POPTAG PEPTIDE AND USES THEREOF
20230044825 · 2023-02-09
Inventors
- Keren Lasker (Palo Alto, CA, US)
- Steven Boeynaems (Stanford, CA, US)
- Aaron David Gitler (Foster City, CA, US)
- Lucy Shapiro (Palo Alto, CA, US)
Cpc classification
C12P21/02
CHEMISTRY; METALLURGY
International classification
Abstract
Proteins and fusion proteins for forming merbraneless droplets in cells are provided. Described herein, is the development of a protein, named PopTag, that drives phase separation when it is part of a chimeric fusion protein. PopTag is engineered from the PopZ protein, found in a-proteobacteria (including Caulobacter crescentus). Despite PopZ being exclusively found in this clade of bacteria, the PopTag can drive protein phase separation in other prokaryotes (e.g., E. coli) and eukaryotes (e.g., human cells).
Claims
1. A fusion protein comprising an amino acid sequence linked to a polypeptide sequence comprising SEQ ID NO: 1, or a variant thereof as set forth in Table 1, wherein the amino acid sequence is heterologous to the polypeptide sequence.
2. The fusion protein of claim 1, wherein the polypeptide sequence is at least 95% identical to SEQ ID NO: 1.
3. The fusion protein of claim 1, wherein the amino acid sequence is an epitope-binding polypeptide.
4. The fusion protein of claim 3, wherein the epitope-binding polypeptide comprises an immunoglobulin heavy chain variable region.
5. The fusion protein of claim 4, wherein the epitope-binding polypeptide is a single domain antibody or a single-chain variable fragment (scfv).
6. The fusion protein of claim 1, wherein the amino acid sequence is a target-binding polypeptide.
7. The fusion protein of claim 1, wherein the amino acid sequence comprises a fluorescent protein.
8. The fusion protein of claim 1, wherein the amino acid sequence comprises an enzyme.
9. A polynucleotide comprising a nucleic acid sequence that encodes the fusion protein of claim 1.
10. The polynucleotide of claim 9, comprising a promoter operably linked to the nucleic acid sequence.
11. (canceled)
12. A cell comprising a polynucleotide encoding the fusion protein of claim 1, wherein the cell expresses the fusion protein.
13. The cell of claim 12, wherein the cell is a eukaryotic cell.
14. The cell of claim 13, wherein the eukaryotic cell is a mammalian cell.
15. The cell of claim 13, wherein the eukaryotic cell is a plant or yeast cell.
16. The cell of claim 12, wherein the cell comprises: a. a first polynucleotide encoding a first fusion protein and; b. a second polypeptide encoding a second fusion protein, wherein the first fusion protein and the second fusion protein comprise a polypeptide sequence comprising SEQ ID NO: 1 or a variant thereof as set forth in Table 1 and comprise different heterologous amino acid sequences.
17. The cell of claim 16, wherein the different heterologous amino acid sequences are different enzymes.
18. A method of purifying a product from a cell, the method comprising, expressing in the cell the fusion protein of claim 1, wherein the fusion protein forms compartments in the cell; optionally performing a reaction in the compartments to form the product; lysing the cell; and isolating the compartments from cell lysate material, wherein the compartments comprise the product, thereby purifying the product from the cell.
19. The method of claim 18, wherein the product is formed by performing a product in the compartments.
20. The method of claim 19, wherein the amino acid sequence comprises an enzyme and the enzyme catalyzes production of the product.
21. The method of claim 18, wherein the cell produces the product and the amino acid sequence comprises a binding polypeptide that binds the product, thereby binding the product to the compartment.
22-23. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
DETAILED DESCRIPTION OF THE INVENTION
[0026] The inventors have discovered active fragments of the PopZ bacterial protein family that are capable of forming cellular compartments (membraneless organelles) and surprisingly can form them when expressed in eukaryotic cells. Moreover, it has been discovered that the active fragments can be fused with a heterologous polypeptide sequence to generate a number of beneficial functionalities.
[0027] Active fragments of the PopZ protein (the full-length of which is found in α-proteobacteria (e.g., Caulobacter crescentus)) have been discovered. For example, the following peptide (referred to as “PopTag”) has been discovered to form membraneless organelles when expressed in prokaryotic or eukaryotic cells:
TABLE-US-00001 (SEQ ID NO: 1) EVAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEW LDQNLPRIVETKVEEEVQRISRGRGA.
[0028] A large number of PopZ domains are known. For example a listing of PopTag protein domain from other bacterial species is provided at the end of this application (SEQ ID NO:4-149). Any of these sequences or substantially identical variants thereof can form a polypeptide corresponding to SEQ ID NO:1 and can be used as described for the PopTag polypeptide. By comparing a number of different PopZ proteins from various species, the following variants of SEQ ID NO:1 (also considered “PopTag” proteins) have been determined:
TABLE-US-00002 TABLE 1 1 E Q; H; K; D; 2 V A; E; D; G; F; L; M; L; N; Q; P; S; R; T; Y; 3 A E; D; G; N; Q; P; S; R; T; V; 4 E A; D; G; H; K; M; L; N; Q; P; S; R; T; 5 Q A; E; D; G; F; H; K; M; L; N; P; S; R; T; V; 6 L A; E; D; I; M; N; Q; P; R; V; 7 V A; E; D; G; F; L; M; L; P; S; T; 8 G A; E; D; I; —; L; N; S; T; V; 9 V A; E; D; G; E; L; H; K; —; M; L; N; Q; P; S; R; T; 10 S A; E; D; G; F; I; H; K; —; M; L; N; Q; P; R; T; V; 11 A E; G; I; K; —; N; Q; P; S; R; T; V; 12 A C; E; D; G; F; I; H; K; —; M; L; N; Q; P; S; R; T; V; 13 S A; E; D; G; F; I; H; K; —; M; L; N; Q; R; T; V; 14 A C; E; D; I; H; K; —; M; L; N; Q; S; R; T; V; X; 15 A E; G; F; L; —; M; L; Q; S; T; V; X; 16 A E; D; G; F; I; H; K; —; M; L; N; Q; S; R; T; V; Y; X; 17 S A; E; D; G; H; K; —; L; N; Q; R; T; V; 18 A G; I; H; K; —; M; L; N; Q; P; S; R; T; V; Y; 19 F A; G; I; M; L; S; R; V; Y; 20 G A; E; D; F; H; K; M; L; N; Q; P; S; R; T; V; 21 S A; E; D; G; F; I; H; K; M; L; N; Q; R; T; V; Y; 22 L A; F; V; 23 S A; E; D; G; E; I; —; M; L; N; Q; P; R; T; H; V; Y; X; 24 S A; E; D; G; F; H; K; —; L; N; Q; P; R; T; V; 25 A M; E; D; G; F; I; H; K; —; L; N; Q; P; S; R; T; V; 26 L A; E; G; F; I; —; K; M; N; Q; P; S; R; T; H; V; 27 L A; E; D; G; F; I; —; K; M; Q; P; S; R; T; H; V; 28 M A; E; D; G; F; I; H; K; —; L; N; Q; P; S; R; T; V; Y; 29 P A; E; D; G; H; K; —; L; N; Q; S; R; T; V; 30 K A; M; E; D; G; F; I; H; —; L; N; Q; P; S; R; T; V; Y; 31 D A; M; E; G; I; H; K; —; L; N; Q; P; S; R; T; V; 32 G A; M; E; D; L; H; K; —; L; N; Q; P; S; R; T; V; 33 R A; C; E; D; G; I; —; K; M; L; N; Q; P; S; T; H; V; Y; 34 T A; D; —; M; L; P; S; R; V; 35 L A; F; I; M; S; V; 36 E A; D; G; H; N; Q; 37 D A; E; G; —; K; M; N; Q; S; R; T; V; 38 V A; F; I; H; K; M; L; T; Y; 39 V A; G; I; M; L; S; T; 40 R A; E; G; I; H; K; M; L; N; Q; S; T; V; 41 E A; D; G; N; Q; S; T; V; 42 L A; E; I; M; S; T; V; 43 L I; A; C; M; V; 44 R A; H; K; N; Q; T; 45 P Q; S; E; G; V; 46 L E; L; M; Q; V; Y; 47 E I; M; V; 48 K A; D; G; H; Q; S; R; T; 49 E A; D; G; I; H; N; Q; S; T; V; 50 W Y; 51 L I; M; V; 52 D H; S; V; E; N; 53 Q A; E; D; G; I; H; K; M; L; N; S; R; T; 54 N E; H; K; Q; R; Y; 55 L M; V; 56 P A; E; G; K; N; Q; S; T; 57 R A; E; D; G; I; H; K; L; N; Q; P; S; T; V; Y; X; 58 I M; L; T; V; 59 V A; I; T; 60 E A; D; H; K; Q; S; R; 61 T A; E; D; G; H; K; L; N; Q; S; R; W; 62 K A; C; E; F; I; H; M; L; Q; S; RT; V; Y; 63 V I; 64 E A; D; G; H; K; N; Q; S; R; T; V; 65 E A; D; I; H; K; L; N; Q; S; R; T; V; 66 E A; D; Q; 67 V I; M; L; 68 Q A; E; D; H; K; N; S; R; T; V; 69 R C; G; K; M; N; T; Y; 70 1 A; M; L; T; V; 71 S A; I; M; L; N; R; T; V; 72 R A; E; G; H; K; —; N; Q; S; T; V; 73 G A; C; D; H; K; —; M; L; N; Q; S; R; T; 74 R A; E; G; H; K; N; Q; P; S; T; 75 G A; S; D; N; 76 A S; G; V; 1 E Q; H; K; D; 2 V A; E; D; G; F; I; M; L; N; Q; P; S; R; T; Y; 3 A E; D; G; N; Q; P; S; R; T; V; 4 E A; D; G; H; K; M; L; N; Q; P; S; R; T; 5 Q A; E; D; G; F; H; K; M; L; N; P; S; R; T; V; 6 L A; E; D; I; M; N; Q; P; R; V; 7 V A; E; D; G; F; I; M; L; P; S; T; 8 G A; E; D; I; —; L; N; S; T; V; 9 V A; E; D; G; F; 1; H; K; —; M; L; N; Q; P; S; R; T; 10 S A; E; D; G; F; I; H; K; —; M; L; N; Q; P; R; T; V; 11 A E; G; I; K; —; N; Q; P; S; R; T; V; 12 A C; E; D; G; F; I; H; K; —; M; L; N; Q; P; S; R; T; V; 13 S A; E; D; G; F; I; H; K; —; M; L; N; Q; R; T; V; 14 A C; E; D; I; H; K; —; M; L; N; Q; S; R; T; V; X; 15 A E; G; F; I; —; M; L; Q; S; T; V; X; 16 A E; D; G; F; I; H; K; —; M; L; N; Q; S; R; T; V; Y; X; 17 S A; E; D; G; H; K; —L; N; Q; R; T; V; 18 A G; I; H; K; —; M; L; N; Q; P; S; R; T; V; Y; 19 F A; G; I; M; L; S; R; V; Y; 20 G A; E; D; F; H; K; M; L; N; Q; P; S; R; T; V; 21 S A; E; D; G; F; I; H; K; M; L; N; Q; R; T; V; Y; 22 L A; F; V; 23 S A; E; D; G; F; I; —; M; L; N; Q; P; R; T; H; V; Y; X; 24 S A; E; D; G; F; H; K; —; L; N; Q; P; R; T; V; 25 A M; E; D; G; F; I; H; K; —; L; N; Q; P; S; R; T; V; 26 L A; E; G; F; I; —; K; M; N; Q; P; S; R; T; H; V; 27 L A; E; D; G; F; I; —; K; M; Q; P; S; R; T; H; V; 28 M A; E; D; G; F; I; H; K; —; L; N; Q; P; S; R; T; V; Y; 29 P A; E; D; G; H; K—; L; N; Q; S; R; T; V; 30 K A; M; E; D; G; F; I; H; —; L; N; Q; P; S; R; T; V; Y; 31 D A; M; E; G; I; H; K; —; L; N; Q; P; S; R; T; V; 32 G A; M; E; D; I; H; K; —; L; N; Q; P; S; R; T; V; 33 R A; C; E; D; G; I; —; K; M; L; N; Q; P; S; T; H; V; Y; 34 T A; D; —; M; L; P; S; R; V; 35 L A; F; I; M; S; V; 36 E A; D; G; H; N; Q; 37 D A; E; G; —; K; M; N; Q; S ; R; T; V; 38 V A; F; I; H; K; M; L; T; Y; 39 V A; G; L; M; L; S; T; 40 R A; E; G; I; H; K; M; L; N; Q; S; T; V; 41 E A; D; G; N; Q; S; T; V; 42 L A; E; I; M; S; T; V; 43 L I; A; C; M; V; 44 R A; H; K; N; Q; T; 45 P Q; S; E; G; V; 46 L E; I; M; Q; V; Y; 47 L I; M; V; 48 K A; D; G; H; Q; S; R; T; 49 E A; D; G; I; H; N; Q; S; T; V; 50 W Y; 51 L I; M; V; 52 D H; S; V; E; N; 53 Q A; E; D; G; I; H; K M; L; N; S; R; T; 54 N E; H; K; Q; R; Y; 55 L M; V; 56 P A; E; G; K; N; Q; S; T; 57 R A; E; D; G; I; H; K; L; N; Q; P; S; T; V; Y; X; 58 I M; L; T; V; 59 V A; I; T; 60 E A; D; H; K; Q; S; R; 61 T A; E; D; G; H; K; L; N; Q; S; R; W; 62 K A; C; E; F; I; H; M; L; Q; S; R; T; V; Y; 63 V I; 64 E A; D; G; H; K; N; Q; S; R; T; V; 65 E A; D; I; H; K; L; N; Q; S; R; T; V; 66 E A; D; Q; 67 V I; M; L; 68 Q A; E; D; H; K; N; S; R; T; V; 69 R C; G; K; M; N; T; Y; 70 I A; M; L; T; V; 71 S A; I; M; L; N; R; T; V; 72 R A; E; G; H; K; —; N; Q; S; T; V; 73 G A; C; D; H; K; —; M; L; N; Q; S; R; T; 74 R A; E; G; H; K; N; Q; P; S; T; 75 G A; S; D; N; 76 A S; G; V;
Using Sequence Homology to Generate a List of Amino-Acid Substitutions Shown in Table 1
[0029] We started by aligning PopTag to its homologs within α-proteobacteria. We used BLASTP 2.10.0 with parameters: Max target sequences: 5000, Expected threshold: 10. Word size: 3, Max matches in a query range: 0, Matrix: BLOSUM62, Gap Costs: Existence:11 Extension:1, Compositional adjustments: Conditional compositional score matrix adjustment.
[0030] We detected 4199 candidate homologous sequences. For filtered out candidate sequence with homology to less than 50% of the PopTag sequence. For the remaining of the candidate homologous sequences, we extracted amino-acid substitutions based on the reported BLAST alignment.
Using Binding Energy to Predict Mutations that Maintain PopZ Self-Assembly Capabilities.
[0031] We ran Rosetta ab-initio protein folding to predict PopTag structure (Rosetta server). We ended up with five possible structures. From there, we ran ZDOCK 3.0.2 to predict PopTag-PopTag homo-dimer structure. We ended up with 50 possible models (10 possible homo-dimer models per each of the 5 modeled PopTag monomers). We then used MODELLER homology modeling to predict the structure of mutated PopTags, based on (1). We then superposed each homology model on the 50 docking complexes and ran FiberDock to refine the structure and calculate free binding energy. We included substitutions with calculated binding energy that supports PopTag-PopTag dimerization.
[0032] In some embodiments, the polypeptide has the following sequence, wherein amino acids in parentheses are alternatives at the designated position;
TABLE-US-00003 (SEQ ID NO: 2) (E/D)VA(E/D)QLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVR (E/D)LLRPLLKEWL(D/E)QNLPRIV(E/D)TKV(E/D)(E/D)(E/D) VQRISRGRGA.
[0033] Polypeptides described herein can be substantially identical to SEQ ID NO:1 or SEQ ID NO:2. For example, in some embodiments, the polypeptide is at least 60%, 70%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:1 or SEQ ID NO:2. In some embodiments, the polypeptide has 1, 2, 3, 4, 5, 6, or more amino acid changes (or amino acid insertions or deletions) compared to SEQ ID NO:1 as listed in Table 1 (i.e., has one of the possible mutations as listed in Table 1 at 1, 2, 3, 4, 5, 6, or more different amino acid positions).
[0034] In some embodiments, the polypeptide is a fragment of SEQ ID NO:1 or SEQ ID NO:2. For example, in some embodiments, the polypeptides comprise at least 60, 65, or 70 contiguous amino acids of SEQ ID NO:1 or SEQ ID NO:2 but do not include the full-length of SEQ ID NO:1 or SEQ ID NO:2. An exemplary fragment is
TABLE-US-00004 (SEQ ID NO: 3) AEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWL DQNLPRIVETKVEEEVQRISRGRGA.
[0035] In some embodiments, the polypeptides comprise SEQ ID NO: 1 or SEQ ID NO:2 and comprise further amino acids from a native PopZ protein but does not include the full-length of the native PopZ polypeptide. In other embodiments, the polypeptide can include the full-length PopZ polypeptide.
[0036] The above-described PopTag polypeptides or fragments or variants thereof can be fused to a heterologous amino acid sequence. Any amino acid sequence can be added as desired, depending on the functionality desired to be localized to the membraneless organelle that will form from the polypeptide. In some embodiments, the heterologous amino acid sequence is a fluorescent or protein that degenerates a detectable signal, an enzyme, or an epitope-binding or target-binding protein.
[0037] The heterologous amino acid sequence can be fused to the amino terminus of the PopTag polypeptide. PopZ self-assembly generally occurs via interactions at the PopZ carboxyl terminus.
[0038] In some embodiments, the heterologous amino acid sequence comprises a detectable protein. In some embodiments, the detectable protein is fluorescent. Exemplary fluorescent proteins include but are not limited to blue fluorescent protein, green fluorescent protein, yellow fluorescent protein, and red fluorescent protein
[0039] In some embodiments, the heterologous amino acid sequence comprises an enzyme. Enzymes can be used to convert one substance to another. By targeting the enzyme to the organelle formed by the PopTag protein, the reaction can be localized to the organelle, concentrating the product in a location and also allowing for ease in later purification of the product. Exemplary enzymes include, but are not limited to, SOD1 (UniProtKB-P00441), GAPDH (UniProtKB-P04406), TurboID (Branon, et al., Nature Biotechnology volume 36, pages 880-887(2018)). In some embodiments, two or more PopTag fusions are used where two or more enzyme fusions are expressed to allow for localization of two or more enzymes (as parts of fusions) in the organelles. This can be useful, for example, where the product of a first enzymatic reaction is the substrate of a second enzymatic reaction.
[0040] In some embodiments, the heterologous amino acid sequence comprises an epitope-binding protein. The term “epitope,” as used herein, means a component of a molecule capable of specific binding to an antibody or antigen binding fragment thereof. Such components optionally comprise one or more contiguous amino acid residues and/or one or more non-contiguous amino acid residues. Epitopes frequently consist of surface-accessible amino acid residues and/or sugar side chains and can have specific three-dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents. An epitope can comprise amino acid residues that are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding. The epitope to which an antigen binding protein binds can be determined using known techniques for epitope determination such as, for example, testing for antigen-binding to antigen variants with different point mutations.
[0041] The epitope-binding protein can be selected to bind any specific target as desired. In some embodiments, the epitope-binding protein specifically binds to GFP-GFP nanobody (Kubala, et al., Protein Sci. 2010 December; 19(12): 2389-2401), HA-tag (Zhao, et al., Nature Communications volume 10, Article number: 2947 (2019)), SOD1 (WO2014/191493), or HTT (Butler, et al., Prog Neurobiol. 2012 May; 97(2): 190-204).
[0042] Eukaryote viruses require cellular uptake for host infection. Therapeutic and prophylactic anti-viral strategies can involve the generation of antibodies, nanobodies or other viral binding proteins that can prevent viral docking to the cell membrane and viral entry. Additionally, the antibody-mediated aggregation of viral particles is a another mode of anti-viral activity of these molecules. The PopTag and constructs comprising it can also be used in these strategies. In some embodiments, fusing virus-binding proteins, natural or designed, to the PopTag allows for the generation of anti-viral nanoparticles. Given their size and condensed state, in some embodiments, these nanoparticles can have improved characteristics, such as protein stability, retention in the body, increased binding affinity due to multivalency, increased vial aggregation or a combination thereof.
[0043] In some embodiments, the Pop-Tag-comprising nanoparticles are used to protect agricultural crops. For example, in some embodiments, the PopTag is fused to a pathogen-binding protein that binds to a plant pathogen (e.g., virus, fungus, bacteria). The nanoparticles can be applied for example by spraying them on target plants.
[0044] In some embodiments, the Pop-Tag-comprising nanoparticles are used to protect against animal pathogens, (e.g., human or non-human viruses). Depending on the entry mechanisms of the pathogen, the Pop-Tag-comprising nanoparticles can be administered via injection, external application or nasal sprays. Exemplary target viruses can include but are not limited to influenza and SARS-CoV-2.
[0045] Accordingly, in some embodiments, the amino acid comprises or is part of, an antibody. In some embodiments, the antibody is or comprises an antigen-binding fragment, preferably made of a single amino acid chain that retains epitope binding activity. Antigen binding fragments of an antibody molecule are well known in the art, and include, for example, (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab′)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv) (see e.g., Bird et al. (1988) Science 242:423-426; Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883); (viii) a single domain antibody. These antibody fragments are obtained using techniques known to those skilled in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
[0046] Antibody molecules can also be single domain antibodies. Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of the art, or any future single domain antibodies. Single domain antibodies may be derived from any species including, but not limited to mouse, rat, guinea, pig, human, camel, llama, fish, shark, goat, rabbit, and bovine. Single domain antibodies are described, for example, in International Application Publication No. WO 94/04678. For clarity reasons, this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins. Such a VHH molecule can be derived from antibodies raised in Camelidae species (e.g., camel, llama, dromedary, alpaca and guanaco) or other species besides Camelidae.
[0047] In some embodiments, an epitope binding fragment can also be or can also comprise, e.g., a non-antibody, scaffold protein. These proteins are generally obtained through combinatorial chemistry-based adaptation of preexisting antigen-binding proteins. For example, the binding site of human transferrin for human transferrin receptor can be diversified using the system described herein to create a diverse library of transferrin variants, some of which have acquired affinity for different antigens. See, e.g., Ali et al. (1999). J. Biol. Chem. 274:24066-24073. The portion of human transferrin not involved with binding the receptor remains unchanged and serves as a scaffold, like framework regions of antibodies, to present the variant binding sites. The libraries are then screened, as an antibody library is screened, and in accordance with the methods described herein, against a target antigen of interest to identify those variants having optimal selectivity and affinity for the target antigen. See, e.g., Hey et al. (2005) TRENDS Biotechnol 23(10):514-522.
[0048] In some embodiments, the scaffold portion of the non-antibody scaffold protein can include, e.g., all or part of the Z domain of S. aureus protein A, human transferrin, human tenth fibronectin type 111 domain, kunitz domain of a human trypsin inhibitor, human CTLA-4, an ankyrin repeat protein, a human lipocalin (e.g., anticalins, such as those described in, e.g., International Application Publication No. WO2015/104406), human crystallin, human ubiquitin, or a trypsin inhibitor from E. elaterium.
[0049] In some embodiments, the heterologous amino acid sequence comprises a target-binding protein. For example, in some embodiments, the target-binding protein binds a target molecule that is localized in the cell, thereby allowing for localization of the membraneless organelle to a particular cellular location. As some examples, the target-binding protein is, e.g., a M17 peptide (which is inserted in the plasma membrane upon myristoylation), spectrin beta, non-erythrocytic 2 (SPTN2) (which binds actin), EBI1 (which binds microtubules), Perilipin 1 (PLIN1) (which binds lipid droplets), or an MLLE domain (which binds axatin-2 and other proteins harboring PAM2 motifs). In other embodiments, the target is a cellular molecule ((e.g., a receptor protein binds its cognate ligand).
[0050] In some embodiments, the target binding protein is a protein that has binding affinity for a certain protein or non-protein molecule or a protein motif. Thus, for example, certain receptors have an affinity for certain ligands. Thus the target-binding protein can be a binding protein that allows for localization of a target protein to the organelle formed by the PopTag protein and/or localization of the organelle to the cellular location of the target protein to which the target binding protein binds.
[0051] In some embodiments, an epitope-binding protein or target-binding protein is a fusion partner with the PopTag protein allows for localization of the epitope-containing molecule to the organelle. This can be useful where the epitope-containing molecule (or target) is a desired product, which can be purified from the cell as described herein. Alternatively, the epitope-containing molecule or target can be an undesirable product that can thereby be sequestered in the organelles and thereby removed from the cytoplasm.
[0052] The PopTag protein and the fusion partner can be linked directly or via an amino acid linker. In embodiments in which a linker links the two fusion partners, the linker can be of any length as desired. In some embodiments, the linker is between 1-200, e.g., 1-100, 1-20, or 1-10 amino acids for example. In some embodiments, the linker comprises at least 20, 30, 40, 50, 60 70% or more acidic amino acid residues (e.g., D and E) optionally with a majority of the remaining amino acids in the linker being A, V, or P. In some embodiments, the linker is DDAPAEPAAEAAPPPPPEPEPEPVSFDDEVLELTDPIAPEPELPPLETVGDIDVYSPPEPESE PAYTPPPAAPVFDRDDDAPAEPAAEAAPPPPPEPEPEPVSFDDEVLELTDPIAPEPELPPLE TVGDIDVYSPPEPESEPAYTPPPAAPVFDRD. In some embodiments, the linker modulates the material properties of the PopTag condensate, and can be selected for desired properties.
[0053] The PopTag proteins and PopTag fusions as described herein can be expressed in any cell to generate PopTag membraneless organelles. As shown herein, expression of these proteins in eukaryotic and prokaryotic cells results in PopTag oligomerization and organelle formation, including as fusion proteins. Accordingly, in some embodiments, a cell comprising (e.g., expressing) the PopTag fusion polypeptides is provided. In some embodiments, the cells comprising the PopTag fusion polypeptides are prokaryotic cells. Exemplary prokaryotic cells include but are not limited to, Escherichia coli, Caulobacter crescentus. In some embodiments, the cells comprising the PopTag fusion polypeptides are eukaryotic cells. Exemplary eukaryotic cells include but are not limited to, mammalian (e.g., human), fungal (e.g., yeast) or plant cells.
[0054] The PopTag fusion polypeptides can be introduced into a cell in any way desired. In some embodiments, an expression cassette comprising a promoter operably linked to a polynucleotide encoding the PopTag fusion protein is introduced into the cell. The cell can then be exposed to conditions conducive for expression. The promoter can be for example, inducible or constitutive. The expression cassette can be introduced by a vector (e.g., a plasmid of viral vector) or can be delivered directly (e.g., via electroporation or biolistics). Exemplary vectors include but are not limited to, a recombinant adeno-associated virus, a recombinant adenoviral, a recombinant lentiviral, etc. For example, viral vectors can be based on vaccinia virus, poliovirus, adenovirus, adeno-associated virus, SV40, herpes simplex virus, human immunodeficiency virus, and the like. A retroviral vector can be based on Murine Leukemia Virus, spleen necrosis virus, and vectors derived from retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, a lentivirus, human immunodeficiency virus, myeloproliferative sarcoma virus, mammary tumor virus, and the like. Introduction of the expression cassette can be performed in vitro, ex vivo (e.g., removal of cells from the body, introduction of the expression cassette outside the body, and reintroduction of the cells into the body), or in vivo (e.g., via gene therapy).
[0055] Cells expressing the fusion polypeptides described herein as well as vectors and expression cassettes encoding the fusion polypeptides can in some embodiments be administered to an animal (e.g., a human) to cause a biological effect. In some embodiments the effect is a prophylactic or therapeutic effect. For example, the cells can have an affinity for a cytotoxic or other undesirable molecule or protein and can allow for sequestration of that molecule or protein in the cell.
[0056] As noted above, in some embodiments, two or more (e.g., 2, 3, 4, 5, or more) different fusion proteins, each comprising a PopTag protein can be introduced into the same cell. This will result in organelles comprising the multiple different fusions (interacting via the common PopTag fusion partner), allowing for multiple functionalities in the same organelle based on the functionalities of the various fusion partners.
[0057] In some embodiments, the PopTag fusion polypeptide further includes one or more drug-inducible degron degradation motifs, allowing for inducible degradation of the PopTag fusion proteins in an inducible manner. Exemplary inducible degradation systems include those described in Lambrus, B. G., Moyer, T. C., and Holland, A. J. Methods in Cell Biol 358(6364): 716-8. (2017)
[0058] One advantage of localization of the fusion proteins, and optionally molecules that bind to the fusion proteins or products that are catalyzed by the fusion proteins, is that the organelles formed by the fusion proteins can be readily purified from cells containing them. For example, in some embodiments, a cell expressing the fusion proteins and thereby containing membraneless organelles composed of the fusion proteins, can be lysed and the resulting lysate can be separate from the organelles. In some embodiments, the separation can be achieved by centrifugation of the lysate and subsequent removal of the organelles which will separate from most of the remaining lysate due to differential density. As noted above, by purifying the organelles one can readily purify any desired component of the organelle of contents of the organelle (e.g., a product made by one or more enzyme as part of the fusion protein).
Definitions
[0059] As used herein, the following terms have the meanings ascribed to them unless specified otherwise.
[0060] The terms “a,” “an,” or “the” as used herein not only include aspects with one member, but also include aspects with more than one member. For instance, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “a cell” includes a plurality of such cells and reference to “the agent” includes reference to one or more agents known to those skilled in the art, and so forth.
[0061] The terms “sequence identity” or “percent identity” in the context of two or more nucleic acids or polypeptides refer to two or more sequences or subsequences that are the same (“identical”) or have a specified percentage of amino acid residues or nucleotides that are identical (“percent identity”) when compared and aligned for maximum correspondence with a second molecule, as measured using a sequence comparison algorithm (e.g., by a BLAST alignment), or alternatively, by visual inspection.
[0062] The phrase “substantial identity” or “substantially identical,” used in the context of two nucleic acids or polypeptides, refers to a sequence that has at least 60% sequence identity with a reference sequence. Alternatively, percent identity can be any integer from 70% to 100%. In some embodiments, a sequence is substantially identical to a reference sequence if the sequence has at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the reference sequence as determined using the methods described herein; preferably BLAST using standard parameters, as described below. Embodiments of the present invention provide for nucleic acids encoding polypeptides that are substantially identical to any of SEQ ID NO:1 or SEQ ID NO:2.
[0063] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
[0064] A “comparison window,” as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection.
[0065] Algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (NCBI) web site. The algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra). These initial neighborhood word hits acts as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word size (W) of 28, an expectation (E) of 10, M=1, N=−2, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a word size (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff. Proc. Natl. Acad. Sci. USA 89:10915 (1989)).
[0066] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.01, more preferably less than about 10.sup.−5, and most preferably less than about 10.sup.−20.
[0067] As with all peptides, polypeptides, and proteins, including fragments thereof, it is understood that additional modifications in the amino acid sequence of the PopTag proteins described herein can occur that do not alter the nature or function of the antibodies or antigen-binding fragments thereof. Such modifications include conservative amino acid substitutions, such that each recited sequence optionally contains one or more conservative amino acid substitutions. The list provided below identifies groups that contain amino acids that are conservative substitutions for one another; these groups are exemplary as other conservative substitutions are known to those of skill in the art. [0068] 1) Alanine (A), Glycine (G); [0069] 2) Aspartic acid (D), Glutamic acid (E); [0070] 3) Asparagine (N), Glutamine (Q); [0071] 4) Arginine (R), Lysine (K); [0072] 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); [0073] 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); [0074] 7) Serine (S), Threonine (T); and [0075] 8) Cysteine (C), Methionine (M)
[0076] By way of example, when an aspartic acid at a specific residue is mentioned, also contemplated is a conservative substitution at the residue, for example, glutamic acid. Non-conservative substitutions, for example, substituting a proline with glycine, are also contemplated.
[0077] An amino acid residue “corresponding to an amino acid residue [X] in [specified sequence,” or an amino acid substitution “corresponding to an amino acid substitution [X] in [specified sequence]” refers to an amino acid in a polypeptide of interest that aligns with the equivalent amino acid of a specified sequence.
[0078] A polynucleotide sequence is “heterologous” to an organism or a second polynucleotide sequence if it originates from a foreign species, or, if from the same species, is modified from its original form.
[0079] An “expression cassette” refers to a nucleic acid construct that, when introduced into a host cell, results in transcription and/or translation of an RNA or polypeptide, respectively.
[0080] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art to which this technology belongs. Although exemplary methods, devices and materials are described herein, any methods and materials similar or equivalent to those expressly described herein can be used in the practice or testing of the present technology. For example, the reagents described herein are merely exemplary and that equivalents of such are known in the art. The practice of the present technology can employ, unless otherwise indicated, conventional techniques of tissue culture, immunology, molecular biology, microbiology, cell biology, and recombinant DNA, which are within the skill of the art. See, e.g., Sambrook and Russell eds. (2001) Molecular Cloning: A Laboratory Manual, 3rd edition; the series Ausubel et al. eds. (2007) Current Protocols in Molecular Biology: the series Methods in Enzymology (Academic Press, Inc., N.Y.); MacPherson et al. (1991) PCR I: A Practical Approach (IRL Press at Oxford University Press); MacPherson et al. (1995) PCR 2: A Practical Approach; Harlow and Lane eds. (1999) Antibodies, A Laboratory Manual; Freshney (2005) Culture of Animal Cells: A Manual of Basic Technique, 5th edition; Miller and Calos eds. (1987) Gene Transfer Vectors for Mammalian Cells (Cold Spring Harbor Laboratory); and Makrides ed. (2003) Gene Transfer and Expression in Mammalian Cells (Cold Spring Harbor Laboratory).
EXAMPLE
Example 1
1. PopTag is Sufficient for Phase Separation in Human Cells
[0081] We identified PopTag, a 76 amino-acid sequence extracted from the bacterial protein PopZ (UniProt ID Q9A8N4), that phase separates in U2OS osteosarcoma cell line. A heterologous protein of choice (ORF, open reading frame) can be visualized with GFP (green fluorescent protein), and fused to the PopTag with the possibility of a central linker. When expressing GFP alone, GFP is diffusely localized throughout the cell. Upon fusion of GFP to the PopTag, with a central (GGGGS)4 spacer, GFP-PopTag forms phase-separated condensates in the cytoplasm. Insertion of a negatively charged linker tunes the material properties of PopTag condensates from gel-like to liquid-like, as assayed by an increase in fluid-like dynamics (FRAP, fluorescent recovery after photobleaching) and decrease in molecular density (partitioning coefficient).
2: PopTag Condensates have Tunable Material Properties
[0082] Protein binding domains, so-called anchors, target PopTag condensates to different cellular localizations. While GFP-PopTag condensates localize to the bulk of the cytoplasm, fusion to M17 targets it to the plasma membrane, the actin binding domain of SPTN2 confers actin cytoskeleton localization, the microtubule binding domain of EBI1 to the microtubule cytoskeleton, and an amphipathic helix of the PLIN1 protein to the surface of lipid droplets.
[0083] GFP-PopTag condensates have gel-like properties, based on (1) their poor dynamics as assayed by fluorescence recovery after photobleaching, FRAP, and (2) high partitioning coefficient indicating high molecular density. By inserting a negatively charged spacer (
3: PopTag Condensates have Tunable Cellular Localization
[0084] Fusing anchors (i.e., protein domains that bind to specific cellular structural features) to PopTag condensates allows targeting to different cytoplasmic compartments and organelles. In our assay, we fused anchors at the N-terminus of our GFP-PopTag and show altered localization depending on the specific anchor): (1) The M17 peptide, an HIV-derived peptide that is targeted to the plasma membrane upon myristoylation by the cell, targets the GFP-PopTag condensates to the plasma membrane. (2) The actin binding domain of SPTN2 targets GFP-PopTag condensates to the actin cytoskeleton. (3) The microtubule binding domain of EBI1 targets GFP-PopTag condensates to the microtubule cytoskeleton. (4) An amphiphatic alpha helix derived from PLIN1 targets GFP-PopTag condensates to the surface of lipid droplets.
(FIG. 3B)
[0085] 4: PopTag Condensates have Tunable Enzymatic Functionality
[0086] PopTag condensates can be functionalized by fusion to different enzymes. Fusion to the PopTag allows for the formation of enzyme condensates in the cytoplasm. For example, fusion of the PopTag to SOD1 and GAPDH results in their phase separation in the cytoplasm. Additionally, fusion of the PopTag to the biotinylating enzyme TurboID results in the formation of condensates that stain positive for streptavidin (SA) upon treatment of the cells with biotinindicating that TurboID retains its enzymatic activity within the context of phase-separated PopTag condensates.
5: PopTag Droplets have Tunable Composition
[0087] PopTag droplets can be engineered to have different protein composition. By fusing specific protein binding domains to the PopTag, one can recruit a client protein to the condensates. The MLLE domain of PABPC1 can bind to the PAM2 motif of ATXN2, a protein that is implicated in the pathogenesis of spinocerebellar ataxia type 2 (SCA2) and amyotrophic lateral sclerosis (ALS). ATXN2 is not enriched in GFP-PopTag condensates in the cytoplasm. However, upon fusion of the MLLE domain at the N-terminus of GFP-PopTag we do observe the recruitment of ATXN2 to the GFP-PopTag condensate.
5: NanoPop, Sequesters GFP Tagged Proteins
[0088] To generate a system that would allow for the recruitment of any protein of interest we decided to test the compatibility of the PopTag system with nanobodies. Nanobodies are single chain antibodies derived from camelids or cartilaginous fish, of which the antigen binding domain can be expressed as a linear protein sequence. NanoPop includes a PopTag fused to a GFP nanobody, a single-chain antibody specific to GFP. We found that GFP tagged proteins are specifically recruited into NanoPop, as shown for the stress granule protein YB1, a cytoplasmic enzyme Glyceraldehyde 3-phosphate dehydrogenase (GAPDH), as well as NcI.
[0089] NanoPop condensates allowed for the recruitment of client proteins to PopTag condensates based on nanobody binding. A heterologous protein of choice (ORF, open reading frame) can be visualized with GFP (green fluorescent protein). Fusion of RFP (red fluorescent protein) to GFP nb (nanobody raised against GFP) allows for recruiting RFP to the GFP-tagged protein. Subsequent fusion to the PopTag allows specific recruitment of GFP-tagged protein to PopTag condensates. Nanobody-RFP fusion colocalizes with GFP diffusely throughout the cell. Nanobody-RFP-PopTag fusion, NanoPop, induces the recruitment of GFP to the cytoplasmic PopTag condensates. The recruitment to NanoPop condensates is observed for different GFP-tagged proteins that were expressed by plasmid transfection. Recruitment of endogenous GFP-tagged nuclear transport receptor KPNA2 to cytoplasmic NanoPop condensates prevents its nuclear localization, and subsequently perturbs nuclear localization of its cargo NPM1.
6: Drug-Induced PopTag Assemblies
[0090] Drug-inducible expression of PopTag condensates via degrons: To enable temporal control on the assembly of the PopTag, we developed a drug-inducible degradation of the PopTag proteins by fusion to a destabilizing domain (see, e.g., Banazynski, et al., Cell 2006 September 8; 126(5): 995-1004). Upon fusion of the DD (Destabilizing Domain, degron to the PopTag, rapid degradation is inhibited by incubating transfected cells (red outlines) with the Shield-1 compound. In cells lacking the compound, PopTag molecules are rapidly degraded, releasing any sequestered protein. Only in the presence of Shield-1, DD-GFP-PopTag condensates were present.
Methods
Plasmid Generation
[0091] Constructs encoding PopTag and fusion proteins we synthesized by Genscript (Piscataway, USA) and subcloned into pcDNA3.1+N-eGFP under the control of a CMV promoter.
Human Cell Culture and Transfection
[0092] U2OS (ATCC) cells were cultured in DMEM medium (Thermo-Fisher Scientific) containing 10% FBS (Invitrogen) at 37° C. and 5% CO.sub.2 and handled according to standard procedures. Cells were seeded on glass coverslips and allowed to adhere for 24 h. Cells were subsequently transfected with plasmids encoding PopTag fusion proteins via Lipofectamine 3000 (Thermo Scientific) according to manufacturer's instructions.
Alternative PopTag Sequences
[0093] We identified the attached sequences as alternative PopTag fragments based on sequence alignment (same as 1). We then used MMseqs2 to cluster the sequences based on homology (0.65 minimum sequence identity and 0.65 minimum alignment coverage). We ended up with 146 sequences as follows (SEQ ID NO: 4-149, respectively).
TABLE-US-00005 >MAK64050 EVSEGIMSEPAASAAMGSFHTLADQIRISEEEGRTLEGVVRALLRPMLKEWLDANLPSIV DEKVQAEIDRVSRRR >OZB16237 EPLTDANTAESAAGALGKLISKMDIGSDNTLEGLVRELLKPMVKEWLDANLARIVEEKV EAEVQRIAR >WP_116399749 ELSDVLLSPAASESVAHAFDTLDRTLKMQNDGTLEDMSRELLRPMLKAWLDENLPALV ERLVKAEIERVVRG >WP_150286982 ERIMSDNTKALVSQAFQTLSRHTAMPAMGRSLEDVVVELLRPMLRDWIDSHLPAIVEK HVRAEIERVARG >WP_084563928 TAEDRILSEAADAAIGASFNVLSRTVVAQNPHTIEDLVRDMLRPMLQSWLDENLPRIVER QVRAEIERVSRG >SFZ82387 DIAEELLEPATKAAVRSTFARLNGLSAVAPGITLEDLIRDMMRPMLKEWLDENLPAVVE RMVEKEIERVSRG >RYZ14919 ETLTSAPVAQHAAGALGKLMGSMLVSSTGTLDDVVRELLKPMLKEWLDANLPQLVEA EVAKEIDRIRR >RZO67422 AAVAEDAFKSLNQSIRISGQSEKTLEDLVTDLLRPLMKEWLDENLPQIVEDKVQDEVTRI AR >KAB2877277 LLSSAASHAVDHAFSQFTQTVFTQNGRTIEDVGRDMLRPMLKSWLDDNLPGLVERLVR AEIERVSRGR >WP_107990003 DRLMSDNTDTTVHSAFASLSNTVLAANSRTLDELVREMLRPMIKGWLDDNLPTMVER MVRQEIERVTRGR >PCJ59580 DSLLDKTAAAAATESFGELTKAVIKEDGPGIQLGSLTEKTLEDLLKELLRPMLKEWLDQ NLPSITEKLVRKEIERTAR >OGN41220 DALVGESAAAXXXSAFAGLAASFKKPEPAAASSTEMPFVSGNTVEAMVAEMLRPMLK DWLDNNLPAIVEAAVQREVERIARS >WP_150968254 EGASALLSAQAGDQVAAAFDDLTRAIRDGQMRSMEEMAREMMRPMLQEWLDDNLPRI VERLVRDEIERIARG >WP_110354116 QVSERLVSSHTVESVGQNFHLLAQTVLSQNARTLEDLVQDMLRPMLKGWLDENLPHM VERLVRAEIERVARGR >OYW35496 KDLLSPSVDAVVAAAFESLGDMVLPAHERTVEDLVKEILRPMLKEWLDAHLPDIVERLV RAEIERVSR >WP_152586336 DALLSGAADACVADAFGRLGAAVAGRSSPATMEDFVAELLRPLLREWLDENLPPLVER LVRAEIERISRG >MBG50924 EPLISGATEAATAAAFGSLASSILTSSGDARTLEDLVADMLRPMLKDWMDKNLPSLVEQ LVREEIERVARRGR >MBF34074 EALTDERIAGAAATALGKLMVKRSSSEEEANPNTLDGLMREILRPMIKEWLDANLPAIV ERKVEEEVQRIAR >MSO89259 GEGLMSQSATMSSAGAIAHLNQALLGDYSDLLGNMGRMTVEDLVRELLRPLLKEWLD RNLPPLVEQMVRNEIQRIVR >RME62048 IVSDDVAVAASAKFDQLSHMLVRRYPGAENTLEGLVRDLLRPLLKEWLDANLPPLVEE MVAREIERITRGKS >WP_109253360 LLGESQAGVASAAFAALSENLRVSSGNGQTLEGIVRELMKPMLKQWLDENLPTIVEQK VEEEIERVARRR >OQW62276 TADAILSTPVASAAAGSLARLAGTLRISDQPGQTVEGVVRELLKPMLKEWLDRNLAAIV EARVEAELERIAR >WP_068000963 DLTETLISSATDQVVSSAFNGLANTVLSKNARTLEDMVAEMLRPMLKGWLDQHLPSVV ERLVRQEIDRIS >HAJ47106 LVSSHTQSAVNQAFSMLSRSNTNDMPIAQGDGRTLEDIVAQMLRPMLKDWLEDNLPA MVERIVREEVERASRTTG >WP_104831404 EIEDEILDQTTAAAASKAFTTLSQSVRVSEGPGRTLEDIVTEMLRPMVKEWLDANLPAIV EEKVEEEVQRVARRR >WP_062630189 DIAEGLLETTTKAAVRSSIGKLGAAGLGTIASPALGNGGLTIEAMVRELLRPMLKEWLDE NLPAVVERMVEKEIARVARG >WP_127070964 DMANELLEPATKAAVHSAFAKLGTPSKQTSDMALGASGLTIENMIREMLRPMLKDWLE ENLPSMVERMVEKEIERVSRG >WP_018996642 EGLVAAATADATAGQLGKLMGSMMLSQGTTIEDLVREMLKPMLKEWLDGNLPQLVEQ EVKKELQRISR >HAA93780 DNLIGDSPRAQATTSLANLSTAIREHRPGLTVEQLAEELLRPMLREWLDANLPDMVERL VQKEIQRMA >OYY45783 EALVGAGVAGATSSAFARLNQAVQDSVPAPAATDPGPRVGGSGQSIEDLVKEMLRPML KEWLDTNLPPMVERYVEREIARLTR >WP_136161146 EDIVSAAVASASRNALASLARLKVRAEDDAPENSLEGLVRDMLRPMLKEWLDANLPRI VEAMVAKEIARISGDR >WP_144343391 ERLVSGSASNAVSAAFGSLQRTVTSNSRTVDDLVTEAIRPMLKAWLDENLPTLVERLVR AEIERVAR >PHR54293 DELLSAASTAASAGTLGALASSMKLAETDGQTIEGVMRELLRPLLKDWLDTNLPAIVEA KVEAAIDKVVR >WP_024749786 LVSADAANSVASHFQALAASIVLSESDLIERYARDLLRPLLKQWLDDNLPHIVERLVRVE IERVARGR >WP_083579096 IVSDATASATAERLKALSSAMAGPESGSVTLEGLVREMLRPMLKDWLDRNLPDIVDEV VSREIARLTGKG >WP_099512227 QTAEALLSSEAVASVTGAFSRLSESVRPAQPQTVEDLMKEMLRPMLKAWLDDNLPPLV ERLVREEIERVVRRRA >WP_119422031 LVSAPVAQQAASTFSNLASTVSQVRGLPIGSPNRTLEDIVKELLRPMLKDWLDANLPTL VHRIVEREVAKLAGR >GEQ98249 EALVSSSTEERSSASFAELSAMLVGGYEGAGNTLEGLVREMLKPMLRAWLDENLPRIVE DMVEREVARIAARG >WP_127690594 AETMLSVESEVATRHSLSALSAMVVKPQEGGRDNTLESLVRELLRPMMKDWLDAHLP DLVEAMVAKEIARITGRA >WP_046863310 LLSPAVDSTVSQAFGLLSSTISNQSFSSTLLSSNPRTLEDLVGDLLRPLLKAWLDEHLPPL VERLVRSEIERVARG >WP_014077464 STQAARESLVNLSRLLIRPEDGPAGTLEDLVREMLRPMLKDWLDAHLPGLVETLVKREI DRIT >MPY74861 ADSIISTSTAAAGISSFGQLARSVKSGRPGITVEQLAEELMRPMLRQWLDENLPDMVERL VRREIERMARA >WP_110030672 QLISMDAGAKVAASFDHLSATLAASSTRSFDEIAEELLKPMLQNWLDDNLPTLVERLVR EEIERVSRG >MAS86895 EDDENLLSENTASASLAALDKLSRSSAIDNRRNINDAVTIEDITREMLRPMLKAWLDKNL PDIIERTVQKEIRRLS >WP_131117822 ETLVSPEAGATVGSAFQTLATSVVLQNSDTIEKLTREMLRPLLKSWLDDHLPALVERLV RQEIERLARG >PCJ89384 DHLLSNQAAESISGAFSNLSNLVVSGQAKTMEDLMREMLRPMLQAWLDQNLPPMVEK MVASEIRRLSGR >HAD25315 IVDKVTAQATAAALNQLVVDMPSYVGMGQGLSLEEIVKELLRPLLKEWLDQHLPGMA ERLVQEEISRISRAR >WP_046171594 DMADQLLEPATQAAVRSSITRLNGLGNTGATIESLMRDMLRPMLKEWLDENLPSVVER MVEKEIARVSRG >WP_111198331 AEQPAILSGNSAQAVQSAFGKLADSVLSRATNERSVEEVTRELLRVMLKQWLDENLPA MVERMVREEIERVAR >WP_040617591 LISNDTGAAVHTALDHLSAMFVGSKAQTVEELIQEMLRPMLKAWLDQHLPGMVEEMV QKEIKRITRGR >OJX54643 DMAEQLLAPATDAAVQGAMSRLGSLAGTGIGSMTVEAMIRDMLRPMLKDWLDENLPA LVERMVEKEISRISRG >MPT47087 QLQDNIVSAQSENAARSSLAALSNMMVKSAGQGDPATLEDLVKDMLRPMLKEWLDAN LPNMVEGMVAKEISRITGR >WP_073011368 EDDDPLTSDQTGEAVNAAFSNLASLYVGNAQTVEDLIKDMLRPMLKAWLDQNLPVLV EQLVQKEIERVTRRR >WP_099475008 EVLMSANSSGLAMDQFGILSDLLTSGYQGSGNTLEDLVREMLKPMLRGWLDENLPPLV ERMVAKEIARLSRTK >WP_134763919 KFAHALISREAGERVAASFSELAAAIRDDHLRDSDAIVREVMRPMLQEWLDENLPRLVE QLVREEIERIARG >MBG05802 IVSDPTAQAGVDAFGQLAGIIAGRMQLGQGRTVEELVQELLRPLLREWLDKNLPELVDE LVKKEIERM >TDI66500 EIEEGLLSADAAVATSAAFGDLNRTLTVSLGEGKTVEAIVGDLLRPLLKSWLDQHLPPLV EQMVQEEIERLARRR >WP_113943108 LISQAAEKQVAASFGSLSQALLEEQKRLLNDKMEAMLRPMLQEWLDTNLPPLVERLVR EEIERVVRRG >WP_099057644 AEALSGLNALVSAATVEQVSRSFGELAAAIDGQQRRSLDEMAEDMLRPMLREWLDDNL PTLVERLVREEIERVARG >WP_090699777 QPLLSAETNASVATAFQSLAQSVLLRDPGVMENMARDLLRPMLKQWLDDNLPPLVERL VRAEIERAARG >EKE77616 EEDEGLVSPPKRDEAVSAFANLTSTLEARHPELPIGAGHKTLESLTKEVMRPMLKDWLD KNLPHIVERLVREEIERIAR >WP_155191382 EFLTSAATGQAVHAALDNFSDMLISTKAQTIEEMVREMLRPMIKAWLDKNLPPMVEEM VKKEIQRVIRRR >MSP82741 DRLVSDFAANMASSRFSALARAAEPDPLEGVQRTGRTVEEIAVDLLRPMLKEWLDTNV PSIVERMVEREIRYLSR >CBS86857 EVDDGLISRRTAEDASHHLTHLARELGDDLSIGPMPIGIRTVEEVVRELLKPLLKEWLDE NLPTVVERLVQQEIDRMIR >WP_108659666 EMDDSLTSQKTRQSVTNSLDQLSRTILSNNPRTLEDLVRDMVRPLLREWLEANLPDIVE RQVRQEIDRVASRGR >TNE42206 LMSDSAAGAAAASFENLARAMPVLEEDSRSLEGIVVEMLRPVLAAWLDQHLPKIVEQM VQKEIERVSR >SDC97157 IAEPAASAHAGPSLSSLIINPAGTGQTLEGLVRDMLRPMLSDWIDTNLPGIVERLVKQEM SGIN >WP_152428646 EPIASPATDAAVASSFNALFASRLLPNPEMLAELTRDLLRPMLKAWLDDNLPVMVERLV RAEIERVARG >WP_109901738 EPLVSTPIANQARNAFAQVADAARPSVSPRESVGDGRTVEQVAEDLMRPMLKAWLDA HLPAIVERAVAEELARITGRGS >PPR25242 EVVEDDVLVSAATTAVGASAFAQLTGAMDLAMRLGGVDRTLEALVKELMRPMLRDW LEANLPAVVERLVQREIDKMSVKSG >WP_010919196 EVAEQLVGVSAASAAASAFGSLSSALLMPKDGRTLEDVVRELLRPLLKEWLDQNLPRIV ETKVEEEVQRISRGRGA >OYW82231 ASRLVSDRTESTAANAFGALTNALLVPKDGRTLEDVLKELMRPMLQDWLDKNLAAIVE EQVRLEVERIAR >TAJ69484 AANLVSDHIAAAAAATFGQLSSSILMPAEGRTLEDVVREMLRPMLQQWLDTNLPGIVQE AVQAEVERIARGR >WP_045319374 ASAFAGLTAAARTPADARSLEDIVRELLRPMLKDWIDANLPGIVEREVRAEVERISRQG GA >WP_126424045 ETTSHLVSERTVQSAVSAFGQLTSASLLPREGRSIEDLLTEILRPMLQDWLDGNLPAIVET AVREEVERLAR >HBJ92934 SAGKAAGALGQLMGSMAIGNGATLESIVRELLRPMLKEWLNENLPGIVEAKVEEEVKRI SR >WP_117396792 DIADSLLEPTAQAASSHAFSQLDNLIMSQKQGQTIEDLIREMLRPMLKSWLDENLPGVVE QLVQREIERVSRGK >WP_036837750 EMDEPLVSAAASATVQSAFGQLSHTVLAANGRTLDDLVKEMLRPMLHAWLDENLPVIV ERLVRAEIERVSRGR >WP_111433003 EPLLSPTSDAAVSAAFGNLAHTILSNNARTLEDLVGEMLRPMLKTWLDDNLPALVERLV RQEIERVSRGR WP_150942726 AETLLSSAANASVSDAFTRLGSTIMPTQPQTLEDLMKDLLRPILKSWLDENLPSLVERLV QAEIERISRGQ >WP_054731639 EELVSAASADAARQSLEALSAAVTPDTAATNAHVAPVPAARTMEDVVLDALRPMLKD WLDTNLPSLVEAMVAKEISRITGKR >WP_123152580 IVSTVAVEASRHALASLSKMVVKPEVAGSDTLEGVVRDMLKPMLKDWLDTHLPDIVER MVAQEVARISGRS >WP_082922353 SESLIAGAAAATLRDSFAALQSVASTPEPSKPAGTANPLEDMVREMMRPMLKQWLDDN MPGMVEKIVEREIARITGR >WP_113227590 NLVSAEAGAQIARSFGALAEVFDGVRNPTIETVAQDMLRPMLQEWLEDNLPTIVERMV REEIERVARG >OJW52521 SEPLVSSAAVSEAALSFQALNKVASESPRYPDPRLNAGIGGQTVENLVREILRPLLKEWL DANLPTLVRWVVNEQVERIVR >WP_116391335 AQTLVSDGAAKKVSDAFGALHENVRVSNAGGQTIEDIVEAMLRPMIQQWLDQNLPRIV EEKVEEEVRRIARRR >MSQ87355 LVGDPAVQAAGASIAQLANAVSRERAVVLGNTGITLEQLVREICTPILKEWLDTNLPHIV DRVVKQEIERI >TDN86484 ETIVSRQAADASRGKLESLSRMVVKPETPGSDTLEGMVREMLRPMLREWMDANLPGLV ERMVQREIERIT >WP_153478534 EGLLSDRAGASVGHAFDALSRTVSAQTPRSVEELVADILRPMLKSWLDQNLPGLVEDLV RQEIERIARSR >MBS27392 VSDEVEEVSAASMSGLTAALAATAAVGDGNKTLEELVKEVLRPILKEWLDDNLPDVVD RIVHEEVERISQ >MAZ76946 ILSDSAQSATMSSLSKLVGNVPLNRRGYDGITLEDIVRELLNPMIRDWMDDNLPPMVER IVQKELEKLAR >PPR71936 VTSEIVSASTAHAATDILSELAKAILNRRDVAVDDAGQNMTLEGMVREILKPLLREWLD RNLPYLIERLVKKEIDTMINRAEG >WP_094408892 DALMSPDTASAASRAFAKLQDMDEDESPAAAVMRASGGGNPTLDELVREALKPVLRE WLDRNLPPMVETMVREEIQRLA >PCJ02983 ISDSLISEQVGDAVNKNFHLLANTLLAQNGAGQTVESMVMALMRPMLKSWLDENLPV MVEKIVREEIERVARG >WP_056631067 EEAPAVSPATVEATRGALGALSRLIVKPEPESDGTLEGLVREMLRPMLSEWLDHNLPPL VEQMVAREIAKIIANQG >SIS42034 DRLVSPPTEVASAAIFSELYGALARDRGLGIGKVGITLEEIVREALRPLLREWLDANLPEL VERLVRKEIERLVTG >MBI05737 EPLMEVSSEDVAVSAFAALASQVSSGSAEHRAQAISPSERTLEDHVLEMLRPMLREWLD KHLPEMVQRLVQREIDRITH >WP_115936803 VSQATDALGTASFAYLEKSIRMGQVGDTLEDIVKGLLRPMLQSWLDENLPQLVERLVQ REIEMMAGG >WP_014102704 ESVLGEVAASATFAGFARLANNIAVDRRRQTGEGVTIEDIVRDMLQPLLRQWLDDNLPT MIERMVQKELEKLAQ >WP_121048327 EEAQSAVSDDIMAKASESFSALSSLRLRGDGAGPETLEGLVREMLQPMLKSWLDANLPE IVEQMVAREIARITR >MAZ00165 VREELISATTASASLEAMSKLVAEEVARPDSSSTIEQITKDLLRPMLKDWLDANLPALIEK LVQKELRRLS >WP_129792709 VTEEAGLLSSGAAAASRERLAALSALRQRTEIPTDTGALEAVVRDMLRPMLKDWLDEH LPAIVEQLVTREIARIT >MBK18883 LLDDEPATATTSSLSNLVAAVDADNSGTPLGDGNRTIEDLVKEVMRPMIKEWLDDNLP ALVDRVVRREIERLSR >WP_119775134 AERLVSETIASQARNAFAQVAQASRPPAGTRRADGDARSVEEVVEDLLRPMLKDWLDT HLAGIVERCVAEELARIS >WP_151591514 VAPHILSQVAERQVAAAFQDLSHVVRAEPRRSFDDIAAEILRPMLQDWLDNNLPTLVER LVREEIERVVRG >PJI44352 EGLVSPPTAARAAAHLGQLSGAIAGSRAMGLGNSQRTLEELVKELLRPMLKEWLDAHL ATIVQRIVEREVARLT >WP_121154820 LVSDATLNASRSSIAALSALVIKPEITGGDTLEGLVREMLKPMLADWLDQRLPDVVERL VAQEISRITARG >WP_114911944 LANDTAESAAASIVGLVRTLAADRLTPVHRGGPTTEDLVREEIRPLLKTWLDAHLPALVE RLVQNEIERV >PIR33635 EHISDKTAATAKSSIESLVSQLANDTDTDPGAPFRSGETVEDLVKEMLKPMLKTWLDANL PELVEAIVQKEIKKI >MAQ70769 ATTATSDAFHKLAENVAISRQVGKVTLEDITRDLLRPMLRQWIHENMPQIVERLVQKEL EKIAK >WP_119268692 LMSEASSDATQAAFGRLAETLTRRALGERPIADVTQELLKGMLKQWLDENLPKIVERLV REEIERVVR >WP_011389550 VDERLISATTEVAAGGLLAELASAVARERTIGLGHGGVTLEDMVREILRQLLKDWLDEN LPYMTERLVQKEIERL >PCI01942 ILNDAAATATVSSMARLAENIAVSRTTEGTTLEDITRDLLRPMLKIWLDENLPTVIERLV AQELERLAE >MBL41367 DVASLLDSVTADNASAAFAQLANTRAERATTLEELVKELLRPMLKTWLDENLSQVVER LVEKEITKLS >WP_127612254 IAGATAAAMRDQLSALSNFSAAAPKTETTPHPLEDAVRDMLRPLLKEWLDANLEGIVER IVQDEISRITGSR >WP_068498366 AEPLISDPVARHSTSLLSDLAREIVRHRGIGLGNGGITLEDMVRELLKPILKEWLDDNLPY MIERLVKQEIEKM >WP_143130987 DSLLSPRAADSSATALAELSAAVARGRALGLGAGHTTLEEIVKELLRPILKEWLDNHLPG MVERMVRQEMERL PJB72509 EDGDSIFTDSAENAALQGFMKLASKMPLDRRGTGETTIEDIIREMMKPMLREWLDIHLPP LIEKVVQKELRNIAR >WP_025898636 EEPVVQAATSSFASLAGAVSASRGMPMGNSAATLEELVRDLLRPMLKEWLDEHLASIV QRIVEREVSKLA >SFF08372 SASSSRYGDVPPPLVSPTTGQLVGASFNELAEAIRQGELRSLEAMAQEMLQPMLRDWLD DNLPKMVERLIREEIERLARG >WP_093311076 LVSEQAASASRLSLAALSALIVSPAAEPARDNTLEGLVREMLRPMLKEWLDARLPEMVE GLVAREIARIT >BAT28987 AEPLISETSEAAIGASFAELTQAIRAGELRSLEEMAQDLLRPMMREWLEENLARMVEDIV REEIRRAVTRGR >PZU09872 VPEPAMLLSKQTQAASQRALAALSGLSIDPNADANTMDGLVREMLRPMLKDWLDAHL PEMVERLVAREVARISGR >MAH04765 GVTAEATLGAFERLAQSIPVNRPGTHGHTLEDIVRDMLRPMLRQWVDENMPTIAERLV KKELERL >WP_136694877 ELAEGLTNTVAADSMRQSLAALAMLSEPSAKPQIVRSGETSLEDMVRDLLRPLMAQWL DAHLPEIVERLVKEEITRIA >WP_083548962 ATELMSQTTRLAAGAAFEELSRSLQARDGAEPSRGTNPLEDLVKEAMRPMLREWLDAN LNGIVERLVREEIQKVT >MQA65746 DPLVSGSVAAASTAALGRLAQTVNRDPGSVGNFSLGAGTTLEDMVRDMVRPMLKEWL DANLGPLVERMVKREIERMVR >KAB2836666 EEIISSAAAHEFANAFSNLENTLKAPLSSAPQLPTFDKNNVGQMTLEMIVNQMLQPLLKE WLDKHLPSLVKLLVSEQIEKI >WP_007066121 LISDNAETKVSASFSELAAVLRDEQAQRMDATVREMLQPMLSDWLEDNLPIIVERLVRE EIERVARG >MSP19964 MAEGLVSRDTEAAATRSFAGLGATVSAVTGMPLGHPQRTIEELVRELLRPMLKQWLDR NLQAIVALAVEREISCLSGRA >WP_062139950 EKLLSEDALQESASAFAELARATQKPAVQDKPFKIESAGEYTVDNLMRELLRPLLREWL DAHLPSIIRTLVAEQIEKTLQQR >OYV24965 ESPDGLVGDEISTAVVSSIGSLVNSINNERSVTISRAGVTIEDVIREEIKPLLKAWLNTHLP VLVERVVRAEIARV >WP_022691990 EGLLSSTSAEASRSAFAALTQLQVRNDEGKSNTLEGLVSDLLRPMLKEYLDRELPGIVER LVAVEVKRLA >PHS77477 LSGADTQLEAGNAFASLTSTVQKQAVTEENGPPIGELVKEALKPMLQEWLDKNLKTMV QRAVTKEIKRISTGK >WP_130153757 EFQEGLLSPQAQAATIQSFAKLAEAAHHVQSAPKSEPTSPTLDQLIGELARPMVKQWLD QHLPRLVELTVAKEIERLTK >PKU24871 EVAEESLLSPPVQAASTTALAELARAVAQERGVGLGNGGVTLEEIVREILKSLIKDWLDQ NLPYMIERIVKKEIEKM >GDX38801 ETSEDLMSAQTASIVSDHFEALAARALVDNSDMVMALTQQLMKPMLKQWLDDHLPEI VERLVQVEIKRISRQGRD >GEL63958 ESLLGTSAKAAMDRSLESLNTALEQQAAPRHTLTATTRISNGTSSSIEDIVREEVREMVR SWLDTNLPSMVENMVRAEITRMTR >PZO84687 EDILTEAAKTAALSSMAKLAGNMPITRHREYGNITLEDLVREMLHPMLRDWVSENLPS MVERLVQKELEKLAR >WP_068070837 DAAAEEAGLLPEAAAASMRDSLTALAMLAEPGASPQIVRSGETSLEGLARELMRPMLA EWLENNLPAMVEKMVAAEIARIAGKKG >MAF67980 DVSEDNSEHISDRAAEEAVGALSKLAQNVALSNRSADVTLEDIVKELVRPMLRQWINEN MSDIVEALVEKELEKLVR >MBH63242 SEGLVSREAAEQTAAAFVDFASAVSSAQGVQLGASHRTLEELVKESLRPMLKVWLDNN LQPIVSRTVEREIAKLAGRA >WP_150061170 LVEASVAAVSSQYLSTLTDSLQGRDIPIGNGAITLEGLVRQIVRELVKQWLDENLPEMTE RLVEREIQRLAKS >WP_145609868 DRLMSQFTEEAASRAFSSLSGFRRGGPSLTGEGPIGRSDVTLEEIVHVLVRPILREWLDEN LPSLVERLVKREIEKVVR >TVQ33838 LTEVLLDSGTSSIASSALQRLSAAIAPGDAVAGGQRSIEVFLADLVRPELKAWLDTNLPP LVERIVEREIKKLVR >WP_138325922 EELIAARTRAATEQSFDALHAALKREEAANAPPAAPSPMLLRGGGPSLEDMVRQELRGL LSAWLDEHLPGLVEALVRSQIEKMVRRGS
Example 2
Introduction
[0094] Biomolecular condensation is a powerful mechanism underlying cellular organization and regulation in cell physiology and disease [Boeynaems, S. et al., Trends Cell Biol 28, 420-435 (2018); Shin, Y. & Brangwynne, C. P., Science 357 (2017); Mathieu, C., Pappu, R. V. & Taylor, J. P., Science 370, 56-60 (2020)]. Many of these condensates are formed via reversible phase separation [Shin, Y. & Brangwynne, C. P., Science 357 (2017); Banani, S. F. et al., Nat Ret Mol Cell Biol 18, 285-298 (2017)], which allows for rapid sensing and responding to a range of cellular challenges [Yoo, H., Triandafillou, C. & Drummond, D. A., J Biol Chem 294, 7151-7159 (2019); Franzmann, T. M. & Alberti, S., Cold Spring Harb Perspect Biol 11 (2019)]. Biomolecular condensates can adopt a broad spectrum of material properties, from highly dynamic liquid to semi-fluid gels and solid amyloid aggregates [Banani, S. F. et al., Nat Rev Mol Cell Biol 18, 285-298 (2017); Kato, M. et al., Cell 149, 753-767 (2012); Boeynaems, S. & Gitler, A. D., Dev Cell 45, 279-281 (2018); Patel, A. et al., Cell 162, 1066-1077 (2015)]. Perturbing protein condensation can alter fitness.sup.9-1 and mutations leading to high degrees of protein aggregation and other pathological phase transitions were implicated in various degenerative diseases [Patel, A. et al., Cell 162, 1066-1077 (2015); Boeynaems, S. et al., Mol Cell 65, 1044-1055 (2017); Molliex, A. et al., Cell 163, 123-133 (2015); Ramaswami, M., Taylor, J. P. & Parker, R., Cell 154, 727-736 (2013); Scheckel, C. & Aguzzi, A., Nat Rev Genet 19, 405-418 (2018)]. However, mechanistic link between the material properties of a biomolecular condensate and cellular fitness remains largely unexplored. Here, we show that the emergent properties of condensates formed by the bacterial protein PopZ confer biological function. Moreover, based on our insights into its underlying molecular grammar, we have engineered synthetic PopZ-based condensates in human cells with tunable cellular addresses and composition.
[0095] The bacterium Caulobacter crescentus reproduces by asymmetric division [Lasker, K., Mann, T. H. & Shapiro, L., Curr Opin Microbiol 33, 131-139 (2016)], and a key player orchestrating this event is the intrinsically disordered Polar Organizing Protein Z, PopZ [Bowman, G. R. et al., Cell 134, 945-955 (2008); Ebersbach, G. et al., Cell 134, 956-968 (2008)]. PopZ self-assembles into 200 nm microdomains that are localized to the cell poles (
[0096] PopZ Phase Separates in Caulobacter Crescentus and Human Cells.
[0097] To probe the dynamic behavior of PopZ, we expressed PopZ in a strain of Caulobacter bearing an mreB.sup.A32P mutant [Dye, N. A. et al., Molecular microbiology 81, 368-394 (2011)] that leads to irregular cellular elongation with a thin polar regions and wide cell bodies [Harris, L. K., Dye, N. A. & Theriot, J. A., Mol Microbiol (2014)]. In this background, the PopZ microdomain deforms and extends into the cell body before undergoing spontaneous fission, producing spherical droplets that moved throughout the cell (
[0098] PopZ homologs are restricted to α-proteobacteria, and the sequence composition of the PopZ intrinsically disordered region (IDR) is divergent from the human disordered proteome (
[0099] PopZ IDR Tunes the Microdomain Viscosity
[0100] PopZ is composed of three functional regions [Bowman, G. R. et al., Mol Microbiol 90, 776-795 (2013); Holmes, J. A. et al., Proc Natl Acad Sci USA 113, 12490-12495 (2016)] (
[0101] The architecture of the PopZ protein from Caulobacter crescentus is conserved not only within the Caulobacterales order, to which Caulobacter crescentus belongs (
[0102] To better characterize the PopZ linker we performed all-atoms simulations. We found the linker adopts an extended conformation, with a radius of gyration (R.sub.G) of 34.4±4.8 Å and an apparent scaling exponent (v.sup.app) of 0.7, corresponding to a self-repulsing polyelectrolyte (
[0103] We generated PopZ mutants with a truncated or expanded IDR; namely, IDR-40, corresponding to half the wild-type IDR length and an IDR-156, corresponding to double the length of the wild-type IDR We tested their ability to form condensates in human cells by measuring partition coefficients compared to wild type PopZ. First, we mapped an eGFP-PopZ phase diagram as a function of concentration and IDR length. For any phase separating protein, condensates emerge as the cytoplasmic concentration exceeds the saturation concentration (C.sub.sat). At high cytoplasmic concentrations (C.sub.D), the system can then move to the dense phase regime characterized by the cytoplasm being taken over by one large droplet. We indeed observed that PopZ could occur in dilute, demixed, and dense regimes, as a function of its cytoplasmic concentration (
[0104] Given the IDR offers one means to tune PopZ material properties, we wondered if altering the degree of multivalency could be used as an orthogonal control parameter. We increased the valency of the C-terminal region containing three helices (trivalent) by repeating the last highly conserved helix-turn-helix motif (
[0105] Maintaining PopZ as a Viscous Liquid is Essential for Cell Viability
[0106] To test whether IDR length-dependent changes in PopZ condensate viscosity would affect biological function, we expressed IDR-48 and IDR-156 PopZ mutants in ΔpopZ Caulobacter cells (
[0107] Given the ability to rescue PopZ condensate material properties by combining IDR-156 with the pentavalent C-terminal region, we reasoned that this ‘double mutant’ would rescue function and fitness from the ‘single mutant’ defects observed for cells with IDR-156. In line with our expectation, PopZ with IDR-156 and pentavalent C-terminal region restored FRAP dynamics and localization to the poles (
[0108] The Net Charge and Charge Distribution of the IDR are Conserved and Tune the Material Properties of the PopZ Condensate
[0109] In addition to conserved length (
[0110] Since drastically changing the amino acid composition may affect several linker properties at once, we evaluated the role of potentially conserved primary sequence features. This allows us to explicitly test an alternative hypothesis—that the highly-charged IDR functions as a solubility tag, penalizing phase separation as a function of length. Accordingly, we constructed 17 scrambled versions of the IDR and measured their FRAP dynamics in human cells. We calculated primary sequence features for all of these mutants (Methods) and performed regression analysis to test which combination of features best explains the measured FRAP dynamics. We found that a combination of differential N-versus C acidity and differential proline enrichment best predicted experimental data with an R-square of 0.86. Notably, the values of the features used in the regression model show a narrow distribution across Caulobacterales, despite large differences in the actual primary IDR sequence.
[0111] Scramble 5 and scramble 17, with opposing differential N-versus C acidity, give rise to less dynamic or more fluid PopZ condensate compared to the wild-type protein (
[0112] Cumulatively, our results show that the function of the PopZ microdomain is tuned by its material properties. By dissecting the molecular grammar of the PopZ IDR and the OD, we propose that the PopZ material properties can be explained by a molecular push-pull strategy. The valency of the OD drives condensation, while the electrostatic repulsion of the IDR fluidizes the condensates. Moreover, we show that three hierarchical IDR features can be tuned to alter its repulsive nature. While IDR length and charge drive linker extension, local variations in IDR acidity can promote competing IDR-OD interactions. By subsequently testing an array of carefully designed mutants, we provide for the first-time evidence that condensate material properties can tune organismal fitness. Looking at the evolutionary landscape of PopZ, we find evidence suggesting that tunable IDR properties may be under selective pressure, and therefore could have helped the boom in phenotypic and ecological diversity among α-proteobacteria.
[0113] An Engineered PopTag Phase Separates into Cytoplasmic Condensates with Tunable Material Properties.
[0114] The simple modular domain architecture of PopZ, with an N-terminal client binding domain, and discrete domains that tune and drive phase separation, highlights a novel topology that is distinct from most of the currently characterized phase separating proteins (
[0115] Accumulating data indicates that cellular condensates are spatially regulated and can interact with other subcellular structures and compartments [Boeynaems, S. et al., Trends Cell Biol 28, 420-435 (2018); Wiegand, T. & Hyman, A. A., Emerg Top Life Sci, doi:10.1042/ETLS20190174 (2020)]. To test whether our designer condensates would be amenable to such specific subcellular localization, we fused the PopTag to different “cellular anchors”—tethering the condensates in the plasma membrane, on microtubules, or on the surface of lipid droplets (
[0116] We next wondered if we could functionalize the PopTag with a nanobody to facilitate specific and targeted sequestration of specific clients. In order to more closely mimic the endogenous function of PopZ in Caulobacter, we focused on the N-terminal helix. PopZ uses this domain to specifically recruit client proteins to the microdomain. We replaced the N-terminal helix with a GFP-targeting nanobody (
[0117] As a proof-of-concept study to test whether designer condensates can recapitulate specific cellular processes, we focused on the role of protein phase separation in nucleocytoplasmic transport. Nuclear import is mediated by karyopherins or importins, a class of proteins that binds to and facilitate the translation of client proteins through the nuclear pore complex. (
[0118] As IDRs code for 4% of bacterial proteomes, unlike 30-50% of eukaryotic proteomes [van der Lee, R. et al., Chem Rev 114, 6589-6631 (2014)], their role in bacteria physiology was largely overlooked. With accumulating evidence for abundance of biomolecular condensates in bacterial cells [Azaldegui, C. A., Vecchiarelli, A. G. & Biteen, J. S., Biophys J, doi:10.1016/j.bpj.2020.09.023 (2020)], and the vital role IDRs play in their formation [Cohan, M. C. & Pappu, R. V., Trends Biochem &ci 45, 668-680 (2020)], the importance of these proteins is gaining appreciation. Bacterial IDRs differ from their eukaryotic counterpartners, not only in proteome abundance, but also in amino acid composition (Extended Data
[0119] Here we studied the biophysical properties of the intrinsically disordered protein PopZ from the bacterium Caulobacter crescentus. We previously showed that PopZ forms membraneless condensates at the poles and selectively sequesters kinase-signaling cascades to regulate asymmetric cell division [Bowman, G. R. et al., Cell 134, 945-955 (2008); Ebersbach, G. et al., Cell 134, 956-968 (2008); Lasker, K. et al., Nat Microbiol 5, 418-429 (2020)]. We found that PopZ self-condenses by liquid-liquid phase separation in vivo both in Caulobacter and human cells (
[0120] Combined, our studies reveal a simple modular biomolecular platform, comprising of client recognition, tuner, and driver modules, allows for the engineering of a virtually unlimited set of designer condensates for synthetic biology (
[0121] The above examples are provided to illustrate the invention but not to limit its scope. Other variants of the invention will be readily apparent to one of ordinary skill in the art and are encompassed by the appended claims. All publications, databases, internet sources, patents, patent applications, and accession numbers cited herein are hereby incorporated by reference in their entireties for all purposes.