Amino acid-specific binder and selectively identifying an amino acid
10836798 ยท 2020-11-17
Assignee
Inventors
- Jennifer A. Tullman (Germantown, MD, US)
- Zvi Kelman (Gaithersburg, MD)
- John P. Marino (Silver Spring, MD)
Cpc classification
International classification
Abstract
An amino acid-specific binder selectively binds to a binding amino acid. A binder complex selectively identifies the binding amino acid and includes an adjunct attached to the amino acid-specific binder. The adjunct includes a taggant, protein, substrate, or chemical modifier. Selectively identifying an N-terminal amino acid includes anchoring a C-terminal end; contacting an N-terminal amino acid of the anchored analyte with the binder complex; selectively binding when the N-terminal amino acid includes the binding amino acid; producing, by the taggant of the tagged complex, a taggant signal; detecting the taggant signal; and identifying the N-terminal amino acid based on the taggant signal.
Claims
1. An amino acid-specific binder for selectively binding to an amino acid in an analyte, the amino acid-specific binder comprising: TABLE-US-00013 afirstaminoacidsequencecomprising (SequenceIDNo.1) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTCPSFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; asecondaminoacidsequencecomprising (SequenceIDNo.2) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTCSWFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; athirdaminoacidsequencecomprising (SequenceIDNo.3) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMSFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; afourthaminoacidsequencecomprising (SequenceIDNo.4) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTSGRFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; afifthaminoacidsequencecomprising (SequenceIDNo.5) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMPFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; asixthaminoacidsequencecomprising (SequenceIDNo.6) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPREFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVSERDIAETKAKEATDLGKEAGFPLMFTTEP EE; aseventhaminoacidsequencecomprising (SequenceIDNo.7) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPREFVTEVLKAVFNMSE DQGRRVMMTAHRFGSAVVGVCTRDIAETKAKQATDLAREAGFPLMFTTEP EE; aneighthaminoacidsequencecomprising (SequenceIDNo.8) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMSFVTEVLKAVFNMSE DQGRRVMMTAHRFGSAVVGVSTRDIAETKAKQATDLAREAGFPLMFTTEP EE; or aninthaminoacidsequencecomprising (SequenceIDNo.10) NLEKIKKLRNVIKEIKKDNIKEADEHEKKEREKETSAWKVILYNDDIHKF SYVTDVIVKVVGQISKAKAHTITVEAHSTGQALILSTWKSKAEKYCQELQ QNGLTVSIIHESQLKDKQKK.
2. An amino acid-specific binder for selectively binding to an amino acid in an analyte, the amino acid-specific binder comprising the amino acid sequence comprising: a first amino acid sequence comprising X1-C-P-S-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 1); a second amino acid sequence comprising X1-C-S-W-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 2); a third amino acid sequence comprising X1-P-M-S-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 3); a fourth amino acid sequence comprising X1-S-G-R-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 4); a fifth amino acid sequence comprising X1-P-M-P-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 5); a sixth amino acid sequence comprising X1-P-R-E-X2-V-X3-R-X4-T-X5-C-E-X6-E-X7-G-K-X8 (Sequence ID No. 6); a seventh amino acid sequence comprising X1-P-R-E-X2-V-X3-R-X4-T-X5-S-E-X6-E-X7-G-K-X8 (Sequence ID No. 7); an eighth amino acid sequence comprising X1-P-M-S-X2-E-X3-N-X4-Q-X5-S-T-X6-Q-X7-A-R-X8 (Sequence ID No. 8); wherein: X1 comprises the amino acid sequence comprising SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYT (Sequence ID No. 20); X2 comprises the amino acid sequence comprising FVT; X3 comprises the amino acid sequence comprising VLKAVF (Sequence ID No. 22); X4 comprises the amino acid sequence comprising MSED (Sequence ID No. 23); X5 comprises the amino acid sequence comprising GRRVMMTAHRFGSAVVVV (Sequence ID No. 24); X6 comprises the amino acid sequence comprising RDIAETKAK (Sequence ID No. 25); X7 comprises the amino acid sequence comprising ATDL (Sequence ID No. 26); and X8 comprises the amino acid sequence comprising EAGFPLMFTTEPEE (Sequence ID No. 27), such that a total percentage amount of substitutions and deletions to X1, X2, X3, X4, X5, X6, X7, and X8 is from 0% to less than 30%, exclusive of TABLE-US-00014 (SequenceIDNo.27) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTCPSFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The following description should not be considered limiting in any way. With reference to the accompanying drawings, like elements are numbered alike.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
DETAILED DESCRIPTION
(23) A detailed description of one or more embodiments is presented herein by way of exemplification and not limitation.
(24) It has been discovered that an amino acid-specific binder herein selectively binds to a binding amino acid selected from a group of specific amino acids. Indeed, the amino acid-specific binder overcomes a central challenge in single-molecule protein sequencing technology and provides high-fidelity, sequential recognition, detection of specific amino acids that can be included in a peptide sequence. Moreover, the amino acid-specific binder overcomes lack of selectivity involved with an N-End Rule Pathway adaptor protein (NERPap), ClpS, that natively recognizes an N-terminal amino acid (NAA) on a peptide chain, wherein the NERPap lacks selectivity and affinity for peptide sequencing. Beneficially and unexpectedly, the amino acid-specific binder provides selectivity by including novel sequence variants of A. tumefaciens ClpS2, a. ClpS protein, such that the amino acid-specific binder has enhanced affinity and selectivity far various amino acids including phenylalanine (Phe), tryptophan (Trp), and tyrosine (Tyr), which can occur as a single binding amino acid or at an N-terminus of a peptide or protein. Advantageously, the amino acid-specific binder determines a sequence or fingerprint of amino acids in a peptide or protein when used iteratively.
(25) Amino acid-specific binder 200 selectively binds to binding amino acid 210 in analyte 212. In an embodiment, amino acid-specific binder 200 is a protein that includes an amino acid sequence that is
(26) TABLE-US-00006 (SequenceIDNo.1) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTCPSFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; (SequenceIDNo.2) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTCSWFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; (SequenceIDNo.3) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMSFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; (SequenceIDNo.4) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTSGRFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; afifthaminoacidsequencecomprising (SequenceIDNo.5) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMPFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEP EE; (SequenceIDNo.6) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPREFVTVVLKAVFRMSE DTGRRVMMTAHRFGSAVVVVSERDIAETKAKEATDLGKEAGFPLMFTTEP EE; (SequenceIDNo.7) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPREFVTEVLKAVFNMSE DQGRRVMMTAHRFGSAVVGVCTRDIAETKAKQATDLAREAGFPLMFTTEP EE; (SequenceIDNo.8) SDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPMSFVTEVLKAVFNMSE DQGRRVMMTAHRFGSAVVGVSTRDIAETKAKQATDLAREAGFPLMFTTEP EE; (SequenceIDNo.9) PSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCG VYTYEVAETKVAQVIDSARRHQHPLQCTMEKD; (SequenceIDNo.10) NLEKIKKLRNVIKEIKKDNIKEADEHEKKEREKETSAWKVILYNDDIHKF SYVTDVIVKVVGQISKAKAHTITVEAHSTGQALILSTWKSKAEKYCQELQ QNGLTVSIIHESQLKDKQKK;
or an amino acid sequence with a homology of at least 30% compared to an amino acid sequence comprising the amino acid sequence with Sequence ID No. 1, Sequence ID No. 2, Sequence ID No. 3, Sequence ID No. 4, Sequence ID No. 5, Sequence ID No. 6, Sequence ID No. 7, Sequence ID No. 8, Sequence ID No. 9, or Sequence ID No. 10. Amino acid-specific binder 200 binds selectively to binding amino acid 210 selected from the group consisting of isoleucine, leucine, phenylalanine, tryptophan, tyrosine, and valine; and chemically modified amino acids phenylalanine, tryptophan, tyrosine, isoleucine, leucine, and valine. Accordingly, with reference to
(27) According to an embodiment, amino acid-specific binder 200 is a protein with Sequence ID No. 1 and binds selectively to phenylalanine, tryptophan, or leucine.
(28) According to an embodiment, amino acid-specific binder 200 is a protein with Sequence ID No. 2 and binds selectively to phenylalanine, tyrosine, or isoleucine.
(29) According to an embodiment, amino acid-specific binder 200 is a protein with Sequence ID No. 3 and binds selectively to phenylalanine, tryptophan, chemically modified phenylalanine, and chemically modified tryptophan.
(30) According to an embodiment, amino acid-specific binder 200 is a protein with Sequence ID No. 4 and binds selectively to phenylalanine, tryptophan, tyrosine, chemically modified phenylalanine, chemically modified tryptophan, and chemically modified tyrosine.
(31) According to an embodiment, amino acid-specific binder 200 is a protein with Sequence ID No. 5 and binds selectively to phenylalanine, tryptophan, tyrosine, isoleucine, leucine, valine, or chemically modified amino acids phenylalanine, tryptophan, tyrosine, isoleucine, leucine, and valine.
(32) According to an embodiment, amino acid-specific binder 200 is a protein with Sequence ID No. 6 and binds selectively to phenylalanine, tryptophan, tyrosine, isoleucine, leucine, valine, or chemically modified amino acids phenylalanine, tryptophan, tyrosine, isoleucine, leucine, and valine.
(33) According to an embodiment, amino acid-specific binder 200 is a protein with Sequence ID No. 7 and binds selectively to phenylalanine, tryptophan, tyrosine, isoleucine, leucine, valine, or chemically modified amino acids phenylalanine, tryptophan, tyrosine, isoleucine, leucine, and valine.
(34) According to an embodiment, amino acid-specific binder 200 is a protein with Sequence ID No. 8 and binds selectively to phenylalanine, tryptophan, or chemically modified phenylalanine or chemically modified tryptophan.
(35) According to an embodiment, amino acid-specific binder 200 is a protein with Sequence ID No. 9 and binds selectively to tyrosine, isoleucine, leucine, or valine.
(36) According to an embodiment, amino acid-specific binder 200 is a protein with Sequence ID No. 10 and binds selectively to phenylalanine, tryptophan, tyrosine, isoleucine, leucine, valine, or chemically modified amino acids phenylalanine, tryptophan, tyrosine, isoleucine, leucine, and valine.
(37) According to an embodiment, amino acid-specific binder 200 is a protein with a sequence homology of at least 30% compared to an amino acid sequence selected from the group consisting essentially of the amino acid sequence with Sequence ID No. 1, Sequence ID No. 2, Sequence ID No. 3, Sequence ID No. 4, Sequence ID No. 5, Sequence ID No. 6, Sequence ID No. 7, Sequence ID No. 8, Sequence ID No. 9, and Sequence ID No. 10 and binds selectively to isoleucine, leucine, phenylalanine, tryptophan, tyrosine, valine or chemically modified amino acids phenylalanine, tryptophan, tyrosine, isoleucine, leucine, and valine.
(38) Binder complex 228 selectively identifies an amino acid. In an embodiment, binder complex 228 includes amino acid-specific binder 200 and adjunct 236 attached to amino acid-specific binder 200. Attachment of adjunct 236 to amino acid-specific binder 200 can include a covalent bond, an ionic bond, electrostatic interaction (e.g., a -cation interaction, dipole-dipole interaction, a multi-pole interaction, and the like), intercalation, a clathrate arrangement (e.g., with adjunct 236 partially or wholly trapped in amino acid-specific binder 200 or vice-versa, such that amino acid-specific binder 200 can still selectively bind to binding amino acid 210, e.g., of analyte 212), and the like. Further, adjunct 236 can be attached to amino acid-specific binder 200 either directly, indirectly, or a combination thereof. With reference to
(39) In binder complex 228, with reference to
(40) Protein 238 can include a protein to facilitate expression or purification of amino-acid specific binder 200 such as a protein with a functional group that can be immobilized on a resin, an antibody, Protein A, Protein G, a peptide of six histidine residues, Glutathione S-transferase, maltose binding protein, biotin, or streptavidin. Moreover, protein 238 can include a protein with a reactive property such as enzymatic activity, a protease cleavage site, or fluorescence that can be stimulated to produce a signal and can be green fluorescent protein, horseradish peroxidase, luciferase, and the like. Moreover, protein 238 can include proteins with a selected molecular weight, isoelectric point, or functional group that can facilitate separation of binding complex 238, e.g., by dialysis, chromatography, or gradient centrifugation. Exemplary proteins 238 include an immunoglobulin, a high molecular weight protein (HMWP), DNA-binding protein, oligosaccharide binding protein, and the like. In an embodiment, protein 238 is biotinylated and can be attached to a substrate through interaction with streptavidin.
(41) Substrate 240 can include magnetic beads, fluorescent beads, silica coverslips, or microplates to attach amino acid-specific binder 200 to the substrate surface and can be a functionalized glass slide. Moreover, the substrate can be used for localization of amino acid-specific binder 200 by providing separation either by size or magnetism or physical movement of the substrate. The substrate can also be used to detect a taggant signal such as with fluorescent microscopy and can be a functionalized surface that is optically clear. Exemplary substrates 240 include NETS-ester functionalized glass slides, streptavidin coated magnetic beads or microplates, a nickel coated resin, and the like. In an embodiment, substrate 240 includes a nickel coated resin.
(42) Chemical modifier 242 can include a reactive species that can be used in a non-covalent binding reaction or a cross-linking reaction or can be used to amplify a signal. Exemplary chemical modifiers 242 include click-chemistry compatible moieties, N-hydroxysuccinimide esters, biotin, maleimide, hydrazide, carbodiimide compounds for carboxylic acid cross-linking, photocatalysts, or electrocatalysts. In an embodiment, chemical modifier 242 includes an azide.
(43) Exemplary taggant 214 are listed in Table 1 and can include a fluorescent moiety that can include embedded a fluorophore disposed in a shell, an electrochemical moiety, chemiluminescent moiety, Forster resonance energy transfer (FRET) pair, catalytic enzyme, chemical modification, or a combination comprising at least one of the foregoing moieties, that transduce or amplify stimulus 218 to a measurable response as taggant signal 216 for detecting a presence of amino acid-specific binder 200. In an embodiment, taggant 214 is a fluorophore (e.g. a fluorophore commercially available as ALEXAFLUOR such as ALEXAFLUOR647 and the like) that includes conjugated electrons to produce fluorescence upon stimulation by stimulant 218. Exemplary taggants 214 include horseradish peroxidase, fluorescein, rhodamine, and the like. In an embodiment, taggant 214 includes a fluorescently labelled dye (e.g., a dye such as commercially available as ATTO532). Taggant 214 produces taggant signal 216 in response to being subjected to stimulus 218.
(44) TABLE-US-00007 TABLE 1 Complex formation Taggant method Stimulant Signal Detection Fluorophore NHS-ester lysine Photon Photon intensity or sidechain wavelength Chemiluminescence Luciferase fusion ATP Photon Intensity Electrochemiluminescence Fusion with Electrode photon PMT Ru(Bpy)3 potential FRET pair a fluorophore on Photon Photon Intensity or amino acid-specific wavelength binder 200, a fluorophore on analyte 212, or fluorophores on amino acid-specific binder 200 Catalytic enzyme Horseradish Addition of Absorbance Spectrophotometer peroxidase fusion chromogenic at a substrate wavelength Radioactive element .sup.35S-methionine, None Radioactivity Scintillation .sup.32P- counting or phosphorylation, or radio image tritium labeling of amino acid binder 200
(45) Stimulus 218 can include light emitted from a lamp, laser, LED, or a chromogenic substrate such as tetramethylbenzidine (TMB). Exemplary stimulus 218 includes laser light such as 30 mW, 488 nm laser light. In an embodiment, stimulus 218 is a photon, e.g., from a light source such as a laser, flash lamp, and the like. In an embodiment, stimulus 218 is a redox potential pulse.
(46) Taggant signal 216 can have a temporal duration suitable for detection by an electrical amplifier, photodetector, scintillator, camera, and the like. In an embodiment, taggant signal 216 is fluorescence emission that is detected, e.g., by a detector such as a microscope that transmits the fluorescence to a CCD camera, wherein the location of emission can be correlated with the intensity of the signal.
(47) In binder complex 228, with regard to indirect attachment of adjunct 236 to amino acid-specific binder 200, intervening member 246 can include a linker to connect adjunct 236 to amino acid-specific binder 200 but that does not provide additional functionality other than linking the two together. Intervening member 246 can be a protein, peptide, chemical moiety, nucleic acid, and the like. Moreover, intervening member 246 can be chemically inert such that it does not interfere with binding or signaling. Exemplary intervening members 264 include a poly-glycine or serine peptide, a polyethylene glycol (PEG), a glycan, an oligonucleotide, and the like. In an embodiment, intervening member 264 includes a GSGG peptide.
(48) Amino acids 209 include binding amino acid 210 and analyte 212 as shown in
(49) Amino acid-specific binder 200 selectively binds to binding amino acid 210 of analyte 212. Analyte 212 can include binding amino acid 210, non-binding amino acid 211, peptide 248, protein 250, or a combination thereof. Exemplary analytes 212 include proteins, peptides, free amino acids, and the like. In an embodiment, analyte 212 includes a protein that is cleaved using trypsin to produce a mixture of analytes 212 including binding amino acids 210 and non-binding amino acids 211.
(50) Amino acid-specific binder 200 selectively binds to binding amino acid 210. Binding amino acid 210 can include certain naturally occurring amino acids, modified naturally occurring amino acids, non-naturally occurring amino acids, or modified non-naturally occurring amino acids. Selective binding of amino acid-specific binder 200 to binding amino acid 210 isolates binding amino acid 210 from other components in a fluid, identifies binding amino acid 210 as a particular species of amino acid (e.g., Phe, Trp, Tyr), and the like.
(51) As used herein, naturally occurring amino acid refers to the 20 naturally occurring amino acids. Binding amino acids 210 that are naturally occurring amino acids are selected from group consisting of phenylalanine, tryptophan, tyrosine, leucine, isoleucine, and valine. As used herein, modified naturally occurring amino acid refers to naturally occurring amino acids in which a sidechain has been modified. Exemplary modifications include methylation, phosphorylation, glycosylation, deamination, oxidation, or selenocysteine formation. Accordingly, binding amino acids 210 that are modified naturally occurring amino acids include phosphotyrosine, N-acetylated valine, kynurenine and the like.
(52) As used herein, non-naturally occurring amino acid refers to amino acids that are not naturally incorporated into peptide or protein polymers but can be synthetically incorporated into a polypeptide. Exemplary non-naturally occurring amino acids are D-amino acids, homo-amino acids, and amino acids with a non-natural sidechain such as biphenylalanine or azidophenylalanine. Accordingly, binding amino acids 210 that are non-naturally occurring amino acids include 5-bromo-tryptophan, homophenylalanine, homophenylalanine methyl ester hydrochloride, and the like.
(53) As used herein, modified non-naturally occurring amino acid refers to a non-naturally occurring amino acid that has been modified. Exemplary modifications include such as methylation, phosphorylation, glycosylation, deamination, oxidation, or selenocysteine formation. Accordingly, binding amino acids 210 that are modified non-naturally occurring amino acids include 5-bromo-tryptophan, homophenylalanine, homopenylalanine methyl ester hydrochloride, and the like.
(54) Amino acid-specific binder 200 does not bind to non-binding amino acid 211. Non-binding amino acid 211 can be a naturally occurring or non-naturally occurring amino acid exclusive of binding amino acid 210. Exemplary non-binding amino acids 211 include arginine, alanine, serine, threonine, proline, aspartic acid, asparagine, glutamine, glutamic acid. Since amino acid-specific binder 200 does not bind to non-binding amino acid 211 but does selectively bind to binding amino acid 210, non-binding amino acid 211 is determined as not belonging to the group of binding amino acids 210 selectively bound by amino acid-specific binder 200. Accordingly, while binding of amino acid-specific binder 200 to binding amino acid 210 can be used to isolate binding amino acid 210 from other components in a fluid, identify binding amino acid 210 as a particular species of amino acid (e.g., Phe, Trp, Tyr), and the like, not binding non-binding amino acid 211 can be used separate non-binding amino acid 211 from binding amino acid 210 and, by negative implication, determine a set of possible identities for binding amino acid 210.
(55) Peptide 248 can include a plurality of amino acids, including binding amino acid 210, non-binding amino acid 211, or a combination thereof. Moreover, amino acids in peptide 248 are arranged to include N-terminal amino acid 220 and C-terminal end 224. Peptide 248 can be naturally occurring or can be a portion of a longer peptide or protein. Exemplary peptides 248 include a peptide from a proteolytic or tryptic digest of an isolated protein or protein found in blood or serum. Binding of amino acid-specific binder 200 to binding amino acid 210 can be used to isolate binding amino acid 210 from other components in a fluid, identify binding amino acid 210 as a particular species of amino acid (e.g., Phe, Trp, Tyr), and the like.
(56) Protein 250 can include a plurality of amino acids, including binding amino acid 210, non-binding amino acid 211, or a combination thereof. Moreover, amino acids in protein 250 are arranged to include N-terminal amino acid 220 and C-terminal end 224. Protein 250 can be obtained from a mixture of proteins as found within a blood or serum sample. In an embodiment, protein 250 includes serum proteins.
(57) In some embodiments, with reference to
(58) Exemplary anchored analyte 226 includes a peptide analyte 212 anchored via the lysine sidechain to an NETS-ester coated glass slide and the like. It is contemplated that attachment of analyte 212 to anchor 222 can include a covalent bond, an ionic bond, electrostatic interaction (e.g., a -cation interaction, dipole-dipole interaction, a multi-pole interaction, and the like), intercalation, a clathrate arrangement (e.g., with analyte 212 partially or wholly trapped in anchor 222 or vice-versa, such that N-terminal amino acid 220 or binding amino acid 210 is exposed to amino acid-specific binder 200 for selectively binding), and the like. Further, analyte 212 can be attached to anchor 222 either directly, indirectly, or a combination thereof. When analyte 212 is directly attached to anchor 222, direct attachment occurs in an absence of an intervening member between analyte 212 and anchor 222. When analyte 212 is indirectly attached to anchor 222, indirect attachment occurs in a presence of the intervening member 246 between analyte 212 and anchor 222.
(59) In an embodiment, anchored analyte 226 includes a peptide analyte 212 anchored via the lysine sidechain to an NETS-ester coated glass slide and the like.
(60) With reference to
(61) In determining a sequence of amino acids in analyte 212 in anchored analyte 226, with reference to
(62) In determining a sequence of amino acids in analyte 212 in anchored analyte 226, with reference to
(63) With reference to
(64) Amino acid-specific binder 200 can be made in various ways. A process for making amino acid-specific binder 200 can include selecting a sequence for amino acid-specific binder 200 and expressing and purifying amino acid-specific binder 200 from an organism or by recombinant formation. A protein can be purified from the organism with a purification technique. Purification can include ion-exchange on a column that includes a cation-exchanger column or anion-exchanger column (e.g., diethylaminomethyl (DEAE) column), a mixedmode ion exchanger (e.g., hydroxyapatite), or column that separates proteins based on hydrophobicity. A protein can be purified by size exclusion chromatography (e.g., gel-filtration) or in a density gradient (such as glycerol). Purification can be performed with binding to a different column that can include a specific chemical characterization of each protein. For recombinant expression in Escherichia coli, purification can be facilitated using a tag such as histidine, maltose binding protein (MBP), glutathione S-transferase (GST), and the like. A gene can be cloned into a pET15b vector with an additional His6-tag at an N-terminus of the protein, followed by a tobacco etch virus (TEV) protease cleavage site (MGHHHHHHENLYFQG (Sequence ID No. 13)), using the NcoI and XhoI restriction sites and expressed in BL21 E. coli cells. Expression from pET vector is induced with 0.5 mM IPTG when optical density at 600 nm (OD.sub.600) reaches 1.0 absorbance units and further incubated for 6 hours at 37 C. or 16 hours at 15 C. Cells are harvested by centrifugation at 5000 g for 20 minutes, and cell pellets can be frozen. Frozen cell pellets are resuspended in a lysis buffer (e.g., 100 mM Tris-HCl, pH 8.0, 300 mM NaCl, 25 mM imidazole, or 50 mM sodium phosphate, 300 mM NaCl, or 20 mM Hepes, pH 8.0, 150 mM KCl) and sonicated on a 500 W sonicator with a C1334 probe at 20% amplitude for a time (e.g., 4 seconds on, 20 seconds off, for 90 minutes) that provides a selected total time (e.g., 15 minutes) of sonication. The lysate is centrifuged (e.g., at 20,000 g for 40 minutes) and then incubated (e.g., for one hour) that can include a chelating fast flow sepharose resin coated with nickel and pre-equilibrated in lysis buffer. The mixture is centrifuged (e.g., at 1000 g for 10 minutes) and supernatant removed, and the resin resuspended in lysis buffer that can be used to form a column. The column is washed with lysis buffer, wash buffer (e.g., lysis buffer with imidazole), and eluted with elution buffer. Protein that is eluted is subjected to dialysis into lysis buffer. Protein is removed from dialysis tubing and centrifuged, and the supernatant concentration measured by Bradford assay against a BSA standard curve. The protein is loaded onto a size exclusion chromatography column pre-equilibrated in lysis buffer. Fractions are collected from the size exclusion chromatography column and monitored at 280 nm, wherein absorption peaks are compared with a standard and analyzed by electrophoresis such as SDSPAGE. Fractions are combined, concentrated by centrifugation with a molecular weight cutoff, such as 10 kDa, centrifuged, and measured by Bradford assay to prepare amino acid-specific binder 200.
(65) In an embodiment, making binder complex 228 includes expressing a fusion protein of amino acid-specific binder 200 and adjunct protein 238 in an organism and purifying the fusion protein from the organism. In an embodiment, making binder complex 238 includes expressing a tagged variant of amino acid-specific binder such that it can be labeled with biotin during expression. The biotin contacts amino acid-specific binder 200 with substrate 240. In an embodiment, making binder complex 238 includes incubating the amino acid-specific binder 200 with an amine reactive chemical moiety such as NETS-ester HRP or taggant such as a fluorophore such as an NHS-ester fluorescein so that the amino-acid specific binder 200 lysine residues are linked to the fluorophore or chemical moiety.
(66) Amino acid-specific binder 200 has numerous advantageous and unexpected benefits and uses. In an embodiment, with reference to
(67) In the process for selectively identifying N-terminal amino acid 220, providing analyte 212 includes purifying or extracting the analyte 212 from a mixture of components that may interfere with subsequent reactions. Exemplary purifications include high performance liquid chromatography (HPLC) or precipitation with ammonium sulfate. A protein can also be digested using a protease such as trypsin to create multiple peptides which can serve as analytes 212. An immobilized trypsin can be used to create multiple peptides by digestion of a protein or serum sample and purification of the peptides from the trypsin.
(68) In the process for selectively identifying N-terminal amino acid 220, contacting C-terminal end 224 of analyte 212 with anchor 222 includes incubating or flowing the C-terminal end 224 of analyte 212 over the anchor 222.
(69) In the process for selectively identifying N-terminal amino acid 220, anchoring C-terminal end 224 to anchor 222 to form anchored analyte 226 includes incubating the C-terminal end 224 with anchor 222 under reaction conditions to covalently link the two. Exemplary reactions would include performing an N-hydroxysuccinimide (NHS)-ester reaction to link the C-terminal amino acid sidechain lysine within analyte 212 with anchor 222 that is modified with an NHS-ester to produce an amide bond.
(70) In the process for selectively identifying N-terminal amino acid 220, contacting N-terminal amino acid 220 of anchored analyte 226 with binder complex 228 includes incubating anchored analyte 226 and binder complex 228 in a reaction buffer for a time (e.g., from 5 sec to 30 min) for the binding reaction to occur based on a binding affinity of amino acid-specific binder 200 under a set of binding conditions (e.g., in 1PBS at 30 C.). When N-terminal amino acid 220 is non-binding amino acid 211, the binding reaction does not occur.
(71) In the process for selectively identifying N-terminal amino acid 220, selectively binding amino acid-specific binder 200 of binder complex 228 to N-terminal amino acid 220 of anchored analyte 226 when N-terminal amino acid 220 includes binding amino acid 210 includes incubating anchored analyte 226 and binder complex 228 in a reaction buffer for a time (e.g., from 5 sec to 30 min) for the binding reaction to occur based on a binding affinity of amino acid-specific binder 200 under a set of a binding conditions (e.g., in 1PBS at 30 C.). When N-terminal amino acid 220 includes binding amino acid 210, the binding reaction occurs.
(72) With reference to taggants and stimulants, signal, and detection listed in Table 1, in the process for selectively identifying N-terminal amino acid 220, subjecting taggant 214 of tagged complex 230 to stimulus 218 includes exposing tagged complex 230 on a fluorescent microscope that provides a select wavelength of light as a stimulant to produce taggant response, wherein an LED can produce excitation at 628 nm as a stimulus.
(73) In the process for selectively identifying N-terminal amino acid 220, producing, by taggant 214 of tagged complex 230, taggant signal 216 in response to stimulus 218 includes, e.g., producing a fluorescent photon.
(74) In the process for selectively identifying N-terminal amino acid 220, detecting taggant signal 216 includes detecting emission with a microscope that includes a detector that detects a selected wavelength of emission, e.g., 692 nm fluorescence.
(75) In the process for selectively identifying N-terminal amino acid 220, identifying N-terminal amino acid 220 based on taggant signal 216 includes analyzing the signal response and interpreting the response based on the experimental design associated with the tagged binder complex 228. In an embodiment, the taggant is a fluorophore with a selected wavelength of emission response that provides a signal for detection through fluorescence intensity at a selected wavelength of the response to identity binding amino acid 210.
(76) With reference to
(77) The process for selectively identifying N-terminal amino acid 220, also can include contacting N-terminal amino acid 220 of anchored analyte 226 with binder complex 228 by incubating anchored analyte 226 and binder complex 228 in a reaction buffer for a time (e.g., from 5 sec to 30 min) for the binding reaction to occur based on a binding affinity of amino acid-specific binder 200 under a set of a binding conditions (e.g., in 1PBS at 30 C.). When N-terminal amino acid 220 includes non-binding amino acid 211, the binding reaction does not occur.
(78) The process for selectively identifying N-terminal amino acid 220, also can include selectively binding amino acid-specific binder 200 of binder complex 228 to N-terminal amino acid 220 of anchored analyte 226 when N-terminal amino acid 220 is binding amino acid 210 to form tagged complex 230 by incubating anchored analyte 226 and binder complex 228 in a reaction buffer for a time (e.g., from 5 sec to 30 min) for the binding reaction to occur based on a binding affinity of amino acid-specific binder 200 under a set of binding conditions (e.g., in 1PBS at 30 C.). When N-terminal amino acid 220 includes binding amino acid 210, the binding reaction occurs, and the tagged complex forms.
(79) The process for selectively identifying N-terminal amino acid 220, also can include subjecting taggant 214 of tagged complex 230 to stimulus 218. In an embodiment, tagged complex 230 is exposed to a selected wavelength and intensity of light to excite the fluorophore. In an embodiment, subjecting taggant 214 of tagged complex 230 to stimulus 218 includes adding a chromogenic substrate. Table 1 lists a taggant, stimulant, signal, and detection for adjuncts shown in Table 2.
(80) The process for selectively identifying N-terminal amino acid 220 also can include producing, by taggant 214 of tagged complex 230, taggant signal 216 in response to stimulus 218. In an embodiment, taggant 214 is a fluorophore that emit light as taggant response at an emission wavelength after being stimulated by an excitation wavelength as the stimulus. In an embodiment, chromogenic substrate produces a chromogenic signal as when contacted by HRP as taggant 214.
(81) The process for selectively identifying N-terminal amino acid 220 also can include detecting taggant signal 216 by methods listed in Table 2 for each taggant. In an embodiment, detection can involve a microscope with a CCD camera and selected filters in an optical system that detects a wavelength of emitted light. In an embodiment, a spectrophotometer measures absorbance at a selected wavelength to detect a chromogenic substrate. In an embodiment, a scintillation counter measures radioactivity of a radiolabeled complex.
(82) TABLE-US-00008 TABLE 2 Adjunct Isolation Technique Separation Property High molecular weight Dialysis Size protein High molecular weight Ultracentrifugation Size protein Substrate Physical Separation binding analytes are anchored Protein with different Precipitation Solubility or solubility Molecular weight Protein with different Isoelectric Gradient Isoelectric point isoelectric point Protein with different Density Gradient Density densities
(83) The process for selectively identifying N-terminal amino acid 220, also can include identifying N-terminal amino acid 220 based on taggant signal 216 by analyzing the signal response and interpreting the response based on tagged binder complex 228. When taggant 214 is a fluorophore, the intensity and wavelength of the taggant response identifies a binding amino acid 210 due to a higher signal than non-binding amino acid 211.
(84) With reference to
(85) The process for selectively identifying N-terminal amino acid 220, also can include converting penultimate residue 234 to N-terminal amino acid 220 when inert residue 232 is removed by continuing the Edman degradation reaction to remove the PITC.
(86) The process for selectively identifying N-terminal amino acid 220, also can include contacting N-terminal amino acid 220 of anchored analyte 226 with binder complex 228 by incubating anchored analyte 226 and binder complex 228 in a reaction buffer for a time (e.g., from 5 sec to 30 min) for the binding reaction to occur based on a binding affinity of amino acid-specific binder 200 under a set of a binding conditions (e.g., in 1PBS at 30 C.). When N-terminal amino acid 220 includes binding amino acid 210, the binding reaction occurs, and the tagged complex forms.
(87) The process for selectively identifying N-terminal amino acid 220 also can include selectively binding amino acid-specific binder 200 of binder complex 228 to N-terminal amino acid 220 of anchored analyte 226 when N-terminal amino acid 220 is binding amino acid 210 to form tagged complex 230 by incubating anchored analyte 226 and binder complex 228 in a reaction buffer for a time (e.g., from 5 sec to 30 min) for the binding reaction to occur based on a binding affinity of amino acid-specific binder 200 under a set of binding conditions (e.g., in 1PBS at 30 C.). When N-terminal amino acid 220 includes binding amino acid 210, the binding reaction occurs and tagged complex 230 forms.
(88) The process for selectively identifying N-terminal amino acid 220, also can include subjecting taggant 214 of tagged complex 230 to stimulus 218 by exposing tagged complex 230 to a selected wavelength and intensity of light to excite the fluorophore. In an embodiment, subjecting taggant 214 of tagged complex 230 to stimulus 218 includes adding chromogenic substrate.
(89) The process for selectively identifying N-terminal amino acid 220 also can include producing, by taggant 214 of tagged complex 230, taggant signal 216 in response to stimulus 218, e.g., by a method listed in Table 1. In an embodiment, detection can include detecting taggant response with a microscope including a CCD camera and filters in an optical system to detect a wavelength of emitted light. In an embodiment, a spectrophotometer measures absorbance at a selected wavelength to detect a chromogenic substrate. In an embodiment, a scintillation counter measures radioactivity of a radiolabeled complex.
(90) The process for selectively identifying N-terminal amino acid 220, also can include detecting taggant signal 216. The process for selectively identifying N-terminal amino acid 220, also can include identifying N-terminal amino acid 220 based on taggant signal 216. In the process, converting N-terminal amino acid 220 to inert residue 232 can include chemically changing N-terminal amino acid 220 prior to producing inert residue 232.
(91) In an embodiment, with reference to
(92) In the process, chemically changing N-terminal amino acid 220 prior to producing inert residue 232 can include phosphorylating free amine 252 of N-terminal amino acid 220.
(93) In an embodiment, with reference to
(94) In the process for selectively isolating analyte 212, separating isolation complex 244 from the fluid can include separating isolation complex 244 based on a size of isolation complex 244 relative to a size of other constituents in fluid by dialysis in which the isolation complex is too large to move through a pore but other constituents that the complex is being isolated from communicate through the pore. In an embodiment, the isolation complex is an immunoglobulin fusion, and analyte 212 is phenylalanine. The complex can be isolated by dialysis through, e.g., a 10 kDa molecular weight cutoff membrane. Separating can include precipitating isolation complex 244 from the fluid, ultra centrifuging in a glycerol gradient and separating the gradient fractions, and the like.
(95) Amino acid-specific binder 200 and processes disclosed herein have numerous beneficial uses, including protein sequencing, peptide fingerprinting, and isolating amino acid analytes. Advantageously, amino acid-specific binder 200 overcomes limitations or technical deficiencies of conventional articles such as the selectivity or specificity for a particular amino acid over similar amino acids. Additionally, amino acid-specific binder 200 has higher affinity combined with high specificity than conventional approaches. As such, amino acid-specific binder 200 can discriminate amino acids for sequencing. Amino acid-specific binder 200 is specific for an N-terminal amino acid rather than an internal residue containing the same amino acid sidechain. Accordingly, amino acid-specific binder 200 determines the identity of the amino acid and a position of the amino acid in a peptide or protein. Additionally, amino acid-specific binder 200 binds a binding amino acid that is not part of a protein or peptide. To circumvent an inability to determine a position of an amino acid (N-terminal, internal, or C-terminal), conventional sequencing or fingerprinting methods rely on a loss of signal if the amino acid being detected is removed from the peptide and interpret a loss of signal at a particular iteration as an indication of position or register within the peptide. A detection scheme that relies on loss of signal is limited when another factor (such as quenching of a signaling fluorophore) also results in a loss of signal. Amino acid-specific binder 200 and tagged complex described herein overcome this limitation by adding a new amino acid-specific binder in each iteration of the sequencing process. By tagging amino acid-specific binder 200 rather than tagging the analyte directly, embodiments herein provide greater signal control and a more universal approach than conventional technology. Embodiments herein produce or detect different types of signals and include a plurality of detection schemes that provide enhanced flexibility in types of substrates and different contexts in which analyte are manipulated.
(96) Amino acid-specific binder 200 and processes herein unexpectedly isolate analytes from a composition that includes the analyte disposed in a fluid that also includes other constituents such as amino acids, proteins, and the like. Due to the ability to anchor either the analyte or the amino acid-specific binder, the reagent can be used in many different separation processes in addition to sequencing processes.
(97) The articles and processes herein are illustrated further by the following Example, which is non-limiting.
EXAMPLE
(98) Enhanced N-Terminal Amino Acid Binding
(99) One of the central challenges in the development of single-molecule protein sequencing technologies is achieving high-fidelity, sequential recognition and detection of specific amino acids that comprise the peptide sequence. An approach towards achieving this goal is to leverage naturally occurring proteins that function through recognition of amino (N)-terminal amino acids (NAAs). One such protein, the N-End Rule Pathway adaptor protein ClpS, natively recognizes NAAs on a peptide chain. The native ClpS protein has a high specificity albeit modest affinity for the amino acid Phe at the N-terminus but also recognizes the residues Trp, Tyr, and Leu at the N-terminal position. This Example describes directed evolution methods to select for ClpS variants with enhanced affinity and selectivity for two NAAs (Phe and Trp). Two variants of Agrobacterium tumefaciens ClpS protein with native residues 34-36 ProArgGlu were mutated to ProMetSer and CysProSer. In vitro surface binding assays indicate that the ProMetSer variant had enhanced affinity for Phe at the N-terminus with 7-fold tighter binding relative to wild-type ClpS, and that the CysProSer variant selectively bound to Trp over Phe at the N-terminus while having a greater affinity for both Trp and Phe. Accordingly, engineering ClpS provides an amino acid-specific binder for peptide sequencing.
(100) Methods for high-throughput detection and quantification of single or low-abundant proteins in mixtures overcome an unmet need that spans proteomics, synthetic biology, and precision medicine. In 2014, a preliminary draft of the human proteome contained 86% of the known proteins based on predicted open reading frames (ORFs) from the genomic data available at this time. However, due to discrepancies in genomic ORF annotation in which short ORFs or genes with internal initiation sites are often miss-annotated, this number is somewhat of a moving target. As of 2017, 18% of proteins were still considered missing as per Human Proteome Project metrics. While next-generation DNA sequencing technologies have enabled reductions in cost and time for nucleotide sequencing over the past decade that dramatically advanced genomic research, the field of proteomics has seen steadier, but modest advances towards throughput and completeness in proteome analysis. Similar to the effect that disruptive technologies have had on DNA sequencing, progress in proteomic research could be propelled forward dramatically with analogously disruptive advances in technologies for peptide and protein sequencing. In this respect, methods developed for oligonucleotide sequencing could provide a theoretical framework for next-generation protein sequencing technologies. However, technical challenges exist for directly interrogating amino acid residues as opposed to nucleotides. First, there are twenty possible amino acids per position in the peptide chain in comparison to only four nucleotides in an oligonucleotide. Second, post-translational modifications of amino acids, and N-terminal acetylation will ultimately need to be accounted for, just as in DNA sequencing epigenetic features such as methylation can also be detected with bisulfite sequencing. Finally, the unique chemical moieties present on each amino acid sidechain present different and perhaps more difficult challenges when it comes to distinguishing them than is the case for the different nitrogenous bases of DNA.
(101) A natural resource for an amino acid recognition reagent is proteins that are used in cells to detect or interact specifically with a particular amino acid or post-translationally modified amino acid. For example, there are twenty tRNA synthetases, which are each highly specific for one of the twenty amino acids. Additionally, many proteases are able to uniquely identify a target amino acid and cleave before or after that residue on a peptide chain. However, a new method for detecting amino acids, in the context of sequencing, should be coupled with the ability to identify the location of that amino acid on the peptide chain. Therefore, an amino acid-binding protein, here amino acid-specific binder, is selective for an amino acid at a structurally unique chain position, such as the N-terminus of a peptide and can be a sequencing reagent. The amino acid-specific binder provides positional information of the amino acid to be directly coupled to the binding event used to detect that amino acid.
(102) The N-End Rule Pathway functions to degrade proteins in cells as part of a regulated process for maintaining protein homeostasis. In general, the bacterial system consists of adaptor and chaperone proteins that specifically recognize the proteins to be degraded and can unfold and deliver them to a protease core for destruction, or in organisms such as yeast, which contain a ubiquitin pathway, the targeted protein may be ubiquitylated on a lysine residue and then degraded. In eukaryotes, the pathway depends on different N-terminal amino acids (NAAs) than the subset utilized in the bacterial N-End Rule Pathway. In bacteria, for example, the Clp protease that performs the degradation interacts with different chaperones divided into Class I (ClpA, ClpC, ClpD, or ClpE) or Class II (ClpX, ClpY) among different systems from proteobacterian, actinobacteria, or cyanobacteria. This pairing leads to a convenient nomenclature to describe the protease core complex (e.g., ClpAP or ClpXP). An adaptor protein in bacteria, ClpS, interacts with some Class I chaperones and is functionally an N-recognin, as it specifically recognizes the substrate to be degraded through an N-degron tag.
(103) ClpS provides a scaffold from which to develop an amino acid-specific binder (also referred to here as amino acid-binding reagent) for protein sequencing. It is a gatekeeper of the specificity of this protein degradation machinery in many organisms. ClpS and homologous domains such as one of the UBR-box (E3 ligase) N-recognin domains exist in bacteria, yeast, mammals and plants and target different N-degron tags with either type 1 (Arg, Lys, or His) or type 2 (Tyr, Phe, Trp, or Leu) destabilizing residues. The N-degron tags that ClpS proteins from bacteria recognize are sequences containing the type 2 N-terminal primary destabilizing residues. Moreover, cyanobacteria contain two different ClpS protein paralogues, which interact with different types of Clp protease cores, and exhibit different specificity. Similarly, -proteobacteria contain two different ClpS proteins, presumably to achieve enhanced control over which N-degron containing substrates are targeted for degradation by fine-tuning the expression levels of the ClpS adaptors. In addition to wide natural variation in substrate recognition sequences, ClpS can be engineered for new specificity. For example, it was evolved for use in a post-translational proofreading system to detect non-standard amino acids such as p-acetyl-phenylalanine. Finally, the ClpS protein family has the advantages of being relatively small (MW13 kDa) and having no native proteolytic or enzymatic activity that would be unnecessary and potentially complicating in the context of a protein sequencing application.
(104) Based on previous studies, Plasmodium falciparum ClpS protein and the ClpS2 of Agrobacterium tumefaciens were selected as starting scaffolds for protein engineering of the amino acid-specific binder. The P. falciparum ClpS protein has enhanced affinity for the NAA Phe (Kd=600 nM) compared to other ClpS proteins studied to date. The second residue from the N-terminus affects binding affinity. The P. falciparum ClpS protein recognizes isoleucine unlike other homologs. The A. tumefaciens ClpS2 protein has the drawback of lower overall affinities, but the advantage of higher specificity for Phe when compared to Tyr, Trp, and Leu. Therefore, both of these proteins were chosen as starting points for a directed evolution for selecting mutants with higher affinity and selectivity for target NAAs to demonstrate the utility of the ClpS family of proteins for development of NAA binding reagents (NAABs).
(105) With regard to plasmid construction, wild-type P. falciparum ClpS gene was cloned into the pET15b vector with an additional His6-tag at the N-terminus of the protein, followed by a TEV protease cleavage site, using the NcoI and XhoI restriction sites. The A. tumefaciens ClpS gene was amplified from genomic DNA, strain GV3101 from the C58 chromosomal background and cloned into the pET15b vector in the same manner. Both genes were cloned into the pCTCON2 vector for yeast display by amplifying the gene by polymerase chain reaction (PCR) with primers to add the NheI and BamHI sites, and then ligating this to the vector such that the gene is located to the C-terminal end of the aga2-encoding gene, separated by a factor XA cleavage site, an HA-tag and a [GGGGS (Sequence ID No. 14)]3 spacer. There is also a C-terminal myc-tag before the stop codon. A vector was also created that contains no gene insert, but rather a SacII site and a SpeI site, so that the vector can be linearized at this site for homologous recombination.
(106) With regard to random mutagenesis library creation, to create the random mutagenesis libraries, error-prone PCR was used. The gene encoding the ClpS protein of interest was amplified using the HA-tag for (CCATACGACGTTCCAGACTAC (Sequence ID No. 15)) and T7 (TAATACGACTCACTATAGGG (Sequence ID No. 16)) primers in a reaction containing 0.2 mM dATP, 1 mM dCTP, 0.2 mM dGTP, 1 mM dTTP, 10 mM MgCl.sub.2, and 0.5 mM MnCl.sub.2, Taq reaction buffer (20 mM Tris-HCl, pH 8.4, 50 mM KCl) without MgCl.sub.2, and Taq DNA polymerase. The PCR product was used for homologous recombination, as described below. The libraries each contained at least 1 million nave members, and greater than 50% of the colonies contained at least one mutation from the ten colonies sequenced.
(107) With regard to Saccharomyces cerevisiae (yeast) transformation, EBY100 strain S. cerevisiae were transformed with pCTCON2 plasmids containing the wild-type ClpS genes using the Frozen EX Yeast Transformation II kit and subsequently grown on selective media as the pCTCON2 plasmid harbors the ability to synthesize tryptophan. Synthetic dextrose media supplemented with casamino acids lacking tryptophan (SD-CAA) and containing 100 g/mL ampicillin was used to grow all the yeast used in this study. Protein surface expression was induced by resuspending the cells in synthetic galactose media supplemented with casamino acids lacking tryptophan (SG-CAA).
(108) With regard to site-saturation library creation/homologous recombination in yeast, EBY100 S. cerevisiae cells were grown overnight to an OD.sub.600 of 3 in YPD media at 30 C. This was used to inoculate a 100 mL culture of YPD to OD.sub.600 0.3. After 5 hours, when cells had grown to OD.sub.600 1.0, the cells were transferred to 50 mL conical tubes and centrifuged at 3000 g for 3 min at 4 C. The cell pellet was washed twice with 50 mL ice cold sterile water and then washed once with 50 mL ice cold electroporation buffer (1M sorbitol/1 mM CaCl.sub.2)). The cells were conditioned for electroporation by resuspending the cell pellet in 20 mL 0.1 M LiAc, 10 mM DTT and shaking for 30 min at 30 degrees. The cells were centrifuged as above and washed with 25 mL per tube of electroporation buffer before being resuspended in 200 L of electroporation buffer to reach a final volume of about 1 mL. Cells were kept on ice until electroporation.
(109) For electroporation, 400 L of competent cells prepared as above were incubated with the vector and insert, in a 1:3 ratio, and kept on ice for 5 minutes. The vector used was the pCTCON2 plasmid described above containing the ClpS gene of interest and digested within the clpS gene with the restriction enzyme Alel. The insert used was the error prone PCR library obtained as described above or the NNK primer
(110) TABLE-US-00009 (SequenceIDNo.17) (TAAGCTCTACAAGGTCATGCTGCTGAATGACGACTATACGNNKNNKNNK TTTGTCACCGGTGTGCTGAAGGCCGTCTTTCGCATGAGCG,)
for the site-saturation library. The cells were then transferred to a 0.2 cm electroporation cuvette and electroporated on the pre-set yeast settings (1.5 kV, 25 g). The cells were transferred to a tube containing 4 mL of YPD media and 4 mL of 1 M sorbitol and incubated at 30 C. for 1 hour, 225 rpm. The cells were then centrifuged and resuspended in SD-CAA media and dilutions were plated to calculate library size, and the rest was grown in a flask containing 250 mL of SD-CAA media and passaged once before selections or sorting.
(111) With regard to library selection, magnetic-activated cell sorting (MACS) and fluorescence-activated cell sorting (FACS) were performed using slightly modified protocols from the 2003 Pacific Northwest National Lab Yeast Display ScFV Antibody Library User's Manual and 2004 Methods in Molecular Biology Flow Cytometry Protocols. Yeast displaying a library of mutant ClpS proteins were grown in SD-CAA media overnight at 30 C. until the OD.sub.600 nm was approximately 4.0. The yeast was used to inoculate a fresh culture at an OD.sub.600 nm of 1.0 in a mixture of 80% SG-CAA/20% SD-CAA and incubated for 24 hours at 20 C. Approximately 109 yeast were washed and resuspended in 1 mL of Dulbecco's phosphate buffered saline containing 0.5% bovine serum albumin (PBS/BSA) (DPBS) containing 10 M biotinylated peptide at room temperature for 1 hour. The yeast was pelleted by centrifugation at 3000 g for 2 minutes. The supernatant was decanted to remove excess peptide and the pelleted yeast resuspended with 100 L of streptavidin coated or anti-biotin coated magnetic beads and flowed over a MACs column.
(112) After two rounds of MACs selection, the library was sorted by flow cytometry. The cells were induced to express surface-displayed protein as described above and then incubated with biotinylated peptide in different concentrations, streptavidin-R-phycoerythrin (PE), and anti-myc AF647 overnight at room temperature. A typical reaction contained 100 L of cells (containing approximately 106 cells), 10 L of peptide at a concentration between 10 nM to 10 M, and 25 L of a master mix containing 2 L of an anti-myc antibody, 4 L of the SAPE (streptavidin, R-phycoerythrin conjugate1 mg/mL) and 19 L of PBS/BSA for each sample.
(113) Cells were washed with PBS/BSA and sorted using a FACS Aria cytometer and collected in 1 mL of SD-CAA media. The number of cells that bound the peptide improved with each round and were sorted with sequentially lower concentrations of peptide to increase the stringency of the selection. In general, eight to sixteen colonies were sequenced from the sorted libraries after the fourth and fifth rounds of selection.
(114) With regard to peptides, all peptides are named by indicating the first two residues, with the full sequence available in Table 3. All of the peptides had one of two sequences for the C-terminal end of the peptide, either XDEDLE (Sequence ID No. 18) or XGVECK (Sequence ID No. 19), where the N-terminal amino acid is varied on a particular peptide scaffold. The X1G2 peptides also contained a biotin linked via the lysine side chain on the C-terminal residue. X1G2 peptides started from a lyophilized form. Peptides were resuspended in 1DPBS and diluted to the appropriate concentration into the experiment buffer. The X1D2 peptides were synthesized in-house on a 20 mol scale on a peptide synthesizer with amino acid reagents and biotin resin. Synthesis resulted in a peptide with an ethylene diamine spacer and then the biotin moiety. The peptide was then cleaved from the resin using 3 mL of trifluoroacetic acid (TFA), phenol, water, and triisopropylsilane (TIPS) in an 88:5:5:2 ratio. The peptide was subsequently rinsed with ice cold ether, pelleted by centrifugation at 4500 g for 10 min at 4 C. and decanted three times. It was then dried under nitrogen overnight at room temperature and subsequently lyophilized and stored at 20 C. until resuspension in the assay buffer.
(115) TABLE-US-00010 TABLE 3 NAME SEQUENCE X.sub.1D.sub.2 XDEDLE-biotin X.sub.1F.sub.2 XFDEDLE-biotin X.sub.1G.sub.2 XGVECK-biotin WILD-TYPE (WT) A. tumefaciens ClpS2 [Pro.sub.34 Arg.sub.35 Glu.sub.36] VARIANT 1 (V1) A. tumefaciens ClpS2 [Pro.sub.34 Met.sub.35 Ser.sub.36] VARIANT 2 (V2) A. tumefaciens ClpS2 [Cys.sub.34 Pro.sub.35 Ser.sub.36] VARIANT 3 (V3) A. tumefaciens ClpS2 [Cys.sub.34 Ser.sub.35 Trp.sub.36]
(116) With regard to protein purification, the wild-type and mutant ClpS proteins were expressed in BL21 Escherichia coli cells. Expression of wild-type and ProMetSer mutant proteins was induced with 0.5 mM IPTG when the OD.sub.600 nm reached 1.0 and incubated for 6 hours at 37 C. The cells expressing the CysProSer and CysSerTrp mutants were removed from the 37 C. incubator and cooled to 15 C. when the OD.sub.600 nm reached 0.5, then induced with 0.5 mM IPTG when the OD.sub.600 nm reached 1.0 and grown for 16 hours at 15 C. The cells were harvested by centrifugation at 5000 g for 20 minutes, and the cell pellets frozen for future use.
(117) Frozen cell pellets were resuspended in lysis buffer (100 mM Tris-HCl, pH 8.0, 300 mM NaCl, 25 mM imidazole), and sonicated with a probe at 20% amplitude for 4 seconds on, 20 seconds off, for 90 minutes, which results in 15 minutes total sonication time. The lysate was centrifuged at 20000 g for 40 minutes and then incubated for one hour with chelating fast flow sepharose resin coated with nickel and pre-equilibrated in lysis buffer. The mixture was centrifuged at 1000 g for 10 minutes and then the supernatant removed, and the resin resuspended in 5 mL lysis buffer and used to form a column. The column was then washed with 10 column volumes (CVs) of lysis buffer, and then 5 CVs of wash buffer (100 mM Tris-HCl, pH 8.0, 300 mM NaCl, 75 mM imidazole), before eluting with 5 CVs of elution buffer (100 mM Tris-HCl, pH 8.0, 300 mM NaCl, 250 mM imidazole). The eluted protein was then dialyzed using 10 kDa molecular weight cutoff (MWCO) dialysis tubing into 50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 1 mM DTT, 5% glycerol. Each dialysis was performed for >12 hours, for a total of 3 times. The protein was removed from dialysis tubing, centrifuged 40 minutes at 20,000 g, and the supernatant concentration measured by Bradford assay against a BSA standard curve. The protein was then loaded onto a S200 26/60 size exclusion chromatography column pre-equilibrated in 2CV of 50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 5% glycerol, 1 mM DTT. 5 mL Fractions were collected and tracked at 280 nm; peaks were compared with a gel filtration standard and further analyzed by SDS-PAGE. Fractions were combined, concentrated by ultra-centrifugation with a 10 kDa MWCO, centrifuged for 40 minutes at 20,000 g, and measured by the Bradford assay.
(118) The thermal stability of the variants was assessed. Each variant was loaded in 3PBS at approximately 1 mg/mL concentration in capillary tubes and the intrinsic protein fluorescence recorded at 330 nm and 350 nm while heating the sample over a 35-95 C. at a rate of 30 C. per minute.
(119) With regard to yeast or peptide pull-down assay, a colorimetric pull-down assay was used to screen the FACS selected library variants with different peptide substrates in a high-throughput manner and determine the optimal candidates for in vitro characterization. Yeast displaying the library variants of interest were grown to saturation in SD-CAA media and transferred to SG-CAA media for surface expression at 20 C. for 24 hours. The cultures were pelleted at 3000 g for 2 minutes and washed with PBS, 0.5 mg/mL BSA, 0.1% ELISA buffer and diluted to OD.sub.600 nm=2.5. A UV-transparent 96-well flat-bottomed polystyrene plate was pre-blocked with 1 mg/mL BSA and washed with ELISA buffer. 10 L of diluted cells were added to the wells and mixed with 90 L of 1 g/mL biotinylated peptide substrate in ELISA buffer. The mixture plate was incubated in a benchtop orbital shaker for 1 hour, then centrifuged at 3000 g to pellet the yeast cells bound to peptide and wash the excess peptide away by washing three times with 100 L of buffer. The cells were resuspended in 100 L of buffer with 1 g/mL of streptavidin-HRP. Incubation and wash steps were repeated. Cells were resuspended in a final volume of 50 L buffer and 50 L of 1 tetramethylbenzidine was added to the wells. Reactions were incubated for 20 minutes at room temperature for oxidation of the TMB by horseradish peroxidase (HRP), which produces a blue coloration. Reactions were then quenched by adding 100 L of 1M HCl, which produces a yellow color that can be measured by the absorbance at 450 nm. The intensity is a function of the amount of streptavidin-HRP pulled down by interaction with the yeast cells, facilitated by biotinylated peptide binding to surface-expressed ClpS.
(120) Each sample was measured in triplicate within the same row of the 96 well plate, allowing for four ClpS/substrate pairs per row, with the standard deviation of Abs 450 nm taken as the error. Fluid was added to rows using a 12-channel hand pipette. In assays, when testing a single library variant against a panel of peptides, wells 1 through 3 were empty as a check for artifacts; peptide was added to wells 4 through 6; wells 7 through 9 had peptide and uninduced yeast, and wells 10 through 12 had peptide and yeast. As the background in lanes 1 through 9 showed no increase in background absorbance from the peptide or media, the data displayed here is the average and standard deviation of lanes 10 through 12, except for the data labeled no yeast, which is lanes 4 through 6.
(121) With regard to surface plasmon resonance (SPR), SPR data was collected by loading a streptavidin chip with the target biotinylated peptides in each of the four channels, and then flowing the protein over the chip at each concentration for 180 seconds before washing with 50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 1 mM DTT, 5% glycerol buffer for 180 seconds. The SPR assays for all variants were performed under the above optimized buffer conditions to obtain the greatest binding activity, as the activity and stability of ClpS is pH, and NaCl concentration dependent. Additionally, the wild-type and mutant proteins purify as dimers that can be disrupted by the addition of DTT, indicating they are likely disulfide-linked with different homologs of ClpS having different propensities for dimerization. The four channels were used such that the negative control peptide (A1G2) was in channel 1, F1G2 in channel 2, W1G2 in channel 3, and Y1G2 in channel 4. The negative control peptide channel was used as a baseline for subtraction, which accommodates both any non-specific binding and refractive index change. A steady state response at each concentration was plotted and fit to calculate the KD, while the resonance units vs. time was used to calculate a koff for each mutant protein with each peptide.
(122) With regard to directed evolution of ClpS, random mutagenesis and screening was used to select proteins with higher affinity binding to the target NAA. In subsequent steps, specific residues were determined from initial screens with a targeted mutagenesis step. An error-prone PCR approach was applied to broadly and randomly mutagenize both the P. falciparum clpS gene and the A. tumefaciens clpS2 gene. We then performed homologous recombination into a yeast display vector such that the gene of interest was fused to the C-terminal end of the aga2 gene for display. The displayed proteins also contained a C-terminal myc-tag that could be used for detection as shown in
(123) With regard to characterization of yeast-displayed ClpS mutant proteins, we designed a pull-down assay to screen the FACS-selected hits against many different NAA containing peptides in high-throughput. As shown in panel A of
(124) Regarding characterization of the ClpS mutant protein binding kinetics, for peptide sequencing via some recently proposed methods reagents can bind peptides affixed to a surface. Two A. tumefaciens ClpS2 protein variants (V2, described above, and V1) were expressed and purified from E. coli. V2 was not as thermally stable as the wild-type and V1. The binding properties of each variant were analyzed using surface plasmon resonance (SPR). Since the SPR chip has four channels, we chose three peptides ending in the residues that are the most commonly recognized by the wild-type ClpS proteins (Phe, Trp, Tyr) and a negative control (Ala). The summary of the SPR data is displayed in Table 4, where the steady state values of the KD are calculated from the experiments performed using concentrations ranging from 0 to 50 M of protein for each variant.
(125) TABLE-US-00011 TABLE 4 K.sub.D (M) Variant Phe Trp Tyr WT 13.0 0.6 18.4 0.4 63.0 4.0 V1 1.8 0.4 13.1 1.3 11.6 1.2 V2 3.7 0.3 2.8 0.3 36.1 4.4 Selectivity for Phe Variant Phe/Phe Phe/Trp Phe/Tyr WT 1.0 0.71 0.21 V1 1.0 0.14 0.16 V2 1.0 1.32 0.10 Selectivity for Trp Variant Trp/Phe Trp/Trp Trp/Tyr WT 1.42 1.0 0.29 V1 7.28 1.0 1.13 V2 0.76 1.0 0.08 Selectivity for Tyr Variant Tyr/Phe Tyr/Trp Tyr/Tyr WT 4.86 3.43 1.0 V1 6.43 0.88 1.0 V2 9.82 12.91 1.0
(126) The association curves for V2 with each peptide ending in Phe, Trp, or Tyr, are given in panel A of
(127) The SPR experiment gives steady-state KD and on- and off-rates. A contribution to improved KD resulted from a slower off-rate for the mutant proteins. From SPR sensorgrams shown panel B of
(128) TABLE-US-00012 TABLE 5 K.sub.OFF (SEC.sup.1) VARIANT Phe Trp Tyr WT 0.93 1.32 1.16 V1 0.1 0.76 0.5 V2 0.03 0.03 0.05
(129) In addition to advancing the field of proteomics, rapid protein or peptide sequencing facilitates protein engineering by eliminating the conventional maintenance of a genotype-phenotype linkage, as is fulfilled by using yeast or phage display. Similarly, in combinatorial peptide drug library screening, the ability to sequence peptides eliminates conventional barcoding. Currently, there is no single molecule protein sequencing technology available. For example, FRET pairs are being used to tag residues and detect amino acids in a technique called single-molecule peptide fingerprinting that can be applied when the peptide is translocated through the Clp protease molecular machinery attached to a surface. In an alternative approach, the ionic current fluctuation pattern within nanopores can be detected to directly discriminate between different groups of amino acids. Engineered nanopores can also be used as a potential way to cleave a single amino acid, and, combined with mass spectrometry, identify that amino acid. Additionally, it has been proposed that partial sequencing, or fluorosequencing can be accomplished by immobilizing a peptide to a surface such that single-molecule fluorescence can be measured. In this measurement modality, the fluorescence detection can be accomplished by either chemically modifying the amino acids based on their unique side chain chemistry, or by using a fluorescently labeled amino acid binding reagent. The approach of chemical modification has been successfully employed to detect cysteine and lysine residues. The specificity and affinity requirements of a potential NAAB is dependent on the limits of detection of the technology being employed, however some groups are exploring the theoretical limitations to which lower affinity NAABs can still potentially be useful reagents.
(130) This work shows that NAABs that are enhanced in specificity and affinity for some NAAs can indeed be engineered from ClpS proteins, which natively recognize some NAAs, using directed evolution and yeast-based FACS screening methods. The initial directed evolution design targeted all of the ClpS residues in a random fashion, rather than relying on structural insights into the exact location of the binding pocket. However, many of the residues that were ultimately found to be mutated were indeed in or near the binding pocket and recapitulate properties that could perhaps have been rationally designed from critical assessment of the crystal structures available in the literature. The strategy of targeting the residues that frequently occurred after the first set of selections with a more in depth, focused library testing each of the 20 residues at these positions resulted in more hits during subsequent rounds of selection. However, there is still the possibility of evolving these proteins further, for enhanced selectivity and affinity for the Trp or Phe NAAs, or for other amino acid targets such as Tyr and Leu, by combining the mutations found in this work with those that may be found among the different homologs in the literature with known differences in specificity. Additionally, in a peptide sequencing context, ideally the second amino acid must not significantly affect the binding of the NAAB or false positives could occur. The finalized NAAB reagents will ultimately need to be characterized against a panel of peptides to ensure that the neighboring sequence does not affect the sequencing fidelity, as has been done for the some of the wild-type ClpS proteins. Although there is a significant amount of characterization of this family of proteins in the literature, it has previously been studied in ways which focus on the properties of ClpS that contribute to the selection of substrates for degradation within a cell. As with any engineering effort, one must strive to understand as much as possible about a system in order to engineer it to perform a new or different task. From the standpoint of using ClpS homologs as potential tools or binding reagents, the criteria and attributes by which protein engineers assess this protein are beginning to evolve. For instance, assessing the ability of ClpS to bind non-standard amino acids that it would not normally encounter in nature contributed to the use of the protein to detect non-standard amino acid incorporation. In this Example, the finding that the ClpS mutants with higher NAA target affinities are driven by reduced rates of dissociation (koff) is encouraging from a binding reagent standpoint. It poises these mutant proteins as binding reagents for NAA detection in fluorescence based sequencing technologies as the slowed rate of dissociation provides a longer residence time for fluorescence-based imaging of the NAAB.
(131) SPR experiments were performed with the peptide affixed to a surface and showed that ClpS binds peptides in a surface-attached configuration (also referred herein as anchoring). The yeast display system provides efficient activity in vitro in the surface adhered peptide context, fluorescent labeling, and stability to the length of incubation times, temperatures, and buffer conditions involved in sequencing detection.
(132) While one or more embodiments have been shown and described, modifications and substitutions may be made thereto without departing from the spirit and scope of the invention. Accordingly, it is to be understood that the present invention has been described by way of illustrations and not limitation. Embodiments herein can be used independently or can be combined.
(133) All ranges disclosed herein are inclusive of the endpoints, and the endpoints are independently combinable with each other. The ranges are continuous and thus contain every value and subset thereof in the range. Unless otherwise stated or contextually inapplicable, all percentages, when expressing a quantity, are weight percentages. The suffix (s) as used herein is intended to include both the singular and the plural of the term that it modifies, thereby including at least one of that term (e.g., the colorant(s) includes at least one colorants). Optional or optionally means that the subsequently described event or circumstance can or cannot occur, and that the description includes instances where the event occurs and instances where it does not. As used herein, combination is inclusive of blends, mixtures, alloys, reaction products, and the like.
(134) As used herein, a combination thereof refers to a combination comprising at least one of the named constituents, components, compounds, or elements, optionally together with one or more of the same class of constituents, components, compounds, or elements.
(135) All references are incorporated herein by reference.
(136) The use of the terms a and an and the and similar referents in the context of describing the invention (especially in the context of the following claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context. Or means and/or. It should further be noted that the terms first, second, primary, secondary, and the like herein do not denote any order, quantity, or importance, but rather are used to distinguish one element from another. The modifier about used in connection with a quantity is inclusive of the stated value and has the meaning dictated by the context (e.g., it includes the degree of error associated with measurement of the particular quantity). The conjunction or is used to link objects of a list or alternatives and is not disjunctive; rather the elements can be used separately or can be combined together under appropriate circumstances.