presence or absence of carcinoma cells.
(44) Once it is determined, according to any one or more of the methods disclosed herein, whether a carcinoma is present in a subject or not, if a carcinoma is present, the subject can be treated according to the methods of treatment disclosed in the present disclosure. In one example, the method of determining the presence of a carcinoma in a subject is performed as disclosed herein, wherein the subject is subsequently administered i) one or more of an oligonucleotide comprising or consisting of the sequence of miR-198 (SEQ ID NO: 1), a functional part thereof, or a combination thereof; and/or ii) at least one oligonucleotide which reduces expression of any one or more of the following target proteins: follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) or Urokinase-type plasminogen activator (PLAU). In another example, the functional part of miR-198, as referred to above, comprises or consists of 5GTCCAGAG 3 (SEQ ID NO: 2).
(45) The term increased as used herein refers to greater amount, intensity, or degree relative to a control expression level. The increased in expression may be at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 100% more than that of a control expression level.
(46) The term reduced as used herein refers to decreased amount, intensity, or degree relative to a control expression level. The reduced in expression may be at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 100% less than that of a control expression level.
(47) Disclosed herein is a method of treating a carcinoma, wherein the method comprises administration of at least one or more oligonucleotides and/or at least one or more RNA molecules, wherein the one or more oligonucleotides is homologous in sequence to the nucleic acid sequence of miR-198 (SEQ ID NO: 1) or a functional part thereof; wherein the one or more RNA molecules reduce the level of and/or inhibit gene expression of an RNA target of miR-198. Thus, it is also possible and contemplated to target one or more RNA targets or miR-198. These targets can be targeted simultaneously or sequentially. In one example, the RNA target is a gene, which is, but is not limited to, follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) and Urokinase-type plasminogen activator (PLAU), and combinations thereof. In one example, the RNA target expresses a protein with an amino acid sequence selected from a group consisting of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, and SEQ ID NO: 6 and combinations thereof.
(48) In another example, there is disclosed the use of at least one or more oligonucleotides and/or at least one or more RNA molecules in the manufacture of a medicament for treating a carcinoma. In one example, the one or more oligonucleotides is homologous in sequence to the nucleic acid sequence of miR-198 (SEQ ID NO: 1) or a functional part thereof. In another example, the one or more RNA molecules reduce the level of and/or inhibit gene expression of an RNA target. In yet another example, wherein the RNA target is a gene selected from a group consisting of follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) and Urokinase-type plasminogen activator (PLAU). In a further example, the use of at least one or more oligonucleotides and/or at least one or more RNA molecules in the manufacture of a medicament for treating a carcinoma is disclosed, wherein the one or more oligonucleotides is homologous in sequence to the nucleic acid sequence of miR-198 (SEQ ID NO: 1) or a functional part thereof; and/or wherein the one or more RNA molecules reduce the level of and/or inhibit gene expression of an RNA target; wherein the RNA target is a gene selected from a group consisting of follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) and Urokinase-type plasminogen activator (PLAU). In yet a further example, the use of at least one or more oligonucleotides and/or at least one or more RNA molecules in the manufacture of a medicament for treating a carcinoma is disclosed, wherein the one or more oligonucleotides is homologous in sequence to the nucleic acid sequence of miR-198 (SEQ ID NO: 1) or a functional part thereof; and wherein the one or more RNA molecules reduce the level of and/or inhibit gene expression of an RNA target; wherein the RNA target is a gene selected from a group consisting of follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) and Urokinase-type plasminogen activator (PLAU).
(49) In order for, for example, oligonucleotides to bind and thereby target, or affect, the target gene, the oligonucleotides must possess a sequence similarity to the target gene, as such a binding is understood in the art to be dictated by, for example, complementary binding to the target sequence. In other example, the oligonucleotides mimic the function of the target gene. In such examples, the oligonucleotides would then have sequences that are similar (that is homologous to a defined percentage) or identical (i.e. 100% homologous) to the target sequence. Thus, in one example, the one or more oligonucleotides disclosed herein are about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% homologous in sequence to the nucleic acid sequence of miR-198 (SEQ ID NO: 1). In another example, the one or more oligonucleotides disclosed herein are between 50% to 99%, between 66% to 77%, between 75% to 99%, between 82% to 99%, between 86% to 95%, between 87% to 93%, or between 95% to 99.9% homologous in sequence to the nucleic acid sequence of miR-198 (SEQ ID NO: 1). In another example, the oligonucleotide has the nucleic acid sequence of miR-198 according to SEQ ID NO: 1, that is the oligonucleotide is 100% homologous to the nucleic acid sequence of miR-198.
(50) In another example, the one or more oligonucleotides disclosed in the present application comprise 5GGTCCAGAGG GGAGATAGGT TC 3 (SEQ ID NO: 1) or a functional part thereof. In another example, the one or more oligonucleotides comprise 5GTCCAGAG 3 (SEQ ID NO: 2).
(51) The term sequence identity, as used herein, refers to the situation where two polynucleotide or amino acid sequences are identical (i.e., on a nucleotide-by-nucleotide or residue-by-residue basis) over the comparison window. The term percentage of sequence identity is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I) or residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the comparison window (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. The terms substantial identity as used herein denotes a characteristic of a polynucleotide or amino acid sequence, wherein the polynucleotide or amino acid comprises a sequence that has at least 85 percent sequence identity, preferably at least 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison window of at least 18 nucleotide (6 amino acid) positions, frequently over a window of at least 24-48 nucleotide (8-16 amino acid) positions, wherein the percentage of sequence identity is calculated by comparing the reference sequence to the sequence which may include deletions or additions which total 20 percent or less of the reference sequence over the comparison window. The reference sequence may be a subset of a larger sequence.
(52) Thus, in one example, the one or more oligonucleotides disclosed herein have about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% sequence identity to the nucleic acid sequence of miR-198 (SEQ ID NO: 1). In another example, the one or more oligonucleotides disclosed herein have between 50% to 99%, between 66% to 77%, between 75% to 99%, between 82% to 99%, between 86% to 95%, between 87% to 93%, or between 95% to 99.9% sequence identity to the nucleic acid sequence of miR-198. In another example, the oligonucleotide has the nucleic acid sequence of miR-198 according to SEQ ID NO: 1, that is the oligonucleotide has 100% sequence identity to the nucleic acid sequence of miR-198.
(53) The present application identifies a dual-state molecular switch, in which a single transcript can make either an anti-migratory microRNA-198 (miR-198) or the pro-migratory follistatin-like-1 (FSTL1) protein. In normal, that is disease-free, skin, expression of exonic miR-198 switches from FSTL1 mRNA to the pro-migratory FSTL1 protein upon wounding, thereby enhancing temporal migration and orchestrating wound re-epithelialization.
(54) In the present application, a defect in the wound-healing switch is revealed, in which miR-198 expression is shut off in favour of sustained FSTL1 expression. This scenario is shown to be present in cancers, such as for example, head and neck squamous cell carcinomas (HNSCC). An epidermal growth factor (EGF)-driven micro-circuitry hijacks this molecular switch of miR-198 and FSTL1, and then steers the cells towards a two-pronged pathway of metastasis. In the absence of miR-198, persistent expression of its target, DIAPH1, enhances directional persistence of migration by sequestering Arpin, a competitive inhibitor of this migration process. The secreted glycoprotein FSTL1 interacts with Wnt7a and blocks Wnt7a mediated repression of ERK phosphorylation. This allows the phosphorylation of ERK, which in turn stimulates the expression of MMP9, leading to extracellular matrix degradation and the promotion of metastatic behaviour of carcinoma cells, and/or the formation of metastasis of carcinoma cells. This prognostic significance of this exemplary FSTL1-DIAPH1 gene pair in the absence of miR-198 highlights this gene pair as a potential target for therapeutic intervention.
(55) The miR-198/FSTL1 molecular switch had been previously shown to control the context-specific expression of two alternate gene products from a single transcript, thereby regulating wound re-epithelialization. miR-198 is an exonic miRNA and its precursor sequence is located within the 3-untranslated region of the protein coding follistatin-like-1 (FSTL1) gene. In normal skin, the transcript functions as a primary miRNA, which is processed into mature miR-198, which in turn functions as an inhibitor of keratinocyte migration. However, upon injury, the same transcript functions as a messenger RNA (mRNA) and results in the expression of the FSTL1 protein (follistatin-like-1 protein), which has a pro-migratory effect on cells. This switch from the expression of the anti-migratory miR-198 in normal skin to the pro-migratory FSTL1 expression upon wounding facilitates temporal migration of keratinocytes and wound re-epithelialization.
(56) The proliferation and migration of keratinocytes is essential for, for example, wound healing, but is also a hallmark of all epithelial carcinomas. This process is self-limiting in healing wounds and normally terminates when re-epithelialization is complete. In carcinomas, keratinocyte proliferation and migration is prolonged resulting in uncontrolled growth and metastasis. The parallels between wound healing and epithelial carcinoma in keratinocyte migration and proliferation prompted the investigation of the wound healing switch in the context of progressive head and neck squamous cell carcinomas (HNSCC). A defect was observed in this switch, which resulted in the down-regulation of anti-migratory miR-198, in favour of persistent expression of the pro-migratory FSTL1. In some cases, the expression of pro-migratory targets in head and neck squamous cell carcinomas (HNSCC) were analysed in the absence of miR-198. Persistent, increased expression of DIAPH1, a target of miR-198, together with FSTL1, is shown to enhance migration, invasion and metastasis of carcinoma cells.
(57) Thus, in one example, the target is a gene selected from a group consisting of follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) and Urokinase-type plasminogen activator (PLAU). In another example, the target is an RNA target. In yet another example, the RNA target is a gene selected from a group consisting of follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) and Urokinase-type plasminogen activator (PLAU).
(58) The secreted (glyco-) protein FSTL1 interacts with Wnt7a and antagonises Wnt7a-mediated repression of ERK phosphorylation in head and neck squamous cell carcinomas (HNSCC). This allows the phosphorylation of ERK, which in turn stimulates the expression of matrix metallopeptidase 9 (MMP9), a protein involved in the degradation of the extracellular matrix. Thus, the phosphorylation of MMP9 results in the activation of said MMP9 protein, thereby leading to extracellular matrix degradation and the promotion of metastatic behaviour of carcinoma cells.
(59) DIAPH1 enhances directional persistence of migration by sequestering Arpin, an inhibitor of this process. As a result, Arpin is hindered in its activity and cell migration continues, thereby supporting metastatic behaviour in cancer cells. In summary, the defective molecular switch exerts a double-pronged effect to enhance invasion and metastasis of head and neck squamous cell carcinomas (HNSCC), leading to the progression of the disease.
(60) Epithelial carcinomas activate underlying wound healing program of the host in a prolonged manner to facilitate malignant transformation. Here, a molecular switch was examined at the crossroads of wound healing and squamous cell carcinoma (SCC). This molecular switch controls context-specific expression of two alternate gene products from a single transcript. Investigation of cutaneous squamous cell carcinoma (SCC) samples revealed absence of exonic microRNA-198 (miR-198) however sustained expression of FSTL1 from the linked open reading frame was apparent. In the tumour microenvironment, persistent expression of pro-invasive miR-198 target genes and FSTL1-mediated expression of matrix metalloproteinases (MMP) promote squamous cell carcinoma (SCC) invasion. Expression of human antigen R (HuR) and the EGF-mediated expression of microRNA-181a, which down-regulates KH-type splicing regulatory protein (KSRP), enabled persistent expression of FSTL1. Together, EGF-signalling microcircuit facilitates acquisition of the regulatory switch by cancer cells; prevents processing of tumour suppressor miR-1983 and permits sustained expression of pro-oncogenic factor FSTL1, leading to the progression of SCC.
(61) A novel miR-198/FSTL1 regulatory switch was discovered that is hijacked in cutaneous squamous cell carcinoma (SCC), a common form of skin cancer. The absence of miR-198 and the concomitant, sustained expression of pro-migratory genes FSTL1, as well as miR-198 target genes DIAPH1, LAMC2 and PLAU have been observed in human squamous cancer cell (SCC) samples. It was further demonstrated that knockdown of FSTL1, DIAPH1, LAMC2 and PLAU inhibits keratinocyte invasion (via in vitro transwell and organotypic assays). Moreover, it was also demonstrated that FSTL1 mediates expression of pro-inflammatory genes, the expression of pro-inflammatory genes being a common observation in cancers. The miR-198/FSTL1 regulatory switch is essential for the regulation of keratinocyte migration and wound re-epithelialization in wound healing; pathways which are mis-regulated and overactive in the context of oncogenic transformation in SCC.
(62) To explore parallel molecular mechanisms involved in wound healing and squamous cell carcinomas (SCC), it was sought to investigate the role of a wound healing switch in cancers, for example, in epithelial cancers, such as head and neck squamous cell carcinoma (HNSCC) and cutaneous squamous cell carcinomas. As used herein, the terms carcinoma are used interchangeably and refer to a proliferative disease that originates or develops from epithelial cells.
(63) Thus, in one example, the disease disclosed herein is a cancer. In another example, the disease is carcinoma. In another example, the cancer is epithelial carcinoma. In yet another example, the carcinoma originates from cells that are, but are not limited to, cells from the upper aero-digestive tract, mainly in the nasal cavity, paranasal sinuses, nasopharynx, larynx, trachea, oropharynx and oral cavity. In another example, the cells are epithelial cells. In yet another example, the cells are cells of the mucosal lining. In one examples, the disease is, but is not limited to, squamous cell carcinomas (SCC), head and neck squamous cell carcinomas (HNSCC), cutaneous squamous cell carcinomas, basal cell carcinomas (BCC), basal cell neoplasms, melanomas, adenocarcinoma, adenosquamous cell carcinoma, transitional cell carcinoma, anaplastic carcinoma, large cell carcinoma, small cell carcinoma, cholangiocarcinoma, hepatocellular carcinoma, adenoid cystic carcinoma, renal cell carcinoma, Grawitz tumour, adnexal and Skin appendage neoplasms, mucoepidermoid neoplasms, cystic neoplasms, mucinous neoplasms, serous neoplasms, ductal neoplasms, lobular neoplasms, medullary neoplasms, acinar cell neoplasms, complex epithelial neoplasms, cholangiocarcinoma and carcinoma of unknown origins. In one example, the carcinoma is a squamous cell carcinoma (SCC). In another example, the carcinoma is cutaneous squamous cell carcinoma. In another example, the carcinoma is head and neck squamous cell carcinomas (HNSCC). As appreciated by a person skilled in the art, in the field of carcinomas, the location of a carcinoma is one of the defining traits in the characterisation of the carcinoma. For example, a carcinoma found in the thyroid is considered to be a thyroid carcinoma. Further characterisation is performed based on the morphology of the diseased cells, that is comparison of the shape of the diseased cells themselves and of the cells in a disease-free state. For example, a squamous cell thyroid carcinoma is a rare malignant neoplasm of the thyroid gland, which shows tumour cells with distinct squamous differentiation. Having said that, squamous cells are not usually found in the thyroid glands, but may be derived from the embryonic remnants such as thyroglossal duct or branchial clefts.
(64) The present invention also discloses methods for the diagnosis and treatment of epithelial carcinoma, such as squamous cell carcinoma (SCC) and head and neck squamous cell cancer (HNSCC). In one example, there is disclosed a method or use of miR-198 and/or a further biomarker in the diagnosis of epithelial carcinoma. In another example, there is disclosed a method or use of oligonucleotide mimics of miR-198, or miR-198 itself, in the treatment of epithelial carcinoma. In yet another example, there is disclosed a method or use of siRNAs against FSTL1, DIAPH1, LAMC2, PLAU or combinatorial siRNAs in the treatment of epithelial carcinoma. In one example, the epithelial carcinoma is squamous cell carcinoma (SCC). In another example, the epithelial cancer is cutaneous squamous cell carcinoma (SCC). In another example, the epithelial carcinoma is head and neck squamous cell carcinoma (SCC).
(65) The present disclosure also relates to the absence of miR-198 expression and/or the presence of FSTL1 expression as biomarkers for the diagnosis of a carcinoma. In one example, the carcinoma is cutaneous squamous cell carcinoma (SCC). In addition, miR-198 and its downstream targets, DIAPH1, LAMC2 and PLAU are also considered therapeutic targets for the treatment of carcinomas, for example cutaneous squamous cell carcinoma (SCC).
(66) It was shown that cutaneous squamous cell carcinoma (SCC) cells show a specific and robust expression of FSTL1 and concomitant low (negligible) levels of miR-198, compared to normal skin samples. It was also demonstrated that knockdown of FSTL1, as well as miR-198 target genes (DIAPH1, LAMC2 and PLAU), resulted in a reduction in the invasiveness of cutaneous squamous cell carcinoma (SCC) cell lines. This data points to the fact that a defective miR-198/FSTL1 switch is present in cutaneous squamous cell carcinoma (SCC) and that restoring normal function of this switch provided an innovative strategy for the treatment of SCC.
(67) miR-198/FSTL1 can be used effectively as a biomarker in the diagnosis of cutaneous squamous cell carcinoma (SCC), as it was demonstrated that miR-198 is highly expressed in normal skin epidermis and lowly expressed in all cutaneous squamous cell carcinoma (SCC) tissue sections assayed (n=73). Conversely, FSTL1 is present in high levels in cutaneous squamous cell carcinoma (SCC) tissue sections (n=73) and negligible levels in normal tissue.
(68) Cutaneous squamous cell carcinoma (SCC) is the second most common skin cancer and is a primary malignancy, characterized by significant cell atypia, abnormal keratinization and invasive features. Cutaneous squamous cell carcinoma (SCC) shares the features of basal cell carcinoma (BCC) and melanoma, being locally invasive with a capacity to metastasize. Malignant transformation is considered as a severe complication of non-healing ulcer wounds. Also, epithelial tumours promote formation of their stroma by activating an uncontrolled wound healing response. In an attempt to explore the common molecular mechanisms in re-epithelialization phase of wound healing and the parallels to cutaneous squamous cell carcinoma (SCC), the miR-198/FSTL1 regulatory switch, which controls context-specific expression of two alternate gene products and serves as an orchestrator of wound re-epithelialization, was analysed. At steady state, healthy epidermal keratinocytes express high levels of exonic miR-198, but no FSTL1 protein (
(69) Due to striking similarity in collective migration of squamous carcinoma cells and cell migration during wound healing, the expression of miR-198 target genes in cutaneous squamous cell carcinoma (SCC) was investigated. In the absence of anti-migratory miR-198, all the examined pro-migratory target genes, including urokinase-type plasminogen activator (PLAU), a serine protease degrading extracellular matrix 6, diaphanous homolog 1 (DIAPH1), involved in actin polymerization 7, laminin gamma 2 chain (LAMC2), an essential component of the basement membrane protein laminin 3328 and met proto-oncogene 9 (cMET), which encodes tyrosine-kinase activity, were clearly expressed in highly proliferating keratinocytes in cutaneous squamous cell carcinoma (SCC) (
(70) To confirm the role of miR-198 target genes in cutaneous squamous cell carcinoma (SCC) invasion, an organotypic model of cancer cell invasion was used, which closely mimics in vivo stromal invasion. SCC12 cells transduced with specific shRNA against LAMC2, PLAU and DIAPH1 were cultured on collagen:matrigel gels with incorporated fibroblasts. Substantial knockdown of target genes (
(71) To disseminate the role of pro-migratory glycoprotein FSTL1 expressed from the linked open reading frame of miR-198 primary transcript in SCC, SCC12 cells transfected with siRNA against FSTL1 or control siRNA were subjected to Boyden chamber trans-well assay (
(72) To understand the molecular mechanisms that lead to the failure of molecular switch in cutaneous squamous cell carcinoma (SCC), the expression of KSRP, which is essential for the processing of miR-198, was analysed. In comparison to the normal skin, low levels of KSRP were observed in cutaneous squamous cell carcinoma (SCC) samples (
(73) Prolonged and persistent expression of FSTL1 in cutaneous squamous cell carcinoma (SCC) prompted the examination of other factors, capable of enhancing the stability of FSTL1 transcripts. For example, Hu antigen R (HuR) is an mRNA-binding protein which binds to labile transcripts, including cyclo-oxygenase-2 (COX-2) associated with carcinogenesis in SCC. It was hypothesised that Hu antigen R (HuR) controls the stability of FSTL1 transcript based on the presence of consensus HuR binding motif (NNUUNNUUU-U rich element) in the precursor sequence of exonic miR-19817 (data not shown). Elevated expression of HuR was shown to be present in cutaneous squamous cell carcinoma (SCC) samples (
(74) Finally, an in vitro translation assay using capped, chimeric reporter transcript containing Luc upstream of the full-length FSTL1 3-UTR [Luc-FSTL1 3-UTR] was performed to confirm the role of HuR. The reporter was subjected to in vitro translation in rabbit reticulocyte lysate, in the presence of lysate from SCC12 cells transfected with control siRNA or siRNA against HuR or KSRP. Down-regulation of HuR, but not KSRP, clearly affected the translation of the reporter, thereby confirming the role of the HuR to confer stability to the transcript. As a control for target specificity, a cRNA encoding GFP was added to each reaction mixture. The expression of the GFP was shown to be constant under all conditions, indicating that the inhibitory activity was specific for the FSTL1 3-UTR-containing chimeric transcript (
(75) Wound healing is a self-limiting dynamic event where barrier disruption is transient and inflammation resolves with the completion of re-epithelialisation. Following wound repair keratinocytes revert to epithelial-like phenotype and re-differentiate to restore epidermal barrier, whereas carcinoma cells lose cell-cell contact, and transdifferentiate to acquire a mesenchymal-like phenotype with a gene expression profile that contributes to increased migration and invasion. Furthermore, perpetual perturbation of epidermal gene expression not only results in uncontrolled growth but also leads to chronic inflammation, linked to carcinogenesis. The miR-198/FSTL1 genetic switch is shown to tightly regulate gene expression in the wound microenvironment to facilitate effective wound healing.
(76) Upon cutaneous injury, transient down-regulation of anti-migratory miR-198 is essential to facilitate migration of keratinocytes towards the wound edge. However, in cutaneous squamous cell carcinoma (SCC), perpetual absence of miR-198 and sustained expression pro-migratory target genes enhance keratinocyte migration and invasion. Persistent expression of PLAU and LAMC2 by carcinoma cells leads to increased fibrinolysis and degradation of extracellular matrix components. Although basement membranes are protective and serve as a barrier for tumour growth, enhanced secretion of autocrine factors, including LAMC2 and Laminin 332, by basement membrane promotes tumourigenesis in cutaneous squamous cell carcinoma (SCC). Expression of an actin-binding protein DIAPH1 facilitates polarised cancer cell migration. By targeting regulators of mitogenic and motogenic pathways, miR-198 inhibits migration. Further suppressing the oncogene cMET, miR-198 also functions as a tumour suppressor. By targeting FUT8 and FGFR1, miR-198 further controls metastasis in colorectal cancer and induces apoptosis in lung cancer respectively, all emphasising the role of miR-198 as a tumour suppressor.
(77) Examining the role of FSTL1 at the intersection of wound healing and cancer; the protein is essential for keratinocyte migration and wound re-epithelialisation. However, in carcinoma cells sustained expression of FSTL1 contributed to oncogenic transformation through downstream regulators CSPG4 and MMP9. CSPG4 not only activated FAK and ERK1/2 to facilitate tumour invasion and growth, CSPG4 also activated proteolytic degradation of extracellular matrix by regulating the activity of MMP-2 and MMP-912. Additionally, FSTL1 is a secreted pro-inflammatory glycoprotein, which, when elevated in various inflammatory conditions, mediated inflammatory response and enhances the synthesis of pro-inflammatory cytokines and chemokines including, but not limited to, IL-6, TNF- and IL1-, by immune cells. Supporting this observation, FSTL1 knock-down in SCC12 cells lead to the down-regulation of pro-inflammatory genes including IL-27B, IL-10, TNFAIP2/3, CCL5 and IL-32 (
(78) The subtle but crucial boundaries between the role of FSTL1 in wound healing and its role in the pathology of cutaneous squamous cell carcinoma (SCC) indicated that FSTL1 expression is tightly regulated, allowing the protein to perform its physiological function while avoiding the serious consequences of sustained expression. The contrast between the essential role of FSTL1 in injury/wound healing and its contribution to oncogenic transformation in cutaneous squamous cell carcinoma (SCC) highlights the regulatory complexity of FSTL1. In summary, this highlights the importance of the regulatory switch which controls temporal and mutually exclusive expression of miR-198 and FSTL1. However, cancer cells exploit the regulatory switch by blocking the processing of the anti-migratory, tumour suppressor miR-198 to facilitate sustained production of the pro-migratory, pro-invasive and pro-inflammatory FSTL1. Events that occur in normal wound healing are not sufficient to trigger tumour formation; however, sustained aberrant expression of components in the wound microenvironment can trigger epidermal hyperproliferation, chronic inflammation and invasion, thus leading to carcinogenesis. Modulation of the components of the molecular switch can lead to design of better therapeutic options for cutaneous squamous cell carcinoma (SCC) with improved patient outcome.
(79) The term miRNA, as used herein, is understood as a single stranded non-coding RNA sequence which is capable of interacting with the 3-untranslated region of a mRNA thus preventing its translation. The terms microRNA or miRNA that may be used interchangeably herein, are endogenous RNAs, some of which are known to regulate the expression of protein-coding genes at the post-transcriptional level. As used herein, the term microRNA refers to any type of micro-interfering RNA, including but not limited to, endogenous microRNA and artificial microRNA. Typically, endogenous microRNAs are small RNAs encoded in the genome which are capable of modulating the productive utilisation of mRNA. A mature miRNA is a single-stranded RNA molecule of about 21-23 nucleotides in length which is complementary to a target sequence, and hybridises to the target RNA sequence to inhibit its translation. miRNAs themselves are encoded by genes that are transcribed from DNA but not translated into protein (non-coding RNA); instead they are processed from primary transcripts known as pri-miRNA to short stem-loop structures called pre-miRNA and finally to functional miRNA. Mature miRNA molecules are partially complementary to one or more messenger RNA (mRNA) molecules, and their main function is to down-regulate gene expression.
(80) Thus, as used herein, an inhibitor refers to any molecule which inactivates and/or down-regulates the expression of any one or more of the biomarkers or biomarkers disclosed herein. The inhibitor can be a small molecule, an antisense nucleic acid, a small interfering RNA or a microRNA-based compound. For example, the FSTL1 expression inhibitor may be a direct inhibitor such that it interacts with the FFSTL1 protein or with a nucleic acid encoding the FSTL1 protein. Alternatively, the inhibitor may be an indirect inhibitor which interacts upstream or downstream of, for example, the FSTL gene in the regulatory pathway and which does not interact with the FSTL protein or with a nucleic acid encoding the FSTL protein directly. In one example, the inhibitor may be peptide nucleic acid (PNA) derivatives of FSTL inhibitor sequence or Tiny locked nucleic acid (LNA) anti-miRs for seed-sequence of the inhibitor.
(81) The term peptide nucleic acid (PNA) as used herein refers to DNA mimics with a pseudo-peptide backbone.
(82) As used herein, the term locked nucleic acid (also known as LNA or inaccessible RNA) refers to a modified RNA nucleotide. The ribose moiety of an LNA nucleotide is modified with an extra bridge connecting the 2 oxygen and 4 carbon. The bridge locks the ribose in the 3-endo (North) conformation, which is the same confirmation often found in the A-form duplexes. The, usually synthetic, locked nucleic acid nucleotides can be mixed with DNA or RNA residues in the oligonucleotide, whenever desired, and hybridize with DNA or RNA according to Watson-Crick base-pairing rules. The locked ribose conformation enhances base stacking and backbone pre-organization. This significantly increases the hybridization properties (melting temperature) of oligonucleotides.
(83) The term tiny LNA anti-miRs as used herein refers inaccessible RNA, is a modified RNA nucleotide. In one example, transfection of tiny LNAs into cells resulted in simultaneous inhibition of RNAs within families sharing the same seed with concomitant upregulation of direct targets. In one example, transfection of tiny LNAs systemically showed long term RNA silencing.
(84) It was demonstrated, in transwell and organotypic assays, that the knockdown of FSTL1, as well as miR-198 target genes DIAPH1, LAMC2 and PLAU, resulted in dramatic loss of invasive properties in a cutaneous squamous cell carcinoma (SCC) cell line. Modulating levels of miR-198 via KSRP, which is essential for the processing of miR-198, resulted in the inverse modulation of FSTL1. This data indicated that enhancing the levels of miR-198, for example through the application of oligonucleotide mimics, which can be readily manufactured for, for example, topical application, can be used in the treatment of cutaneous squamous cell carcinoma (SCC).
(85) The compositions as described herein may be administered in a number of ways depending upon whether local or systemic treatment is desired and upon the area to be treated. Administration may be topical, pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebuliser; intratracheal, intranasal, epidermal and transdermal) or systemic such as oral, and/or parenteral. In one example, the compositions as described herein may be administered via systemic or topical administration. In another example, the compounds disclosed herein are administered according to any one of the following methods: orally, intraadiposally, intraarterially, intraarticularly, intracranially, intradermally, intralesionally, intramuscularly, intranasally, intraocularally, intrapericardially, intraperitoneally, intrapleurally, intraprostatically, intrarectally, intrathecally, intratracheally, intratumorally, intraumbilically, intravenously, intravesicularlly, intravitreally, liposomally, locally, mucosally, orally, enterally, parenterally, rectally, subconjunctival, subcutaneously, sublingually, topically, transbuccally, transdermally, vaginally, in crmes, in lipid compositions, via a catheter, via a lavage, via continuous infusion, via infusion, via inhalation, via injection, via local delivery, via localized perfusion or any combination thereof.
(86) Parenteral administration includes intravenous, intraarterial, subcutaneous, intraperitoneal or intramuscular injection or infusion; or intracranial, e.g., intrathecal or intraventricular, administration.
(87) In one example, the administration is via topical administration. Compositions and formulations for topical administration may include transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders. Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable.
(88) In one example, the composition for topical administration comprises the composition as described herein and a dermatologically acceptable vehicle. The vehicle may be aqueous or non-aqueous. The dermatologically acceptable vehicle used in the topical composition may be in the form of a lotion, a gel, an ointment, a liquid, a cream, or an emulsion. If the vehicle is an emulsion, the emulsion may have a continuous aqueous phase and a discontinuous non-aqueous or oil phase (oil-in-water emulsion), or a continuous non-aqueous or oil phase and a discontinuous aqueous phase (water-in-oil emulsion).
(89) In one example, the composition as described herein may be topically administered using a transdermal patch. In one example, the transdermal patch comprises an adhesive layer for attachment to the patch to the skin, and a drug-impermeable backing layer. In one example, the adhesive layer contains the composition as described herein in combination with an adhesive polymer. In this type of system, the composition as described herein is released from the adhesive layer and passes directly to the skin.
(90) In one example, the transdermal system has a reservoir layer containing the composition as described herein. The drug reservoir layer is a liquid, gel, or semisolid compartment containing a drug solution or suspension, where the reservoir layer is positioned in between the adhesive layer and the backing layer. In this type of system, the composition as described herein is released from the reservoir layer and passes through the adhesive layer.
(91) The pharmaceutical excipients used in the topical preparation of the present disclosure may be selected from the group consisting of solvents, emollients and/or emulsifiers, oil bases, preservatives, antioxidants, tonicity adjusters, penetration enhancers and solubilizers, chelating agents, buffering agents, surfactants, one or more polymers, and combinations thereof.
(92) Suitable solvents for an aqueous or hydrophilic topical formulation include, but are not limited to, water; ethyl alcohol; isopropyl alcohol; mixtures of water and ethyl and/or isopropyl alcohols; glycerine; ethylene, propylene or butylene glycols; DMSO; and mixtures thereof. Suitable solvents for a hydrophobic topical formulation include, but are not limited to, mineral oils, vegetable oils, and silicone oils. If desired, the composition as described herein can be dissolved or dispersed in a hydrophobic oil phase, and the oil phase can then be emulsified in an aqueous phase comprising water, alone or in combination with lower alcohols, glycerine, and/or glycols.
(93) Suitable emollients include, but are not limited to, hydrocarbon oils and waxes such as mineral oil, petrolatum, paraffin, ceresin, ozokerite, microcrystalline wax, polyethylene, squalene, perhydrosqualene, silicone oils, triglyceride esters, acetoglyceride esters, such as acetylated monoglycerides; ethoxylated glycerides, such as ethoxylated glyceryl monostearate; alkyl esters of fatty acids or dicarboxylic acids.
(94) Suitable silicone oils for use as emollients include, but are not limited to, dimethyl polysiloxanes, methyl(phenyl) polysiloxanes, and water-soluble and alcohol-soluble silicone glycol copolymers. Suitable triglyceride esters for use as emollients include, but are not limited to, vegetable and animal fats and oils including castor oil, safflower oil, cotton seed oil, corn oil, olive oil, cod liver oil, almond oil, avocado oil, palm oil, sesame oil, soybean oil and combinations thereof.
(95) Suitable esters of carboxylic acids or diacids for use as emollients include, but are not limited to, methyl, isopropyl, and butyl esters of fatty acids. Specific examples of alkyl esters including hexyl laurate, isohexyl laurate, iso-hexyl palmitate, isopropyl palmitate, decyl oleate, isodecyl oleate, hexadecyl stearate, decyl stearate, isopropyl isostearate, dilauryl lactate, myristyl lactate, and cetyl lactate; and alkenyl esters of fatty acids such as oleyl myristate, oleyl stearate, and oleyl oleate. Specific examples of alkyl esters of diacids include diisopropyl adipate, diisohexyl adipate, bis(hexyldecyl) adipate, diisopropyl sebacate and combinations thereof.
(96) Other suitable classes of emollients or emulsifiers which may be used in the topical formulations include, but are not limited to, fatty acids, fatty alcohols, fatty alcohol ethers, ethoxylated fatty alcohols, fatty acid esters of ethoxylated fatty alcohols, waxes and combinations thereof.
(97) Specific examples of fatty acids for use as emollients include, but are not limited to pelargonic, lauric, myristic, palmitic, stearic, isostearic, hydroxystearic, oleic, linoleic, ricinoleic, arachidic, behenic, and erucic acids. Specific examples of fatty alcohols for use as emollients include lauryl, myristyl, cetyl, hexadecyl, stearyl, isostearyl, hydroxystearyl, oleyl, ricinoleyl, behenyl, erucyl alcohols, as well as 2-octyl dodecanol and combinations thereof.
(98) Specific examples of waxes suitable for use as emollients include, but are not limited to, lanolin and derivatives thereof, including lanolin oil, lanolin wax, lanolin alcohols, lanolin fatty acids, isopropyl lanolate, ethoxylated lanolin, ethoxylated lanolin alcohols, ethoxolated cholesterol, propoxylated lanolin alcohols, acetylated lanolin, acetylated lanolin alcohols, lanolin alcohols linoleate, lanolin alcohols recinoleate, acetate of lanolin alcohols recinoleate, acetate of lanolin alcohols recinoleate, acetate of ethoxylated alcohols esters, hydrogenolysates of lanolin, hydrogenated lanolin, ethoxylated hydrogenated lanolin, ethoxylated sorbitol lanolin, and liquid and semisolid lanolin. Also usable as waxes include hydrocarbon waxes, ester waxes, and amide waxes. Useful waxes include wax esters such as beeswax, spermaceti, myristyl myristate and stearyl stearate; beeswax derivatives, e.g., polyoxyethylene sorbitol beeswax; and vegetable waxes including carnauba and candelilla waxes; and combinations thereof.
(99) Polyhydric alcohols and polyether derivatives can be used as solvents and/or surfactants in the topical formulations. Suitable polyhydric alcohols and polyethers include, bur are not limited to, propylene glycol, dipropylene glycol, polypropylene glycols 2000 and 4000, poly(oxyethylene-co-oxypropylene) glycols, glycerol, sorbitol, ethoxylated sorbitol, hydroxypropylsorbitol, polyethylene glycols 200-6000, methoxy polyethylene glycols 350, 550, 750, 2000 and 5000, poly[ethylene oxide] homopolymers (100,000-5,000,000), polyalkylene glycols and derivatives, hexylene glycol, 2-methyl-2,4-pentanediol, 1,3-butylene glycol, 1,2,6-hexanetriol, 2-ethyl-1,3-hexanediol, vicinal glycols having 15 to 18 carbon atoms, polyoxypropylene derivatives of trimethylolpropane, and combinations thereof.
(100) Polydydric alcohol esters can be used as emulsifiers or emollients. Suitable polydydric alcohol esters include, but are not limited to, ethylene glycol mono- and di-fatty acid esters, diethylene glycol mono- and di-fatty acid esters, polyethylene glycol (200-6000) mono- and di-fatty acid esters, propylene glycol mono- and di-fatty esters, polypropylene glycol 2000 monooleate, polypropylene glycol 2000 monostearate, ethoxylated propylene glycol monostearate, glyceryl mono- and di-fatty acid esters, polyglycerol poly-fatty acid esters, ethoxylated glyceryl monostearate, 1,3-butylene glycol monostearate, 1,3-butylene glycol distearate, polyoxyethylene polyol fatty acid ester, sorbitan fatty acid esters, polyoxyethylene sorbitan fatty acid esters and combinations thereof.
(101) Suitable emulsifiers for use in topical formulations include anionic, cationic, non-ionic, and zwitterionic surfactants. Suitable ionic emulsifiers include phospholipids, such as lecithin and derivatives.
(102) Lecithin and other phospholipids can be used to prepare liposomes containing the composition as described herein. Formation of lipid vesicles occurs when phospholipids such as lecithin are placed in water and consequently form one bilayer or a series of bilayers, each separated by water molecules, once enough energy is supplied. Liposomes can be created by sonicating phospholipids in water. Low shear rates create multi-lamellar liposomes. Continued high-shear sonication tends to form smaller uni-lamellar liposomes. Hydrophobic chemicals can be dissolved into the phospholipid bilayer membrane. The lipid bilayers of the liposomes deliver the composition as described herein to keratinocytes by fusing with the cell membrane of the keratinocytes.
(103) In one example, the topical formulation may contain micelles, or an aggregate of surfactant molecules dispersed in an aqueous solution. Micelles may be prepared by dispersing an oil solvent in an aqueous solution comprising a surfactant, where the surfactant concentration exceeds the critical micelle concentration. The resulting formulation contains micelles, i.e., spherical oil droplets surrounded by a membrane of polar surfactant molecules, dispersed in the aqueous solvent.
(104) Sterols including, for example, but are not limited to, cholesterol and cholesterol fatty acid esters; amides such as fatty acid amides, ethoxylated fatty acid amides, and fatty acid alkanolamides can also be used as emollients and/or penetration enhancers.
(105) Suitable viscosity enhancers or thickeners which can be used to prepare a viscous gel or cream with an aqueous base include, but are not limited to, sodium polyacrylate, xanthan gum, polyvinyl pyrollidone, acrylic acid polymer, carrageenans, hydroxyethyl cellulose, hydroxypropyl cellulose, methyl cellulose, ethyl cellulose, propyl cellulose, hydroxypropyl methyl cellulose, polyethoxylated polyacrylamides, polyethoxylated acrylates, polyethoxylated alkane thiols and combinations thereof.
(106) Suitable preservatives and/or antioxidants for use in topical formulations include, but are not limited to, benzalkonium chloride, benzyl alcohol, phenol, urea, parabens, butylated hydroxytoluene (BHT), butylated hydroxyanisole (BHA), Tocopherol, and mixtures thereof.
(107) Suitable chelating agents for use in topical formulations include, but are not limited to, ethylene diamine tetraacetic acid (EDTA), alkali metal salts thereof, alkaline earth metal salts thereof, ammonium salts thereof, and tetraalkyl ammonium salts thereof.
(108) The carrier preferably has a pH of between about 4.0 and 10.0, more preferably between about 6.8 and about 7.8. The pH may be controlled using buffer solutions or other pH modifying agents. Suitable pH modifying agents include phosphoric acid and/or phosphate salts, citric acid and/or citrate salts, hydroxide salts (i.e., calcium hydroxide, sodium hydroxide, potassium hydroxide) and amines, such as triethanolamine. Suitable buffer solutions include a buffer comprising a solution of monopotassium phosphate and dipotassium phosphate, maintaining a pH of between 5.8 and 8; and a buffer comprising a solution of monosodium phosphate and disodium phosphate, maintaining a pH of between 6 and 7.5. Other buffers include citric acid/sodium citrate, and dibasic sodium phosphate/citric acid.
(109) The various examples of creams, ointments, lotions, solutions, gels, sprays and patches may incorporate the composition as described herein as the active ingredient, in combination with penetration enhancing agents and other active agents acting synergistically on the skin for the promotion of wound healing or wound closure or the treatment of chronic cutaneous wound.
(110) In one example, of the topical formulation can includes at least one or more oligonucleotides and/or at least one or more RNA molecules in a concentration of from about 0.005% by weight to about 50% by weight. Formulations containing at least one or more oligonucleotides and/or at least one or more RNA molecules in an aqueous carrier can typically contain from about 0.005% by weight to about 0.5% by weight of the at least one or more oligonucleotides and/or at least one or more RNA molecules, preferably about 0.01% by weight to about 0.1% by weight, more preferably about 0.01% by weight to about 0.05% by weight. Formulations containing at least one or more oligonucleotides and/or at least one or more RNA molecules in an oil or wax carrier can typically contain from about 0.005% to about 50% by weight of at least one or more oligonucleotides and/or at least one or more RNA molecules, preferably about 0.01% by weight to about 25% by weight, more preferably about 0.1% by weight to about 10% by weight, most preferably from about 0.1% by weight to about 5% by weight. Creams, lotions, or other emulsions containing an oil phase and an aqueous phase typically contain at least one or more oligonucleotides and/or at least one or more RNA molecules in an amount of from about 0.005% to about 25% by weight, preferably about 0.005% to about 10% by weight, more preferably about 0.01% to about 5% by weight. The creams, lotions, or other emulsions may be prepared as water-in-oil or oil-in-water emulsions; in either case, the hydrophobic compound containing at least one or more oligonucleotides and/or at least one or more RNA molecules is dissolved or dispersed in the oil phase.
(111) A suitable formulation comprises at least one or more oligonucleotides and/or at least one or more RNA molecules in a concentration of from about 0.1 to about 0.3 mg/mL (0.01% to 0.03%), and the preservative benzalkonium chloride in a concentration of from about 0.05 to about 0.2 mg/ml. The formulation is provided in a vehicle comprising water having a pH of between about 6.8 and about 7.8 as a solvent. The formulation can further comprise sodium chloride, a dibasic sodium phosphate/citric acid buffer, and optionally sodium hydroxide and/or hydrochloric acid to adjust the pH.
(112) The topical formulation can be provided to a subject having, for example, a carcinoma found on the surface of the subject, in a bottle designed to administer the formulation in a drop-wise fashion. The subject can then administer the topical formulation at regular intervals to affected tissue, for example, in an amount of from 1 drop per 5 square centimetres of affected skin to 5 drops per square centimetre of affected skin, preferably 1 drop (where 1 drop is about 0.02 mL to about 0.05 mL, more preferably about 0.03 mL) per 5 square centimetres of affected skin to 1 drop per square centimetre of affected skin, more preferably 1 drop per 2 square centimetres of affected skin. In various embodiments, topical formulations can be administered at intervals ranging from four times per day to once per week, preferably two times per day to twice a week, more preferably two times per day to once a day. Frequency of administration can be adjusted depending on concentration of in the topical formulation, i.e., a topical formulation having a high concentration of the composition as described herein can be administered less frequently than a similar formulation having a lower concentration.
(113) Compositions and formulations for oral administration can include powders or granules, suspensions or solutions in water or non-aqueous media, capsules, sachets or tablets. Thickeners, flavouring agents, diluents, emulsifiers, dispersing aids or binders may be desirable.
(114) Compositions and formulations for parenteral, intrathecal or intraventricular administration can include sterile aqueous solutions that can also contain buffers, diluents and other suitable additives such as, but not limited to, penetration enhancers, carrier compounds and other pharmaceutically acceptable carriers or excipients. Thus, in one example, the one or more oligonucleotides and/or the one or more RNA molecules further comprise a compound selected from a group consisting of a pharmaceutically acceptable carrier, a liposomal carrier, an excipient, an adjuvant or combinations thereof.
(115) Compositions as described herein include, but are not limited to, solutions, emulsions, and liposome-containing formulations. These compositions can be generated from a variety of components that include, but are not limited to, preformed liquids, self-emulsifying solids and self-emulsifying semisolids.
(116) The formulations as described herein, which may conveniently be presented in unit dosage form, can be prepared according to conventional techniques well known in the pharmaceutical industry. Such techniques include the step of bringing into association the active ingredients with the pharmaceutical carrier(s) or excipient(s). In general the formulations are prepared by uniformly and intimately bringing into association the active ingredients with liquid carriers or finely divided solid carriers or both, and then, if necessary, shaping the product.
(117) The compositions as described herein can be formulated into any of many possible dosage forms such as, but not limited to, tablets, capsules, liquid syrups, soft gels, suppositories, and enemas. The compositions as described herein can also be formulated as suspensions in aqueous, non-aqueous or mixed media. Aqueous suspensions can further contain substances that increase the viscosity of the suspension including, for example, sodium carboxymethylcellulose, sorbitol and/or dextran. The suspension can also contain stabilisers.
(118) Thus, in one example, the one or more oligonucleotides and/or the one or more RNA molecules is/are provided as tablets, caplets, capsules, hard capsules, soft capsules, soft elastic gelatine capsules, hard gelatine capsules, cachets, troches, lozenges, dispersions, suppositories, ointments, cataplasms, poultices, pastes, powders, dressings, creams, plasters, solutions, patches, aerosols, nasal sprays, inhalers, gels, suspensions, aqueous liquid suspensions, non-aqueous liquid suspensions, oil-in-water emulsions, a water-in-oil liquid emulsions, solutions, sterile solids, crystalline solids, amorphous solids, solids for reconstitution or combinations thereof.
(119) In one example, the pharmaceutical compositions can be formulated and used as foams. Pharmaceutical foams include formulations such as, but not limited to, emulsions, micro-emulsions, creams, jellies and liposomes. While basically similar in nature these formulations vary in the components and the consistency of the final product.
(120) Thus, in one example, there is disclosed a pharmaceutical composition comprising at least one or more oligonucleotides and/or at least one or more RNA molecules, wherein the one or more oligonucleotides is homologous in sequence to the nucleic acid sequence of miR-198 (SEQ ID NO: 1) or a functional part thereof; and/or wherein the one or more RNA molecules reduce the level of and/or inhibiting gene expression of a RNA target; wherein the RNA target is a gene selected from a group consisting of follistatin-related protein 1 (FSTL1), Protein diaphanous homolog 1 (DIAPH1), Laminin subunit gamma-2 (LAMC2) and urokinase-type plasminogen activator (PLAU). In another example, the one or more RNA molecules comprised in the pharmaceutical composition is/are shRNA directed against FSTL1 or a combination of shRNAs. In another example, the siRNA sequence is selected from the group consisting of SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 10 and combinations thereof.
(121) The compositions as described herein can additionally contain other adjunct components conventionally found in pharmaceutical compositions. Thus, for example, the compositions can contain additional, compatible, pharmaceutically active materials such as, for example, antipruritics, astringents, local anaesthetics or anti-inflammatory agents, or may contain additional materials useful in physically formulating various dosage forms of the compositions of the present invention, such as dyes, flavouring agents, preservatives, antioxidants, opacifiers, thickening agents and stabilisers. However, such materials, when added, should not unduly interfere with the biological activities of the components of the compositions of the present invention. The formulations can be sterilised and, if desired, mixed with auxiliary agents, e.g., lubricants, preservatives, stabilisers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, colourings, flavourings and/or aromatic substances and the like which do not deleteriously interact with the nucleic acid(s) of the formulation.
(122) The term therapeutically effective amount as used herein includes within its meaning a sufficient but non-toxic amount of the at least one or more oligonucleotides and/or at least one or more RNA molecules to provide the desired therapeutic effect. The exact amount required will vary from subject to subject depending on factors such as the species being treated, the age and general condition of the subject, the severity of the condition being treated, the particular agent being administered, the mode of administration, bioavailability of the active compound and so forth. Thus, it is not possible to specify an exact effective amount. However, for any given case, an appropriate effective amount can be determined by one of ordinary skill in the art using routine experimentation.
(123) Dosing is dependent on severity and responsiveness of the disease to be treated, with the course of treatment lasting from several days to several months, or until a cure is effected, or a diminution of the disease is achieved. Optimal dosing schedules can be calculated from measurements of drug accumulation in the body of the subject. The person skilled in the art can easily determine optimum dosages, dosing methodologies and repetition rates. Optimum dosages can vary depending on the relative potency of the composition, and can generally be estimated based on EC.sub.50 values found to be effective in in vitro and in vivo animal models or based on the examples described herein. In general, dosage is from 0.01 g to 100 g/kg of body weight, and can be given once or more daily, weekly, monthly or yearly. Thus, in one example, wherein the oligonucleotide and/or the RNA molecule are administered daily, weekly, twice a week, three times a week, every two weeks and/or monthly.
(124) The person skilled in the art can estimate repetition rates for dosing based on measured residence times and concentrations of the drug in bodily fluids or tissues. Following successful treatment, it can be desirable to have the subject undergo maintenance therapy to prevent the recurrence of the disease, wherein the composition is to be administered in maintenance doses, for example, ranging from 0.01 g to 100 g/kg of body weight, once or more daily, to once every 2 years.
(125) In one example, the composition comprising at least one or more oligonucleotides and/or at least one or more RNA molecules, as described, herein can be administered in an concentration or amount of between any one of about 0.01 g, 0.05 g, 0.1 g, 0.5 g, 1 g, 5 g, 10 g, 20 g, 30 g, 40 g, 50 g, 60 g, 70 g, 80 g, 90 g, 100 g, 110 g, 120 g, 130 g, 140 g, 150 g, 160 g, 170 g, 180 g, 190 g, 200 g, 210 g, 220 g, 230 g, 240 g, 250 g, 260 g, 270 g, 280 g, 290 g, 500 g, 1 mg, 1.5 mg, 2 mg, 2.5 mg, 3 mg, 3.5 mg, 4 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 75 mg, 100 mg, 125 mg, 150 mg, 175 mg, 200 mg, 225 mg, 250 mg to any one of about 0.01 g, 0.05 g, 0.1 g, 0.5 g, 1 g, 5 g, 10 g, 20 g, 30 g, 40 g, 50 g, 60 g, 70 g, 80 g, 90 g, 100 g, 110 g, 120 g, 130 g, 140 g, 150 g, 160 g, 170 g, 180 g, 190 g, 200 g, 210 g, 220 g, 230 g, 240 g, 250 g, 260 g, 270 g, 280 g, 290 g, 500 g, 1 mg, 1.5 mg, 2 mg, 2.5 mg, 3 mg, 3.5 mg, 4 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 75 mg, 100 mg, 125 mg, 150 mg, 175 mg, 200 mg, 225 mg, 250 mg, or 300 mg It is understood that the values provided here refer to values per kilogram body weight of the subject to be treated.
(126) In one example, the at least one or more oligonucleotides and/or the at least one or more RNA molecules can be administered independently or as a combination of each other. In one example, the oligonucleotide and the RNA molecule are to be administered independently of each other in an amount of between any one of about 0.01 g, 0.05 g, 0.1 g, 0.5 g, 1 g, 5 g, 10 g, 20 g, 30 g, 40 g, 50 g, 60 g, 70 g, 80 g, 90 g, 100 g, 110 g, 120 g, 130 g, 140 g, 150 g, 160 g, 170 g, 180 g, 190 g, 200 g, 210 g, 220 g, 230 g, 240 g, 250 g, 260 g, 270 g, 280 g, 290 g, 500 g, 1 mg, 1.5 mg, 2 mg, 2.5 mg, 3 mg, 3.5 mg, 4 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 75 mg, 100 mg, 125 mg, 150 mg, 175 mg, 200 mg, 225 mg, 250 mg to any one of about 0.01 g, 0.05 g, 0.1 g, 0.5 g, 1 g, 5 g, 10 g, 20 g, 30 g, 40 g, 50 g, 60 g, 70 g, 80 g, 90 g, 100 g, 110 g, 120 g, 130 g, 140 g, 150 g, 160 g, 170 g, 180 g, 190 g, 200 g, 210 g, 220 g, 230 g, 240 g, 250 g, 260 g, 270 g, 280 g, 290 g, 500 g, 1 mg, 1.5 mg, 2 mg, 2.5 mg, 3 mg, 3.5 mg, 4 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 75 mg, 100 mg, 125 mg, 150 mg, 175 mg, 200 mg, 225 mg, 250 mg, or 300 mg. It is understood that the values provided here refer to values per kilogram body weight of the subject to be treated. In one example, the at least one or more oligonucleotides and the at least one or more RNA molecules are to be administered independently of each other in an amount of between about 10 g/kg to 300 mg/kg body weight.
(127) In one example, the at least one or more oligonucleotides and/or the at least one or more RNA molecules can be administered, independently of each other, in an amount of between any one of about 0.01 g, 0.05 g, 0.1 g, 0.5 g, 1 g, 5 g, 10 g, 20 g, 30 g, 40 g, 50 g, 60 g, 70 g, 80 g, 90 g, 100 g, 110 g, 120 g, 130 g, 140 g, 150 g, 160 g, 170 g, 180 g, 190 g, 200 g, 210 g, 220 g, 230 g, 240 g, 250 g, 260 g, 270 g, 280 g, 290 g, 500 g, 1 mg, 1.5 mg, 2 mg, 2.5 mg, 3 mg, 3.5 mg, 4 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 75 mg, 100 mg, 125 mg, 150 mg, 175 mg, 200 mg, 225 mg, 250 mg to any one of about 0.01 g, 0.05 g, 0.1 g, 0.5 g, 1 g, 5 g, 10 g, 20 g, 30 g, 40 g, 50 g, 60 g, 70 g, 80 g, 90 g, 100 g, 110 g, 120 g, 130 g, 140 g, 150 g, 160 g, 170 g, 180 g, 190 g, 200 g, 210 g, 220 g, 230 g, 240 g, 250 g, 260 g, 270 g, 280 g, 290 g, 500 g, 1 mg, 1.5 mg, 2 mg, 2.5 mg, 3 mg, 3.5 mg, 4 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 75 mg, 100 mg, 125 mg, 150 mg, 175 mg, 200 mg, 225 mg, 250 mg, or 300 mg. It is understood that the values provided here refer to values per kilogram body weight of the subject to be treated.
(128) In another example, the at least one or more oligonucleotides and/or the at least one or more RNA molecules are administered at a concentration of between 0.1 mg/kg and 10 mg/kg, between 0.1 mg/kg and 5 mg/kg, between 1 mg/kg to 2.5 mg/kg, between 2.5 mg/kg to 5 mg/kg, between 5 mg/kg and 10 mg/kg, between 5 mg/kg and 7.5 mg/kg, between 7.5 mg/kg and 10 mg/kg, at least 1 mg/kg, at least 1.5 mg/kg, at least 1.8 mg/kg, at least 2 mg/kg, at least 2.5 mg/kg, at least 2.8 mg/kg, at least 3 mg/kg, at least 3.2 mg/kg, at least 3.5 mg/kg, at least 4 mg/kg, at least 4.5 mg/kg, at least 5 mg/kg, at least 5.5 mg/kg, at least 6 mg/kg, at least 6.5 mg/kg, at least 7 mg/kg, at least 7.5 mg/kg, at least 8 mg/kg, at least 8.5 mg/kg, at least 9 mg/kg, at least 9.5 mg/kg or at least 10 mg/kg body weight.
(129) As used herein, the term about, in the context of amounts or concentrations of components of the formulations, typically means +/5% of the stated value, more typically +/4% of the stated value, more typically +/3% of the stated value, more typically, +/2% of the stated value, even more typically +/1% of the stated value, and even more typically +/0.5% of the stated value.
(130) In one example, the oligonucleotide and/or the RNA molecule as disclosed herein can be administered either simultaneously or sequentially from each other.
(131) Kits, as disclosed and encompassed herein, can further incorporate a detectable label, such as a fluorophore, radioactive moiety, enzyme, biotin/avidin label, chromophore, chemiluminescent label, or the like, or the kits may include reagents for labelling the nucleic acid primers, the nucleic acid probes or the nucleic acid primers and nucleic acid probes for detecting the presence or absence of at least one mutation as described herein. The primers and/or probes, calibrators and/or controls can be provided in separate containers or pre-dispensed into an appropriate assay format, for example, into micro-titre plates.
(132) The kits can optionally include other reagents required to conduct a diagnostic assay or facilitate quality control evaluations, such as buffers, salts, enzymes, enzyme co-factors, substrates, detection reagents, and the like. Other components, such as buffers and solutions for the isolation and/or treatment of a test sample (e.g., pre-treatment reagents), may also be included in the kit. The kit may additionally include one or more other controls. One or more of the components of the kit may be lyophilized and the kit may further comprise reagents suitable for the reconstitution of the lyophilized components.
(133) The various components of the kit optionally are provided in suitable containers. As indicated above, one or more of the containers may be a microtiter plate. The kit further can include containers for holding or storing a sample (e.g., a container or cartridge for a blood or urine sample). Where appropriate, the kit may also optionally contain reaction vessels, mixing vessels and other components that facilitate the preparation of reagents or the test sample. The kit may also include one or more instruments for assisting with obtaining a test sample, such as a syringe, pipette, forceps, measured spoon, or the like.
(134) The invention illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms comprising, including, containing, etc. shall be read expansively and without limitation. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognised that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention.
(135) The invention has been described broadly and generically herein. Each of the narrower species and sub-generic groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
(136) Throughout this disclosure, certain embodiments may be disclosed in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the disclosed ranges. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed sub-ranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
(137) Other embodiments are within the following claims and non-limiting examples. In addition, where features or aspects of the invention are described in terms of Markush groups, those skilled in the art will recognise that the invention is also thereby described in terms of any individual member or subgroup of members of the Markush group.
EXPERIMENTAL SECTION
(138) A Defective Molecular Switch in SCC
(139) Previously a miR-198/FSTL1 molecular switch had been described, which controls expression of two alternate gene products from a single transcript (
(140) MicroRNA-198 belongs to a small cohort of miRNAs that require KH-type splicing regulatory protein (KSRP) for processing. The absence of miR-198 prompted us to examine the expression of KSRP in SCC. Immunohistochemistry on SCC tissue sections revealed significant down-regulation of KSRP expression compared to normal skin (
(141) EGF-Driven Micro-Circuitry Hijacks the Molecular Switch
(142) TGF--mediated upregulation of oncogenic miR-181a expression is known to promote breast cancer metastasis and induce epithelial-mesenchymal transition (EMT) in hepatocellular carcinoma. Despite aberrant overexpression of miR-181a in CSCC and HNSCC, extremely low levels of TGF- (
(143) FSTL1 and DIAPH1 Enhance Migration and Invasion of SCC Cells
(144) It was then sought to investigate the expression of pro-migratory targets of miR-198 in SCC. Diaphanous homolog 1 (DIAPH1) which is a crucial player in actin polymerization and directed cell migrationis a direct target of miR-198. Immunohistochemistry on CSCC and HNSCC tissue sections using anti-DIAPH1 antibody showed high expression of DIAPH1 (
(145) To investigate the specific role of FSTL1 and DIAPH1, control SCC12 cells, siFSTL1 or siDIAPH1 cells were subjected to Boyden chamber trans-well assay, after evaluation of knockdown efficiency (
(146) FSTL1 and DIAPH1 Promote Metastatic Colonization
(147) It was then sought to determine the role of FSTL1 and DIAPH1 in metastatic progression of carcinoma. Genetically modified, luciferase expressing, HNSCC cell line (A253 cell line) were transduced with lentivirus encoding shFSTL1 or shDIAPH1 individually or in combination. Cells were implanted in immunodeficient NSG mice by lateral tail vein injections and evaluated for metastatic colonization. Silencing of FSTL1 or DIAPH1 independently decreased lung colonization significantly compared to the control cells (
(148) Prognostic Significance of the Synergistic Gene-Pair FSTL1-DIAPH1
(149) The data from 262 HNSCC patients in the TCGA database was interrogated, generating conventional Kaplan-Meier survival curves to compare their overall survival. Here, a 2-dimensional data-driven grouping (2D-DDg) method that can identify expression cut-offs on a two-dimensional axis was used to stratify the patient cohort into significant survival subgroups. The patients were classified into four segments based on a 2D-DDg method (
(150) Mechanistically DIAPH1 and FSTL1 Promote Metastasis by Sequestering ARPIN and Wnt7a Respectively
(151) To understand the mechanism by which DIAPH1 enhances metastasis, BioID (Proximity-dependent biotin identification) analysis was performed to identify candidate proteins that interact with DIAPH1 (
(152) To understand the role of Wnt7a in SCC, A253 cells transduced with control or shFSTL1 RNA, were subjected to transfection with specific siRNA against Wnt7a (
(153) EGF-Driven Micro-Circuitry Hijacks the Wound Healing Switch
(154) In normal skin, expression of anti-migratory miR-198 from the 3-UTR of FSTL1 switches to the expression of pro-migratory FSTL1 protein upon wounding to facilitate keratinocyte migration and wound re-epithelialisation. The miR-198/FSTL1 wound healing switch controls expression of two alternate gene products from a single transcript (
(155) However, immunohistochemistry with anti-FSTL1 antibodies on HNSCC tissue sections revealed sustained expression of FSTL1 protein in HNSCC (
(156) The wound healing switch is regulated by TGF-, which turns off miR-198 and switches on FSTL1 expression upon injury. However, low levels of TGF- (
(157) Next, to investigate, the mechanism by which EGF down-regulates KSRP, the expression of miR-181a was analysed. The KSRP 3-UTR which has a highly conserved binding site for miR-181a (
(158) The Defective Switch is Pro-Invasive
(159) In the absence of anti-migratory miR-198 the expression of pro-migratory targets in HNSCC was examined. Upon normal epidermal wounding, the miR-198 silencing switch de-represses several diverse mechanistic pathways that promote cell migration and tissue remodelling for wound healing. These pro-migratory miR-198 target genes include urokinase-type plasminogen activator (PLAU), a serine protease involved in degradation of extracellular matrix, diaphanous homolog 1 (DIAPH1) involved in actin polymerization, and laminin gamma 2 chain (LAMC2), forming part of the essential basement membrane protein laminin 332. However, based on expression pattern in HNSCC, the focus here is on DIAPH1 and its role in HNSCC. Immunohistochemistry on HNSCC tissue sections using anti-DIAPH1 antibody clearly indicates an aberrant expression of DIAPH1 in HNSCC (
(160) Prognostic Significance of FSTL1-DIAPH1 Gene-Pair
(161) To determine the role of FSTL1 and DIAPH1 in metastasis, genetically modified luciferase expressing A253 and FaDu cell lines were transduced with lentivirus encoding shFSTL1 or shDIAPH1 individually or in combination. Cells were implanted in immunodeficient NSG mice by lateral tail vein injections and evaluated for metastatic colonization. Silencing of FSTL1 or DIAPH1 independently decreased lung colonization significantly compared to the control cells (
(162) To understand the clinical significance of the defective switch, the expression profile and clinical data of 262 patients diagnosed with head and neck cancer from The Cancer Genome Atlas (TCGA) research network (TCGA, 2015) were interrogated. The level 3 RPKM intensity values of the RNA expression were downloaded from the database and analysed. Independently, the survival significance of the genes FSTL1 and DIAPH1 were assessed via 1D-DDg. Results revealed that independently, both FSTL1 (borderline significant, logrank p=0.0583) and DIAPH1 (logrank p=0.00160) exhibited oncogenic behaviour, whereas higher expression corresponded to poor overall survival of patients.
(163) Next, to study the potential combinatorial effect of the two genes FSTL1 and DIAPH1, a 2-dimensional data-driven grouping (2D-DDg) method was used to identify expression cut-offs on a two-dimensional axis to stratify the patient cohort into significant survival subgroups. Based on the expression cut-offs obtained via the 2D-DDg method, the Kaplan-Meier survival plots showed that patients with low expression of both FSTL1 and DIAPH1 exhibited relatively good overall survival (
(164) Finally, in patients with high expressions of both FSTL1 and DIAPH1 (
(165) EGF-Driven Microcircuitry Steers a Two-Pronged Pathway Towards Metastasis
(166) To investigate the underlying molecular mechanism, by which DIAPH1 promotes metastasis, a BioID (Proximity-dependent biotin identification) analysis was performed to identify potential interacting partners of DIAPH1. Arpin, which is a negative regulator of cell migration, was identified as a candidate interaction partner of DIAPH1 (
(167) To confirm the interaction of DIAPH1 with Arpin, cellular lysates from control or shDIAPH1 A253, SCC12 or SCC13 cells were subjected to immunoprecipitation (IP) using anti-DIAPH1 antibody and the immunoprecipitates were probed for Arpin by Western blot analysis. Significant enrichment of Arpin in control samples, compared to DIAPH1 depleted samples, confirmed the specific interaction of Arpin with DIAPH1 (
(168) To investigate the mechanistic pathway by which FSTL1 contributes to metastasis of HNSCC, a microarray analysis was performed comparing gene expression from control versus shFSTL1 SCC12 cells. A significant downregulation of MMP9 upon knockdown of FSTL1 was apparent (
(169) To understand how a secreted glycoprotein, FSTL1, regulates ERK phosphorylation, the protein interactors of FSTL1 were elucidated. The Biological General Repository for Interaction Datasets (BioGRID) analysis revealed multiple interacting partners of FSTL1, including Wnt4, Wnt5a, Wnt7a and Wnt10b (
(170) Depletion of FSTL1 inhibits ERK phosphorylation, however, knockdown of Wnt7a results in restoration of ERK phosphorylation (
(171) Wound healing is a self-limiting dynamic event where barrier disruption is transient. Following wound repair activated keratinocytes revert to a quiescent state and re-differentiate to restore a functional epidermal barrier, whereas carcinoma cells persist in an activated state maintaining a gene expression profile typical for migration and metastasis.
(172) Specific role of many miRNAs in cancer as tumour-suppressors or oncogenes is well known. The anti-migratory miR-198 targets regulators of mitogenic and motogenic pathways and inhibits migration. However, as a consequence of the defective switch, in HNSCC, miR-198 expression is blocked, leading to sustained expression of pro-migratory target genes including DIAPH1. The role of DIAPH1 in stabilisation of interphase microtubules is well known and a decrease in metastatic potential of cancer cells was observed upon depletion of DIAPH1 in colon cancer cells. DIAPH1, which is an EGF-regulated actin nucleator, together with Arp2/3 complex, nucleates polymerisation of branched actin filaments to form thin sheet-like membrane protrusions, known as lamellipodia and drives polarised cell migration. However, Arpin, which is a competitive inhibitor and a negative regulator of Arp2/3 complex, contributes to the collapse of lamellipodia, applying stringent brakes and restricts cell migration. In HNSCC, an additional role of the multifunctional DIAPH1, which sequesters Arpin, and favours directional persistence of migration, to enhance metastasis of carcinoma, was revealed (
(173) EGF-mediated activation of ERK cascade regulates cell migration and acquisition of an invasive phenotype. Further, inhibition of MMP9 activity using a neutralising antibody impaired EGF-induced HNSCC invasion, confirming the role of MMP9 in SCC invasion. The data disclosed herein also substantiates the role of EGF in regulating the expression of MMP9, a known prognostic biomarker for HNSCC. However, it is shown that in the absence of FSTL1, EGF-driven signalling cascade fails to up-regulate MMP9, indicating FSTL1 is an upstream regulator of MMP9. Wnt7a is known to inhibit EGF signalling, suppress tumour cell proliferation and invasion. In HNSCC, the secreted glycoprotein, FSTL1 interacts with Wnt7a and antagonises Wnt7a-mediated repression of ERK phosphorylation, leading to MMP9 expression (
(174) The subtle but crucial boundaries between the function of FSTL1 in wound healing and its role in the pathology of HNSCC, indicate that FSTL1 expression must be tightly regulated, allowing the protein to perform its physiological function while avoiding the detrimental consequences of sustained inappropriate expression. This emphasises the importance of the regulatory switch, which controls temporal and mutually exclusive expression of miR-198 and FSTL1. Cancer cells hijack the regulatory switch, turn-off miR-198 expression, thus allowing persistent expression of pro-migratory FSTL1 and DIAPH1 (
Materials and Methods
(175) Cell Culture and SCC Tissue Array
(176) HNSCC cell lines (A253, SCC12, SCC13 and FaDu) were cultured in RM+ media (3:1 DMEM; F12 HAMS media supplemented with 10% FBS, 0.5 g/ml hydrocortisone, 5 g/ml of insulin and transferrin, 13 ng/ml liothyronin, 1% glutamine, 10 ng/ml epidermal growth factor and penicillin/streptomycin). Tissue array (SK802a) containing cutaneous squamous cell carcinoma sections (76 cutaneous SCC tissue sections, 2 normal sections adjacent to tumour and 2 normal skin sections) was obtained from US Biomax. Human foreskin dermal fibroblasts and lenti-X 293T (Clonetech) were cultured in DMEM supplemented with 10% FCS and penicillin/streptomycin. HNSCC tissue arrays (HN803b) were obtained from US Biomax. Five HNSCC sections were negative for KRT14/KRT5 and therefore omitted for further study. Human foreskin dermal fibroblasts and lenti-X 293T (Clontech) were cultured in DMEM supplemented with 10% FCS and penicillin/streptomycin
(177) Antibodies
(178) Antibodies used in this study are as follows. Goat anti-FSTL1 antibody (#ab11805, Abcam), Rabbit anti-FSTL1 antibody (Protein tech), Rabbit anti-DIAPH1 antibody (#5486, Cell Signaling), Rabbit anti-KSRP antibody (#A302-22A, Bethyl laboratories), ms anti-KRT14 (clone LLO01), mouse anti-EGF (R&D systems, clone 10825), mouse anti-TGF1 (Novacastra) Rabbit anti-GFP (Covance), Rabbit anti-cMyc (Sigma). Streptavidin Alexa 555, Chicken anti-goat Alexa 488 and Donkey anti-rabbit/mouse Alexa 488/555 were from Molecular probes. Rabbit anti-Arp3 (#4738), phospho (#9101) and total ERK antibodies (#9102) were from Cell Signaling. Rabbit anti-Arpin (#ABT251) was purchased from Merck Millipore. Other antibodies used herein are Mouse anti-LAMC2 antibody (#sc25341, Santacruz biotechnologies), Rabbit anti-PLAU (#ab24121, Abcam), Mouse anti-TGF-1 (clone 9016, R&D systems), Rabbit anti-HuR antibody (#ab85539), Rabbit anti-CSPG4 (#ab104535), mouse anti-cMET (clone 11.1, Wong et al., 2013), mouse anti-MMP9 (#sc13520, Santa Cruz biotechnologies).
(179) Stable Knock-Down and Microarray Analysis
(180) ShRNAs were designed against the open reading frame of FSTL1/DIAPH1 sequences using siRNA wizard software (Invitrogen). ShRNAs were cloned into a lentiviral shRNA expression vector (pKAMU), in which H1 promoter drives the expression of shRNA by RNA polymerase III. Third generation lentiviruses were produced in Lenti-X 293T cells (Clontech) by co-transfection of shControl/shFSTL1/shDIAPH1 vectors and lentiviral packaging plasmid mix (pMDLg/pRRE, pRSV-Rev and pMD2.G). HNSCC cell lines were transduced with either control lentivirus encoding a scrambled shRNA or shRNA against FSTL1/DIAPH1. Cells with stable integration of lentiviruses were selected with 2 g of puromycin for 2 weeks. Total RNA was isolated from cells using the Exiqon miRcury RNA isolation kit. 250 ng of total RNA was converted into biotinylated cRNA using a TargetAmp Nano-g Biotin-aRNA labeling kit (Epicenter). 750 ng of biotinylated cRNA was hybridized to HT-12 V4 expression bead chip (Illumina) using samples in triplicate. Hybridization, washing and scanning were performed according to the manufacturer's protocol. Data extracted was normalized and analyzed using Illumina BeadStudio.
(181) Boyden Chamber Invasion Assays
(182) Transient knock-down of FSTL1, DIAPH1, PLAU and LAMC2 were achieved by transfection of 50 nM of On-target plus smart-pool siRNA (Dharmacon/Thermofischer scientific) using Dharmafect 1 transfection reagent as per manufacturer's protocol. A non-targeting siRNA was transfected as negative control. In vitro invasion assays were performed in BD biocoat matrigel invasion assay chambers. Two days post transfection cells were harvested and seeded onto the upper chamber in RM+ media without serum. Complete RM.sup.+ medium was used as a chemo-attractant in the lower chambers. 20 hours post seeding, cells above the membrane was wiped out with a cotton swab and the invaded cells were fixed in methanol and stained with Giemsa solution. Cell invasion was expressed as the percentage of cells invaded in six microscopic fields per chamber in three biological replicates. Invaded cell numbers in non-targeting siRNA transfected was considered as 100%.
(183) Organotypic Invasion Assay and Quantification
(184) Organotypic assays were set up as described in the art, with minor modifications. Briefly, in ice cold conditions, equal amount of matrigel (#354234 BD Biosciences) and rat tail collagen type I (#354236 BD Biosciences) with one tenth volume of FCS and 10DMEM were mixed and pH adjusted to neutral by addition of 0.1N NaOH. About 800 l of this solution was added to millicell hanging cell culture inserts and placed in 12-well plates (Nunc) for 1 hour at 37 C. for solidification. Complete fibroblast medium was added to both top and bottom of the insert and left overnight at 37 C. Human dermal fibroblasts (110.sup.5) was mixed with SCC cell line (2.510.sup.5) and seeded onto the gel and allowed to grow submerged in RM.sup.+ medium for 24 hours. Inserts were lifted to air liquid interface the very next day and cultures were maintained in RM.sup. media (RM.sup.+ media without epidermal growth factor) for two weeks after which the organotypic gels were processed for histology. The depth of invasion of Keratin 14 positive cells were quantified as described in the art.
(185) Immunohistochemistry
(186) Five micron tissue sections were mounted on polylysine-coated glass slides (Thermo Scientific). Sections were de-paraffinised in xylene and rehydrated using descending ethanol concentrations and finally in phosphate buffered saline (PBS). Endogenous peroxidase was quenched by immersing the slides in 3% hydrogen peroxide and methanol for 30 minutes. Antigen retrieval (dependant on the antibody), was performed using programmable pressure cooker with target retrieval solution, pH 6.0 (Dako). Non-specific reactivity in the tissues was blocked by incubation in 10% goat serum in PBS before incubating with the primary antibody at room temperature. Primary antibodies were removed before incubation with species matched secondary HRP-labelled polymer antibodies (Dako). Chromogen 3,3-diaminobenzidine (Dako) was used as substrate for colour development. Slides were counterstained with hematoxylin before dehydration and mounted with DPX (Sigma). For fluorescent immunodetection, species specific secondary antibodies conjugated to Alexa 488/555 were used instead of HRP-labelled polymer antibodies. Sections were washed with running tap water, counterstained with DAPI (100 ng/ml) and mounted using Florsave (Calbiochem) mounting medium. For experiments where goat primary antibodies were used, 5% BSA in PBS was substituted for 10% goat serum. Images were acquired on a Zeiss Axioimager microscope (for bright field imaging) or on Olympus FluoView FV1000 (for fluorescent antibody detection). Quantification of staining intensities in tissue arrays was performed visually by two independent observers. Intensities were classified as negative, week, moderate and strong by averaging the independent observations.
(187) miRNA In Situ Hybridization
(188) 5 m sections were processed and boiled in pre-treatment solution (Panomics), washed in PBS, followed by protease (Panomics) treatment at 37 C. Sections were incubated with LNA probes [5-DIG labelled LNA probes specific for miR-198/miR-181a or scrambled probe with no homology to known vertebrate miRNAs (Exiqon)] in hybridization buffer (Roche) at 51 C. for 4 hours. Following stringent wash, sections were blocked with 10% Goat serum and further incubated with anti-DIG alkaline phosphatase (Roche) overnight at 4 C. Sections were washed in PBS-T (0.1%) and miRNA bound LNA probes were detected by fast red substrate (Panomics). After counterstaining with DAPI, slides were mounted using FluorSave (Merck). Image acquisition was performed with Olympus FluoView FV1000 using TRITC filter.
(189) In Vivo Lung Metastasis Assay
(190) Six- to eight-week-old female NOD-scid IL2Re.sup.null inbred mice were obtained from Jackson Laboratories, Bar Harbor, Me., USA and housed in a specific pathogen-free animal facility. The animals were fed with irradiated mouse chow and autoclaved reverse osmosis treated water. All the animal procedures were performed in accordance with a protocol approved by the Institutional Animal Care and Usage Committee (IACUC #120793). A253 cells constitutively expressing luciferase, transduced with lentiviruses expressing control shRNA or shRNAs against FSTL1, or DIAPH1 or a combination of both FSTL1 and DIAPH1, were harvested with trypsin/EDTA. Cells were washed and re-suspended at a concentration of 510.sup.6 cells per ml. A total of 0.510.sup.6 cells were injected into mice via tail vein and cohorts of 7 mice were used in each group. Survival and successful injection of the cells was monitored by detection of bioluminescence in the lungs after 24 hours using IVIS Spectrum in vivo Imaging System (Xenogen, Perkin Elmer, Mass., USA). In each imaging session, a total of 150 mg of Luciferin per kg body weight was administered into the peritoneal cavity. Mice were imaged 9 minutes after Luciferin injection to ensure consistent photon flux. The bioluminescent signal was expressed in photons per second and displayed as an intensity map. The image display was adjusted to provide optimal contrast and resolution in the image without affecting quantitation. Following acquisition, all images were normalized to units of average efficiency, displayed in the same scale of luminescence intensity, and analysed using the Living Image 4 software (Xenogen, Perkin Elmer, Mass., USA). Luminescence from the cells was measured in the lungs using a region of interest tool. This quantification was plotted as Relative Bioluminescence Units against time. The data were expressed as meanstandard deviation (SD). Statistical analysis was estimated using Student's t-test method. The values with p<0.05 were interpreted to be significant. 30 days post injection mice were euthanized, lungs were harvested, fixed and processed into FFPE blocks. Cancer cells in micro-metastatic foci were detected by immunohistochemistry using a rabbit-anti-human KRT5 antibody.
(191) Zymography
(192) 20 l of cell culture supernatant was loaded and resolved on to SDS-PAGE containing 0.15% gelatin followed by two washes in 2.5% Triton x 100. Gel was soaked in a developer buffer containing 50 mM Tris HCl pH 7.4, 150 mM NaCl and 10 mM CaCl.sub.2) overnight at 37 C. and visualized by staining the gel in 0.2% Coomassie brilliant blue R-250 for 1 hour followed by multiple de-staining rounds in 30% methanol and 7% acetic acid. Band intensity was quantified by Image J and plotted after normalizing the values to background intensity. The position of MMP9 was identified by co-migration of recombinant MMP9 in the same gel.
(193) Biotin-Streptavidin Affinity Purification of DIAPH1 Interacting Partners
(194) Full-length cDNA for DIAPH1 (accession no: NM_005219) was purchased from Origene. DIAPH1 ORF was PCR amplified and cloned as a fusion protein N-terminally with a myc-tagged BirA in pTRIPZ vector system. The entire myc-BirA-DIAPH1 cassette is under the control of Tetracycline inducible promoter system (Tet-ON) for the stringent control of fusion protein expression. For affinity purification of biotinylated interacting partners of DIAPH1, 293T cells were transfected with 20 g of plasmid DNA using calcium phosphate transfection method. Cells were selected with puromycin (2 m/ml) and 72 hrs post-transfection cells were supplemented with Doxycycline (Dox) (5 m/ml) for 24 hrs to induce transgene expression. In order to induce biotinylation of interacting partners, 50 M of biotin was added to cells and incubated for 24 hours. Cells were harvested by trypsinization and subjected to biotin affinity capture purification (BioID) (Roux et al., 2013). Briefly, cells were lysed in buffer containing 50 mM Tris Cl (pH 7.4), 500 mM NaCl, 0.2% SDS with 1 protease inhibitor cocktail (Roche). After clarifying the cell debris by centrifugation, lysates were incubated with Dynabeads (MyOne Streptavidine C1, Life Technologies) overnight. Unbound and non-specific proteins were removed following wash buffer formulation as described in the art. After final wash with 50 mM Tris Cl (pH 7.4), proteins bound to beads were subjected to mass spectrometry analysis as described below. For initial validation of BioID methodology, cells were transfected in coverslips as above. The fusion protein and biotinylated proteins were detected by Rabbit anti-myc and streptavidin conjugated Alexaflour-555 (Invitrogen), respectively.
(195) Mass Spectrometry and Data Analysis
(196) For mass spectrometric analysis, proteins bound to streptavidin beads were digested on-bead following protocols known in the art. The peptides were separated using a gradient of 2% to 80% acetonitrile in 0.1% formic acid at a flow rate of 350 nL/min. Data was collected by Orbitrap Fusion Tribrid Mass Spectrometer (MS) (ThermoFisher Scientific, San Jose, Calif.) and proxeon EASY-nLC 1000 liquid chromatography (LC-MS/MS). Raw data was analyzed using Proteome Discoverer (Version 1.4.0.288 Thermo Fisher Scientific) and Scaffold 4.1 (Proteome Software, Portland, Oreg.) with mascot search engine. (http://www.uniprot.org/uniprot/?query=Human&sort=score).
(197) The peptide spectral matches (PSM) were validated using percolator based on q-values at a 1% false discovery rate (FDR). For protein identification, a high-confidence database search with peptide target FDR (strict) of 0.1%, and target FDR (relaxed) 0.5% and ranked peptides were used for peptide filtering. Identified peptides were grouped into individual protein cluster by Scaffold. The list of proteins obtained by this method was further shortlisted. Proteins identified in cells without dox treatment but with biotin, proteins commonly found in BioID methodology and proteins with less than 8% peptide coverage were subtracted from the list.
(198) BioGRID Analysis
(199) [http://thebiogrid.org/116338/summary/homo-sapiens/fst11.html] BioGRID version 3.4.134 was used to predict the interacting partners of FSTL1 protein.
(200) Co-Immunoprecipitation and Western Blotting:
(201) Total cell extract was prepared from A253 cells by directly lysing the cells in RIPA buffer in culture wells. Cells were lysed at 5 pulses of sonication followed by clarification at 16,000 RCF for 10 minutes at 4 C. Co-immunoprecipitation analysis for selected proteins was performed using a co-immunoprecipitation kit (Peirce) as per the manufacturer's recommendations. Proteins bound to beads were eluted in Lamelli buffer, resolved through 10% SDS-PAGE and subjected to Western blot analysis. Proteins were detected by chemiluminescence.
(202) Live Cell Imaging
(203) 1010.sup.3 cells were seeded in a glass bottom culture dish (Ibidi GmbH) for 24 hours. A drop of Nucblue live cell stain (Life Technologies; R37605) was added to the cells in the culture medium and incubated for 30 minutes. The cells were washed with PBS and fresh medium was added. The live cell migration was followed for 24 hours, using Olympus IX-83 LCI RM 5.17 live cell imaging system. The data was processed and analysed using Imaris 8.1.2 software tool.
(204) Data-driven grouping method (DDg): One-dimensional data-driven grouping (1DDDg) method is a computational and statistical approach to identify an optimal expression cut-off on a linear scale that provides maximal and most statistically significant stratification of the survival curves. Two-dimensional data-driven grouping (2D-DDg) method further extends the idea of 1DDg, and evaluates the potential synergistic effect of gene-pairs in patient prognosis. Briefly, 2D-DDg identifies one expression cut-off on each orthogonal axis (each representing one gene of the gene-pair) that collectively could stratify patients into two subgroups with the most significantly different survival curves. The methods of 1DDg and 2DDg were previously used to identify and experimentally validate molecular signatures of ovarian cancer, breast cancer, as well as used in evaluating the survival significance of gene features in glioblastoma.
(205) Gel Retardation Assay
(206) The pre-miR-198 substrate for gel retardation assay was prepared as described earlier. The U-rich element present within pre-miR-198 sequence were converted to C residues (See SEQ ID NO: 19 and 20 in the table below) using Quick change site directed mutagenesis Kit. Increasing concentration of recombinant HuR protein (0.2, 0.4 and 0.6 M) was incubated with the wild type or mutant pre-miR-198 transcripts in 20 l of reaction buffer containing 30 mM Tris HCl, pH 7.4, 5 mM MgCl.sub.2, 50 mM KCl, 0.5 mM DTT, 40 U/ml of RNaseOUT, 250 g/ml of yeast tRNA and 10% glycerol. After 30 minutes at room temperature, reaction products were resolved through 6% native polyacrylamide gel electrophoresis. For competitive binding assay, 0.2 M of KSRP was co-incubated with indicated concentration of HuR in the presence of pre-miR-198 transcript. The resulting gel was dried and the protein RNA complex and unbound RNA were visualized by phosphor-imaging.
(207) In Vitro Transcription and Translation
(208) Generation of pMIRGLO dual luciferase containing FSTL1 3-untranslated region (UTR) downstream of firefly luciferase open reading frame was performed as described in the art. Primers with T7 RNA polymerase promoter linkers (see paragraph 00176 for sequence table) were used to amplify the entire luciferase-FSTL1 3-UTR fragment along with the Kozak sequence. A PCR fragment containing the copGFP ORF was amplified from pCDH vector (System biosciences), using primers listed in tables section. PCR products were purified and subjected to in vitro transcription with Ambion mMessage mMachine kit. For in vitro translation, 500 ng of purified Luc-FSTL1 chimeric RNA and 200 ng of GFP RNA was added to 30 l of rabbit reticulocyte lysate, 20 M of methionine free amino acid mixture, 50 Ci of Easy tag Express 35S protein labeling mix and 10 g of cell extract in a total volume of 50 l for 1 hour at 30 C. 10 l aliquot of the reaction mix was separated on 10% SDS-PAGE, fixed in 10% acetic acid/40% methanol, dried and exposed to phosphorimaging.
(209) Statistical AnalysisValues are Reported as the Meanthe Standard Error
(210) Statistical significance between 2 samples was determined with two-tailed Student's t-test or one-way analysis of variance (ANOVA) when comparing multiple groups. Statistical significance between 2 samples was determined with two-tailed Student's t test using GraphPad InStat 3.0 software (GraphPad Software, Inc.). For tissue arrays, chi square analysis was performed as described in the art. Values were reposted as meanstandard error.
Sequences
(211) Table of sequences: unless otherwise stated, nucleic acid sequences are provided in 5 to 3 direction and peptide sequences are provided from N- to C-terminus according to convention.
(212) TABLE-US-00001 SEQ IDNO: Description Sequence 1 HumanmicroRNA-198(miRNA- GGTCCAGAGGGGAGATAGGTTC 198)DNAsequence 2 5 sectionofhumanmicroRNA- GTCCAGAG 198(miRNA-198) 3 Follistatin-relatedprotein1 MWKRWLALALALVAVAWVRAEEELRSKS (FSTL1) KICANVFCGAGRECAVTEKGEPTCLCIEQCK PHKRPVCGSNGKTYLNHCELHRDACLTGSK IQVDYDGHCKEKKSVSPSASPVVCYQSNRD ELRRRIIQWLEAEIIPDGWFSKGSNYSEILDK YFKNFDNGDSRLDSSEFLKFVEQNETAINIT TYPDQENNKLLRGLCVDALIELSDENADWK LSFQEFLKCLNPSFNPPEKKCALEDETYADG AETEVDCNRCVCACGNWVCTAMTCDGKN QKGAQTQTEEEMTRYVQELQKHQETAEKT KRVSTKEI 4 Proteindiaphanoushomolog1 MEPPGGSLGPGRGTRDKKKGRSPDELPSAG (DIAPH1) GDGGKSKKFTLKRLMADELERFTSMRIKKE KEKPNSAHRNSSASYGDDPTAQSLQDVSDE QVLVLFEQMLLDMNLNEEKQQPLREKDIIIK REMVSQYLYTSKAGMSQKESSKSAMMYIQ ELRSGLRDMPLLSCLESLRVSLNNNPVSWV QTFGAEGLASLLDILKRLHDEKEETAGSYDS RNKHEIIRCLKAFMNNKFGIKTMLETEEGIL LLVRAMDPAVPNMMIDAAKLLSALCILPQP EDMNERVLEAMTERAEMDEVERFQPLLDG LKSGTTIALKVGCLQLINALITPAEELDFRVH IRSELMRLGLHQVLQDLREIENEDMRVQLN VFDEQGEEDSYDLKGRLDDIRMEMDDFNE VFQILLNTVKDSKAEPHFLSILQHLLLVRND YEARPQYYKLIEECISQIVLHKNGADPDFKC RHLQIEIEGLIDQMIDKTKVEKSEAKAAELE KKLDSELTARHELQVEMKKMESDFEQKLQ DLQGEKDALHSEKQQIATEKQDLEAEVSQL TGEVAKLTKELEDAKKEMASLSAAAITVPP SVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTT PPPPPPPPPPPPPLPGGVCISSPPSLPGGTAISP PPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAI PPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPG EAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPP PGMGMPPPPPFGFGVPAAPVLPFGLTPKKLY KPEVQLRRPNWSKLVAEDLSQDCFWTKVK EDRFENNELFAKLTLTFSAQTKTSKAKKDQ EGGEEKKSVQKKKVKELKVLDSKTAQNLSI FLGSFRMPYQEIKNVILEVNEAVLTESMIQN LIKQMPEPEQLKMLSELKDEYDDLAESEQF GVVMGTVPRLRPRLNAILFKLQFSEQVENIK PEIVSVTAACEELRKSESFSNLLEITLLVGNY MNAGSRNAGAFGFNISFLCKLRDTKSTDQK MTLLHFLAELCENDYPDVLKFPDELAHVEK ASRVSAENLQKNLDQMKKQISDVERDVQN FPAATDEKDKFVEKMTSFVKDAQEQYNKL RMMHSNMETLYKELGEYFLFDPKKLSVEEF FMDLHNFRNMFLQAVKENQKRRETEEKMR RAKLAKEKAEKERLEKQQKREQLIDMNAE GDETGVMDSLLEALQSGAAFRRKRGPRQA NRKAGCAVTSLLASELTKDDAMAAVPAKV SKNSETFPTILEEAKELVGRAS 5 Lamininsubunitgamma-2 MPALWLGCCLCFSLLLPAARATSRREVCDC (LAMC2) NGKSRQCIFDRELHRQTGNGFRCLNCNDNT DGIHCEKCKNGFYRHRERDRCLPCNCNSKG SLSARCDNSGRCSCKPGVTGARCDRCLPGF HMLTDAGCTQDQRLLDSKCDCDPAGIAGPC DAGRCVCKPAVTGERCDRCRSGYYNLDGG NPEGCTQCFCYGHSASCRSSAEYSVHKITST FHQDVDGWKAVQRNGSPAKLQWSQRHQD VFSSAQRLDPVYFVAPAKFLGNQQVSYGQS LSFDYRVDRGGRHPSAHDVILEGAGLRITAP LMPLGKTLPCGLTKTYTFRLNEHPSNNWSP QLSYFEYRRLLRNLTALRIRATYGEYSTGYI DNVTLISARPVSGAPAPWVEQCICPVGYKG QFCQDCASGYKRDSARLGPFGTCIPCNCQG GGACDPDTGDCYSGDENPDIECADCPIGFY NDPHDPRSCKPCPCHNGFSCSVMPETEEVV CNNCPPGVTGARCELCADGYFGDPFGEHGP VRPCQPCQCNNNVDPSASGNCDRLTGRCLK CIHNTAGIYCDQCKAGYFGDPLAPNPADKC RACNCNPMGSEPVGCRSDGTCVCKPGFGGP NCEHGAFSCPACYNQVKIQMDQFMQQLQR MEALISKAQGGDGVVPDTELEGRMQQAEQ ALQDILRDAQISEGASRSLGLQLAKVRSQEN SYQSRLDDLKMTVERVRALGSQYQNRVRD THRLITQMQLSLAESEASLGNTNIPASDHYV GPNGFKSLAQEATRLAESHVESASNMEQLT RETEDYSKQALSLVRKALHEGVGSGSGSPD GAVVQGLVEKLEKTKSLAQQLTREATQAEI EADRSYQHSLRLLDSVSRLQGVSDQSFQVE EAKRIKQKADSLSSLVTRHMDEFKRTQKNL GNWKEEAQQLLQNGKSGREKSDQLLSRAN LAKSRAQEALSMGNATFYEVESILKNLREF DLQVDNRKAEAEEAMKRLSYISQKVSDASD KTQQAERALGSAAADAQRAKNGAGEALEIS SETEQEIGSLNLEANVTADGALAMEKGLASL KSEMREVEGELERKELEFDTNMDAVQMVIT EAQKVDTRAKNAGVTIQDTLNTLDGLLHL MDQPLSVDEEGLVLLEQKLSRAKTQINSQL RPMMSELEERARQQRGHLHLLETSIDGILAD VKNLENIRDNLPPGCYNTQALEQQ 6 Urokinase-typeplasminogen MRALLARLLLCVLVVSDSKGSNELHQVPSN activator(PLAU) CDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ HCEIDKSKTCYEGNGHFYRGKASTDTMGRP CLPWNSATVLQQTYHAHRSDALQLGLGKH NYCRNPDNRRRPWCYVQVGLKPLVQECMV HDCADGKKPSSPPEELKFQCGQKTLRPRFKI IGGEFTTIENQPWFAAIYRRHRGGSVTYVCG GSLISPCWVISATHCFIDYPKKEDYIVYLGRS RLNSNTQGEMKFEVENLILHKDYSADTLAH HNDIALLKIRSKEGRCAQPSRTIQTICLPSMY NDPQFGTSCEITGFGKENSTDYLYPEQLKMT VVKLISHRECQQPHYYGSEVTTKMLCAADP QWKTDSCQGDSGGPLVCSLQGRMTLTGIVS WGRGCALKDKPGVYTRVSHFLPWIRSHTKE ENGLAL 7 siRNAsequenceFSTL1 CGGATACTATTGATGAATAA 8 siRNAsequenceLAMC2 AGAATCCTGACATTGAGTGT 9 siRNAsequenceDIAPH1 CTGCATGTGAGGAGTTACGT 10 siRNAsequencePLAU AATTCTACCGACTATCTCTA 11 SequenceofPre-miR-198WT TCATTGGTCCAGAGGGGAGATAGGTTCCT probe GTGATTTTTCCTTCTTCTCTATAGAATAAA TGA 12 SequenceofPre-miR-198WT TCATTGGTCCAGAGGGGAGATAGGTTCCT probe GTGACCCCCCCTTCTTCTCTATAGAATAAA TGA 13 LuciferaseT7forwardprimer TAATACGACTCACTATAGGGAAAGCCACC (binds9basepairsupstreamof ATGGAAGATGCC LuciferaseAUGinpMIRGLO. IncludestheKozaksequence) 14 FSTL13 UTRreverseprimer CCGAAAAGGAAGAATCAGGAG (Bindstoposition2617in FSTL13UTR) 15 CopGFPstartT7Fprimer TAATACGACTCACTATAGGGctagacgccacc atggagagc 16 CopGFPstopR GTCGACTTAGCGAGATCCGGTG 17 HumanmicroRNA-198(miRNA- GGUCCAGAGGGGAGAUAGGUUC 198)-RNAsequence 18 HumanmicroRNA-198(miRNA- GUCCAGAG 198)-Seedsequence 19 Pre-miR-198WT TCATTGGTCCAGAGGGGAGATAGGTTCCT GTGATTTTTCCTTCTTCTCTATAGAATAAA TGA 20 Pre-miR-198Mut TCATTGGTCCAGAGGGGAGATAGGTTCCT GTGACCCCCCCTTCTTCTCTATAGAATAA ATGA