GENETICALLY ENCODED FLUORESCENT-IRON FERRITIN NANOPARTICLE PROBES FOR DETECTING AN INTRACELLULAR TARGET BY FLUORESCENT AND ELECTRON MICROSCOPY

20200308239 ยท 2020-10-01

Assignee

Inventors

Cpc classification

International classification

Abstract

Disclosed are probes that are expressed in a cell to label an intracellular target (such as protein or DNA) for both light and electron microscopy. The probes comprise a targeting domain that specifically binds to the intracellular target, a detection tag that can be used to detect the intracellular location of the probe using light microscopy, and a ferritin nanoparticle ferritin nanoparticle with ferroxidase activity and that stores ferric oxide. Also disclosed are nucleic acids encoding the fusion proteins and methods of their use.

Claims

1. An isolated nucleic acid molecule encoding a fusion protein, the fusion protein comprising: in an N- to C-terminal direction: a targeting domain that specifically binds to an intracellular target antigen; a detection tag; and a horse ferritin heavy chain subunit; and wherein the horse ferritin heavy chain subunit in the fusion protein self-assembles in mammalian cells to form a globular ferritin nanoparticle.

2. The nucleic acid molecule of claim 1, wherein the globular ferritin nanoparticle has ferroxidase activity and stores ferric oxide.

3. The nucleic acid molecule of claim 1, wherein the targeting domain is a single chain antibody that specifically binds to the intracellular target antigen.

4. The nucleic acid molecule of claim 1, wherein the intracellular target antigen is one of DNA, RNA, or chromatin.

5. The nucleic acid molecule of claim 1, wherein the targeting domain is selected from any one of: an MS2 stem loop binding protein, a lambda N22 RNA binding protein, a PP7 RNA stem loop coat protein, an anti-suntag scFv, an anti-GFP scFv, an anti-GFP V.sub.HH, PUFa, PUFb, FRB, FKBP, dSpCas9, or dCas13d.

6. The nucleic acid molecule of claim 5, wherein the targeting domain comprises or consists of the amino acid sequence set forth as any one of SEQ ID NOs: 27-30, 32-36, or 45.

7. The isolated nucleic acid molecule of claim 1, wherein the detection tag is detectable in cells by fluorescence microscopy.

8. The nucleic acid molecule of claim 1, wherein the detection tag is selected from a fluorescent protein or a fluorescent dye binding protein.

9. The nucleic acid molecule of claim 8, wherein the fluorescent protein comprises mCherry, and/or the fluorescent dye binding protein comprises halotag.

10. The nucleic acid molecule of claim 8, wherein the detection tag comprises or consists of the amino acid sequence set forth as any one of SEQ ID NOs: 39 or 41.

11. The nucleic acid molecule of claim 1, wherein the horse ferritin subunit comprises the amino acid sequence set forth as SEQ ID NO: 21.

12. The nucleic acid molecule of claim 1, wherein the fusion protein further comprises a nuclear localization sequence N-terminal to the targeting domain.

13. The nucleic acid molecule of claim 1, wherein the detection tag is linked to the horse ferritin subunit by a glycine-serine peptide linker.

14. The nucleic acid molecule of claim 13, wherein the glycine-serine peptide linker comprises or consists of the amino acid sequence set forth as SEQ ID NO: 37 (GGGSGGGSGGGS).

15. The nucleic acid molecule of claim 1, wherein the fusion protein comprises the amino acid sequence set forth as SEQ ID NO: 25, 26, or 43.

16. The nucleic acid molecule of claim 1, operably linked to a promoter.

17. An expression vector comprising the nucleic acid molecule of claim 15.

18. The fusion protein encoded by the nucleic acid molecule of claim 1.

19. A ferritin nanoparticle comprising the fusion protein of claim 18.

20. The ferritin nanoparticle of claim 19, further comprising a ferritin light chain.

21. A method of detecting the location of a target antigen in a mammalian cell, comprising: expressing the nucleic acid molecule of claim 1 in a mammalian host cell; and detecting the location of the detection tag and the ferritin nanoparticle in the mammalian host cell using fluorescence microscopy and electron microscopy, respectively, to detect the location of the target antigen.

22. The method of claim 21, wherein the mammalian host cell is incubated in growth medium comprising transferrin and/or ferric ammonium citrate.

Description

BRIEF DESCRIPTION OF THE FIGURES

[0012] FIGS. 1A-1C. Engineering genetically encoded FIREnano probes to label and visualize the chromatin ultrastructure of genes. (FIG. 1A) Illustration of an embodiment of the FIREnano probe subunit protein structure, from N- to C-terminus. (FIG. 1B) Schematic model showing genetically encoded ferritin nanoparticles that label green-fluorescent protein (GFP)-tagged loci in cells for light microscopy (e.g., fluorescence) and EM. The illustrated probe embodiment contains an N-terminal GFP camelid antibody (V.sub.HH) that binds to GFP tagged loci in cells, a fluorescent protein (e.g., mCherry) that can be detected by fluorescence microscopy, and a self-assembled globular ferritin nanoparticle. Ferritin self-assembles into a 24mer 12 nm iron binding particle. Iron salt is added into the cell culture media to load the ferritin nanoparticle with iron to make it visible by EM. (FIG. 1C) Work flow showing how to locate a FIREnano-labeled intracellular locus. Fluorescent signal (e.g., mCherry) from a FIREnano probe is collected to show that the probe labeled the GFP-tagged genomic locus successfully. A transmission electron microscopy (TEM) image of the same cell was also collected. The light and EM measurements were correlated to align images and locate the target region.

[0013] FIGS. 2A-2D. Genetically encoded FIREnano probes label discrete loci in cells. Plasmid encoding the GFPV.sub.HH-mCherry-E. coli ferritin FIREnano probe was transfected into cells with GFP-tagged loci under conditions for iron loading of ferritin. GFP and mCherry fluorescence was detected to localize the GFP-tag and FIREnano probe, respectively. The FIREnano probe was expressed in U2OS cells expressing ORF3-GFP that forms GFP labeled intracellular fibers (FIG. 2A), Hela cells expressing TRF1-GFP that labels telomere sequences (FIG. 2B), U2OS cells expressing LacI-GFP that labels LacO repeat sequences (artificially incorporated into Chromosome 1) (FIG. 2C), and U2OS cells expressing Connexin43 (CX43)-GFP that labels gap junctions (FIG. 2D). Arrows highlight areas of colocalized GFP and mCherry signal.

[0014] FIGS. 3A and 3B. TEM of TRF1-GFP telomere locus labeled by the GFPV.sub.HH-mCherry-E. coli ferritin. (FIG. 3A) Confocal images of DAPI, GFP, and mCherry showing successful labeling of the TRF1-GFP locus by the GFPV.sub.HH-mCherry-E. coli Ferritin. (FIG. 3B) Correlated light (left) and TEM (middle) images with high magnification TEM shown for the boxed region. Arrows highlight areas of colocalized GFP and mCherry signal.

[0015] FIGS. 4A-4E. TEM of LacI-GFP tagged LacO repeat sequences labeled by GFPV.sub.HH-mCherry-E. coli ferritin. (FIGS. 4A-4C) Confocal images of GFP, mCherry, and DAPI, showing successful labeling of GFP locus by GFPV.sub.HH-mCherry-Ferritin. (FIG. 4D) Correlated light and EM was performed. (FIG. 4E): High magnification TEM images was taken at indicated box region. Arrows highlight areas of colocalized GFP and mCherry signal.

[0016] FIGS. 5A-5E. TEM of CX43-GFP tagged gap junction which are labeled by GFPV.sub.HH-mCherry-E. coli ferritin. Confocal images of GFP (FIG. 5A), mCherry (FIG. 5B), and DAPI (FIG. 5C), showing successful labeling of the LacI-GFP locus by GFPV.sub.HH-mCherry-Ferritin. (FIGS. 5D and 5E): Correlated light and EM with high magnification TEM images shown for the boxed region.

[0017] FIG. 6. Phylogenetic tree of ferritin family proteins.

[0018] FIGS. 7A-7C. Assembly of genetically modified ferritin particles from several species. (FIG. 7A) Ferritin sequences from five species including heavy and light from human and horse, was human codon optimized and cloned into constructs with an N terminal FLAG tag. (FIG. 7B) Work flow showing how to purify FIREnano particles from mammalian cells using anti-FLAG dynal beads. (FIG. 7C) Left: Denature gel, anti-FLAG western blot is performed to detect the expression level of FLAG-ferritin. -actin signal was used as loading control. Right: Native PAGE and silver staining of purified ferritin indicating E. coli ferritin is primarily monomeric (28 kDa, lane 1). P. furiosus ferritin and H. pylori ferritin partially assemble into particles, while all mammalian ferritin (horse and human) assembled into globular nanoparticle structures (lanes 4, 5, 6, and 7) with no detectable monomer, with horse ferritin heavy chain showing the greatest level of assembly.

[0019] FIGS. 8A and 8B. Assembly of genetically modified FIREnano probes containing horse ferritin. (FIG. 8A) Four FIREnano probes (1-4) are depicted. These probes were expressed in mammalian cells and detected by mCherry fluorescence or Halotag labeling to show that they do not aggregate in cells (lower images). (FIG. 8B) Left: Denaturing gel, anti-FLAG western blot is performed to detect the expression level of the FIREnano probes. -actin signal was used as a loading control. Middle: Native PAGE and silver staining of purified FIREnano probes showing that they all assemble into particles (lanes 1-4 correspond to probes 1-4, respectively), with pure apoferritin and ferritin as controls. Right: Native PAGE, prussian blue and 3,3-Diaminobenzidine (DAB) staining showing the relative amount of Ferric iron loaded inside each ferritin under normal cell culture condition, with commercial pure apoferritin and ferritin as negative and positive control.

[0020] FIG. 9. Optimization of iron loading efficiency of genetically modified FIREnano probes. The FIREnano probes 1-4 from FIG. 8 were expressed in human cells and an iron source (transferrin or ferric ammonium citrate (FAC)) was added to the cell culture media to increase the iron loading efficiency. Lane 1: normal condition. Lane 2: transferrin. Lane 3: 100 M FAC. Lane 4: 500 M FAC. Upper panel: Native PAGE and silver staining of purified FIREnano probes indicates the relative expression level. Iron-loaded ferritin purified from spleen was used as a standard. Lower panel: Native gel, prussian blue and DAB staining showing the relative amount of ferric iron loaded inside ferritin particles in each condition. Normalized loading efficiency was calculated by normalizing band value from Prussian blue+DAB staining relative to sliver staining. The 500 M FAC condition provided the greatest level of iron loading for the FIREnano probe.

[0021] FIGS. 10A-10C. TEM and Cryo-EM of purified Flag-tagged horse ferritin nanoparticles. (FIG. 10A) TEM of commercial purchased horse spleen ferritin after 2% uranyl acetate (UA) staining, no staining, or 1% osmium staining. (FIG. 10B) TEM of purified FLAG-NLS-GFPV.sub.HH-horse ferritin followed the same staining procedure. Arrow heads indicate iron core of ferritin particles. (FIG. 10C) Cryo-EM of the same sample. Arrow heads indicate iron loaded ferritin particles. Arrows indicate empty ferritin particles.

[0022] FIGS. 11A-11D. Fluorescence and EM imaging of GFPV.sub.HH-mCherry-horse ferritin labeled ORF3-GFP fibers. U2OS cells expressing ORF3-GFP were transfected with plasmid encoding GFPV.sub.HH-mCherry-ferritin and the cells were cultured with 500 M FAC to iron-load the FIREnano probe. (FIGS. 11A-11C) confocal images of GFP (ORF3-GFP), mCherry (GFPV.sub.HH-mCherry-ferritin), and DRAQ5 are shown. Arrows highlight areas of colocalized GFP and mCherry signal. (FIG. 11D) Correlated TEM image of the arrow region in 11A-11C. High magnification images is shown in boxed inset.

[0023] FIG. 12. Electron energy loss spectroscopy (EELS) imaging of ORF3-GFP fibers labeled with the GFPV.sub.HH-mCherry-ferritin FIREnano probe. Left panel: TEM; middle panel: Fe EELS; right panel: overlay of TEM and EELS images.

[0024] FIGS. 13A-13D. EM Tomography imaging of ORF3-GFP fibers labeled with the GFPV.sub.HH-mCherry-ferritin FIREnano probe. U2OS cells expressing ORF3-GFP were transfected with plasmid encoding GFPV.sub.HH-mCherry-ferritin and the cells were cultured with 500 M FAC to iron-load the resulting FIREnano probe. (FIGS. 13A-13C) confocal images of GFP (ORF3-GFP), mCherry (GFPV.sub.HH-mCherry-ferritin), and DRAQ5 signal are shown. Arrows highlight areas of colocalized GFP and mCherry signal. (FIG. 13D) Correlated EM tomography images of the arrow region in 13A-13C. Images of 40 serial 1 nm thick sections were projected and shown.

[0025] FIGS. 14A and 14B. TEM of TRF1-GFP telomere region labeled by GFPV.sub.HH-Halo-ferritin and GFPV.sub.HH-mCherry-ferritin. TRF1-GFP Hela cells were transfected with plasmid encoding GFPV.sub.HH-mCherry-ferritin (FIG. 14A), or GFPV.sub.HH-Halo-ferritin (FIG. 14B) and the cells were cultured with 500 M FAC to iron-load the resulting FIREnano probes. Confocal images of GFP and mCherry signal (FIG. 14A) or GFP and halo tag signal (FIG. 14B) are shown. After performing correlated light and EM, TEM images were taken from two spots of each cell. Diameter of individual telomere as indicated by ferritin labels was measured and shown.

[0026] FIGS. 15A-15E. Combination of ferritin labeling and ChromEM. Hela cells expressing TRF1-GFP were transfected with plasmid encoding GFPV.sub.HH-mCherry-ferritin and the cells were cultured with 500 M FAC to iron-load the resulting FIREnano probe. (FIGS. 15A-15C) confocal images of GFP (TRF1-GFP), mCherry (GFPV.sub.HH-mCherry-ferritin), and DRAQ5 signal are shown. (FIGS. 15D and 15E) Transmitted light images of pre and post-DRAQ5 photo-oxidation. Arrows highlight areas of colocalized GFP and mCherry signal.

[0027] FIG. 16. ChromEMT (EM tomogram) of GFPV.sub.HH-mCherry-ferritin labeled telomere region with chromatin labeled through DRAQ5 photo-oxidation. Hela cells expressing TRF1-GFP were transfected with plasmid encoding GFPV.sub.HH-mCherry-ferritin and the cells were cultured with 500 M FAC to iron-load the resulting FIREnano probe. Left: Selection of a telomere for subsequent electron tomography. Middle: Projection of 140 tomogram slices showing both iron core from ferritin particles (arrow heads) and also chromatin fibers (arrows). Right: A single tomographic slice (1 nm thickness) showing ultrastructure of telomere chromatin labels with ferritin particles (dark spots, arrow heads).

[0028] FIGS. 17A-17D. TEM and EMT imaging of ferritin labeled Cx43-GFP gap junction. U2OS cells expressing connexin43(CX43)-GFP were transfected with plasmid encoding GFPV.sub.HH-mCherry-horse ferritin and the cells were cultured with 500 M FAC to iron-load the resulting FIREnano probe. (FIG. 17A) Confocal images of gap junction structure with CX43-GFP and GFPV.sub.HH-mCherry-ferritin, staining overlapped. (FIG. 17B) TEM of GFPV.sub.HH-mCherry-ferritin labeled CX43-GFP gap junction; the boxed area of FIG. 17A is shown. (FIG. 17C) Confocal images of gap junction structure region are collected. Connexin43-GFP, GFPV.sub.HH-Halo-ferritin, DAPI are overlapped. (FIG. 17D) 4 tilt EMT was performed on GFPV.sub.HH-Halo-horse ferritin labeled Cx43-GFP gap junction. 30 tomogram slices were projected together; the boxed area of FIG. 17C is shown. Arrows indicate individual ferritin particles.

[0029] FIGS. 18A and 18B. Overview of U2OS cell line containing LacO and Tet On promoter genomic insert in Chromosome 1. (FIG. 18A) Schematic representation of the genomic insert. About 4 Mb sequences containing 200 gene arrays are artificially incorporated into chromosome 1 in the U2OS cell line. In each gene array, there are about 256 lacO binding sites, 96 Tet On promoter repeats, a mini CMV promoter, a CFP-SKL reporter which will locate in peroxisome in cytoplasm, and 24 MS2 stem loops, intron and exon. The CFP-SKL expression can be induced by adding doxycycline to the cell culture media. As depicted in the schematic, the FIREnano probe (e.g., GFPV.sub.HH-Halo-horse ferritin) can be applied to label LacI-GFP which binds to LacO sequences in both silent (without doxycycline, Dox) and active (with doxycycline, +Dox) state. (FIG. 18B) The modified cell line was transfected with GFPV.sub.HH-mCherry-ferritin encoding plasmid. Confocal images are collected to show GFPV.sub.HH-Halo-horse ferritin can successfully label LacI-GFP in both silent (upper) and active (bottom) state. The CFP signal was collected by wide-field fluorescent microscope.

[0030] FIGS. 19A-19F. TEM of LacI-GFP tagged LacO repeat sequences labeled with GFPV.sub.HH-mCherry-horse ferritin. The modified cell line described in FIG. 18 was transfected with plasmid encoding GFPV.sub.HH-mCherry-ferritin and the cells were cultured with 500 M FAC to iron-load the resulting FIREnano probe. Confocal images show GFP (FIG. 19A) and mCherry (FIG. 19B) signal. (FIG. 19C) The DRAQ5 signal is shown merged with the images from FIG. 19A and FIG. 19B. (FIG. 19D) Correlated light and EM. (FIG. 19E) TEM image showing ferritin nanoparticles (dark spots). (FIG. 19F) High magnification of box region in FIG. 19E.

[0031] FIGS. 20A and 20B. The FIREnano probe labels Lad GFP-tagged LacO sequences with and without the presence of doxycycline. The modified cell line described in FIG. 18 was transfected with plasmid encoding GFPV.sub.HH-mCherry-ferritin and the cells were cultured with 500 M FAC to iron-load the resulting FIREnano probe. Doxycycline was added (FIG. 20B) or not (FIG. 20A) to the cell culture media. Confocal images of GFP and mCherry are shown, as are TEM and Correlated light and EM images. Arrows highlight areas of colocalized GFP and mCherry signal.

[0032] FIGS. 21A-21E. EM tomography was performed on the region of FIREnano labeled LacO sequences in the silent state. The modified cell line described in FIG. 18 was transfected with plasmid encoding GFPV.sub.HH-mCherry-ferritin and the cells were cultured with 500 M FAC to iron-load the resulting FIREnano probe. The cells were cultured without the presence of doxycycline. (FIG. 21A) Confocal image showing fluorescent (mCherry) signal from FIREnano probes. (FIG. 21B) Image of one single tomogram slice (#61). (FIG. 21C) High magnification images of the boxed region in FIG. 21B, with FIREnano labels indicated by arrow. (FIG. 21D) Images from 100 tomography slices were projected to show the general distribution of FIREnano probes. (FIG. 21E) The FIREnano label is segmented and 3D distribution was displayed. The FIREnano distribution under silent state indicate LacO array formed a compact sphere structure.

[0033] FIGS. 22A-22E. EM tomography was performed on the region of FIREnano labeled LacO sequences in the silent state. The modified cell line described in FIG. 18 was transfected with plasmid encoding GFPV.sub.HH-mCherry-ferritin and the cells were cultured with 500 M FAC to iron-load the resulting FIREnano probe. The cells were cultured with the presence of doxycycline. (FIG. 22A) Confocal image showing fluorescent (mCherry) signal from FIREnano probes. (FIG. 22B) Image of one single tomogram slice (#39). (FIG. 22C) High magnification images of the boxed region in FIG. 21B, with FIREnano labels indicated by arrow. (FIG. 22D) Images from 100 tomography slices were projected to show the general distribution of FIREnano probes. (FIG. 22E) FIREnano labels is segmented and 3D distribution was displayed. The FIREnano distribution under active state indicate LacO array occupy a bigger area than in silent state and is a more open structure.

SEQUENCE LISTING

[0034] The nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. The Sequence Listing is submitted as an ASCII text file in the form of the file named Sequence.txt (30 kb), which was created on Jun. 8, 2020, which is incorporated by reference herein. In the accompanying sequence listing:

TABLE-US-00001 SEQIDNO:1isanexemplarynucleotidesequenceencodingNLS-GFPV.sub.HH-GS linker-mCherry-GSlinker-E.coliferritin. atgcccaaaaagaagaggaaagtgggatcgggtatggcagatgttcaattggtagaaagtggtggagcactcgtaca gcctggtggttctcttcgactgtcatgcgcagcttcaggatttccagtgaatagatatagtatgagatggtatagac aagcccctggaaaagaaagagagtgggtggccggaatgtcctcagccggagatagaagtagttatgaagatagtgtt aaaggacgatttacaatttcaagagatgatgcaagaaatacagtttacctccaaatgaatagtcttaaacctgaaga tacagcagtttattattgtaatgttaacgtgggattcgaatactggggtcagggaacacaagtaacggtaagtagcg gttcaggctggagccacccgcagttcgaaaaaggatccgggcatcaccatcatcaccacggatccgggcccaagaaa aagcgcaaggtaatggtgagcaagggcgaggaggataacatggccatcatcaaggagttcatgcgcttcaaggtgca catggagggctccgtgaacggccacgagttcgagatcgagggcgagggcgagggccgcccctacgagggcacccaga ccgccaagctgaaggtgaccaagggtggccccctgcccttcgcctgggacatcctgtcccctcagttcatgtacggc tccaaggcctacgtgaagcaccccgccgacatccccgactacttgaagctgtccttccccgagggcttcaagtggga gcgcgtgatgaacttcgaggacggcggcgtggtgaccgtgacccaggactcctccctgcaggacggcgagttcatct acaaggtgaagctgcgcggcaccaacttcccctccgacggccccgtaatgcagaagaagaccatgggctgggaggcc tcctccgagcggatgtaccccgaggacggcgccctgaagggcgagatcaagcagaggctgaagctgaaggacggcgg ccactacgacgctgaggtcaagaccacctacaaggccaagaagcccgtgcagctgcccggcgcctacaacgtcaaca tcaagttggacatcacctcccacaacgaggactacaccatcgtggaacagtacgaacgcgccgagggccgccactcc accggcggcatggacgagctgtacaagggatccggctcaggatctatgaagggcgacaccaaggtcatcaactacct gaacaagttgctggggaacgaactcgtggccatcaaccagtacttcctgcacgcacgcatgttcaagaactggggcc tgaagcgcctgaacgatgtggagtaccacgagtccatcgacgagatgaagcacgccgatagatacatcgagcggatt ctgtttctggaaggacttccgaatttgcaagacctggggaagctgaatatcggagaggatgtggaggaaatgctgag aagcgacctcgcgctggaacttgatggtgccaagaacctcagggaagccattggatacgctgactcggtgcacgact acgtgtcacgggacatgatgatcgagatcctgcgcgacgaagaaggccacattgactggctcgaaactgagctggac ctgatccagaagatgggactccagaactatctgcaagcgcagattcgggaagagggttaa SEQIDNO:2isanexemplarynucleotidesequenceencodingFLAG-E.coli ferritin. atggactacaaggaccacgatggtgattataaggatcatgatatagactataaggacgacgacgacaagggaggagg gtccggcggcggaagtggcggtggctcaatgttgaaacctgagatgattgagaaacttaatgaacagatgaatttgg aactttacagttccttgttgtatcagcaaatgagtgcttggtgcagctatcatacgtttgagggtgcggcagcgttc ttgcggaggcatgcgcaggaggaaatgacccacatgcagagactttttgattacctcactgataccggaaatcttcc tcgaatcaacacggtagaaagccctttcgccgaatatagtagcttggacgagctgtttcaagaaacgtacaaacacg agcagctcatcacacagaagataaatgagctggctcatgctgcaatgaccaatcaagactaccctacatttaacttt ctgcagtggtatgtgagtgaacaacacgaagaagagaaactgttcaaatctattattgataaacttagtctcgctgg taagtccggtgagggtttgtatttcatagacaaagaactctccactcttgatacccagaactaa SEQIDNO:3isanexemplarynucleotidesequenceencodinghorseferritin heavychain. atgactaccgcttttccctcccaagttaggcaaaattaccatcaagacagcgaagctgctatcaaccgccagatcaa tcttgagctccacgcttcctatgtctatctgtctatgtccttttattttgatagagatgacgtcgcactgaagaact tcgctaagtacttcctgcatcagagtcacgaggaaagggagcacgctgaaaagcttatgaaactgcaaaatcaacgg ggggggcgcatcttccttcaggatataaaaaagcctgaccaagatgactgggagaacggcctcaaggctatggaatg cgctctccatctggagaagaacgtaaatgagtctttgctggagctgcacaagctggcgacagacaaaaatgacccgc atttgtgtgatttcctggaaactcattatcttaatgaacaagtgaaggctattaaagaattgggcgatcatgtaacg aacctgagaaggatgggggcacctgaatcagggatggccgaatatctgttcgataagcatacattgggtgagtgtga cgaatcttga SEQIDNO:4isanexemplarynucleotidesequenceencodingFLAG-helicobacter ferritin. atggactataaggaccatgatggcgattataaagaccatgacattgattataaggacgacgacgataagggcggcgg cagcggggggggctccggcggtggctctatgttgagtaaagacatcataaaactcctgaatgagcaggtaaacaaag agatgcagtcaagcaacctctacatgtcaatgtcctcttggtgttacacacattctctggatggggcgggcttgttc cttttcgaccacgcagcggaagagtatgagcacgcaaagaaactgattatttttctcaacgagaataacgtgccggt tcagcttacctcaatcagcgcccccgagcacaaattcgagggcttgactcaaatcttccaaaaagcgtatgagcacg agcaacacataagtgaatccattaacaacatagtggaccacgctattaagtccaaagatcacgcaacctttaatttc ctgcagtggtatgttgccgaacaacatgaggaagaggttctttttaaagatatactggataagatagaactcatcgg gaacgaaaatcatgggttgtacctcgctgatcagtacgtaaaaggaatagctaaatcaagaaaaagttga SEQIDNO:5isanexemplarynucleotidesequenceencodingFLAG-human ferritinheavychain. atggattacaaggaccatgacggggattataaggaccatgatattgactataaagacgacgatgataaaggaggcgg cagtggtggtggtagtggcggtggatccatgtcttcacaaatacgacaaaactactccaccgatgtagaggcggcgg tcaatagcctggttaatttgtatctgcaagcatcatatacgtacctgtccctgggtttttacttcgatagggacgat gttgccctggaaggtgttagccattttttccgcgagttggcagaagaaaaaagggagggttacgagaggcttctgaa aatgcagaatcagcggggtggtagagctttgtttcaagatataaaaaagcctgccgaggacgaatggggcaagactc ctgatgccatgaaggcggccatggccttggaaaaaaagttgaaccaggcactcctcgatctgcatgctctcggcagc gcccggacggacccccacttgtgtgactttttggaaacacattttctggacgaggaagtgaagctcattaaaaaaat gggggaccacttgactaatctgcaccgccttgggggtccagaagccggattgggcgaatatctttttgagagactca ccttgaagcatgattga SEQIDNO:6isanexemplarynucleotidesequenceencodingFLAG-NLS- GFPV.sub.HH-GSlinker-horseferritinheavychain. atggactacaaggaccacgatggcgattataaagatcacgacatagattacaaagatgatgatgataagcctaagaa gaagcgaaaagttggcatggcggatgttcagctcgtagagtctggcggcgcactggtgcaacccggtggctccctgc gcttgagctgtgctgcttcaggatttcccgtgaacagatattccatgcgctggtatcggcaggctcctggaaaagag cgagagtgggtcgcagggatgtcctccgccggtgataggagctcatacgaagacagcgttaagggacgctttacaat ctctcgagatgacgcccgcaataccgtctacctgcagatgaacagtcttaagcctgaggataccgcagtttattatt gtaacgtgaatgtcggttttgagtactgggggcagggcacgcaggtgacagtttcttccggcggcggtagtggaggc ggatcagggggcggtagcatgacaaccgcttttcccagtcaggttcggcaaaactaccatcaggacagcgaagcagc gatcaatcgacaaattaacctcgagctccatgctagctacgtttacttgagtatgtccttctattttgatcgcgacg atgttgcgttgaaaaatttcgctaagtatttcttgcaccagtcacatgaggaacgcgagcatgcggaaaagttgatg aagctgcaaaaccagcgaggcgggcgcattttccttcaagacatcaaaaagccagatcaggatgattgggagaacgg ccttaaggcaatggagtgtgcgctccaccttgaaaagaatgtcaacgaatccctgctcgaactccataagctggcga ccgacaaaaatgatcctcacctttgcgattttctggagacacattatctgaatgagcaagtgaaagcaataaaggag ttgggtgatcatgtcacaaaccttagacggatgggggcaccagaatccggaatggcagaatacttgtttgataagca tacgctgggtgagtgtgatgaatcttag SEQIDNO:7isanexemplarynucleotidesequenceencodingFLAG-NLS- GFPV.sub.HH-GSlinker-mCherry-GSlinker-horseferritinheavychain. atggattacaaagatcacgacggagattataaggatcacgatatcgattataaagacgatgatgacaaacccaaaaa aaagcgcaaagttggtatggcggatgtgcagttggttgagtctggcggggcactcgtgcagccggggggtagtctga gattgagttgtgccgcctccggatttccagtcaacagatattcaatgcgctggtatcgacaggcgccagggaaagag agagaatgggttgcgggtatgtcatcagcgggtgatcgatcctcttacgaggattcagtgaaagggcggtttacaat aagccgagatgacgccagaaatacggtatacctccagatgaactccctcaagccggaagatacggcagtttactatt gtaacgttaatgttggatttgagtattggggccaaggaacgcaagtgaccgtcagcagtggtggtggaagtggcgga gggtcaggaggcggatctatggttagcaagggcgaggaggataatatggccattatcaaagaattcatgcgctttaa ggtccacatggagggtagtgtcaacggtcatgaatttgagatagagggtgaaggggaaggtaggccttacgagggta ctcaaactgcgaaattgaaagtcacaaaggggggtcccctcccttttgcgtgggatatactctccccacaatttatg tacggttcaaaagcctatgttaagcaccctgcggacatccccgactacctgaaactcagttttcctgaaggcttcaa gtgggagcgggtcatgaattttgaggacggtggggtcgtaacggtcactcaggactcatctcttcaagatggtgagt ttatctataaagtaaagttgcgcggtactaactttccgtccgacggaccagtaatgcaaaaaaaaacaatgggttgg gaggcttcatccgaacggatgtatcccgaagacggggctctcaagggtgagattaaacaaaggcttaaactgaagga tggaggccattacgatgctgaagttaaaaccacgtataaagcgaagaaacccgttcagctgcctggtgcatataatg tgaatatcaaattggatataacctcacacaatgaggactatactatcgtagaacaatatgaacgggcggaaggacga cactcaaccgggggaatggatgaactttataaagggggaggaagcgggggagggtctgggggtggttcaggcggggg atcaggtggcgggagtatgactactgcattcccgagccaagtgcggcagaattaccaccaggactctgaagcggcca tcaaccgacaaatcaacctggaactgcatgcgtcttacgtttatctgtcaatgagcttttactttgatagagacgat gtcgcattgaagaacttcgccaaatattttcttcatcagagccatgaggaaagggaacatgcagaaaaacttatgaa attgcagaaccagcgcggtggaaggattttcctccaagacataaagaaaccggatcaggacgactgggagaatggcc tgaaggcaatggaatgtgcacttcacctcgaaaagaacgtgaacgagagcctcctggaactgcataaattggccact gacaaaaacgatccacacctgtgcgatttccttgagactcattatcttaacgagcaagtgaaagcaattaaagagtt gggtgatcatgtcactaacctgagacgcatgggggcaccagaaagcggcatggcagagtatttgtttgacaagcata cacttggtgagtgtgacgagtcttga SEQIDNO:8isanexemplarynucleotidesequenceencodingFLAG-NLS- GFPV.sub.HH-GSlinker-halotag-GSlinker-horseferritinheavychain. atggattacaaagatcacgacggagattataaggatcacgatatcgattataaagacgatgatgacaaacccaaaaa aaagcgcaaagttggtatggcggatgtgcagttggttgagtctggcggggcactcgtgcagccggggggtagtctga gattgagttgtgccgcctccggatttccagtcaacagatattcaatgcgctggtatcgacaggcgccagggaaagag agagaatgggttgcgggtatgtcatcagcgggtgatcgatcctcttacgaggattcagtgaaagggcggtttacaat aagccgagatgacgccagaaatacggtatacctccagatgaactccctcaagccggaagatacggcagtttactatt gtaacgttaatgttggatttgagtattggggccaaggaacgcaagtgaccgtcagcagtggtggtggaagtggcgga gggtcaggaggcggatctgaaatcggtactggctttccattcgacccccattatgtggaagtcctgggcgagcgcat gcactacgtcgatgttggtccgcgcgatggcacccctgtgctgttcctgcacggtaacccgacctcctcctacgtgt ggcgcaacatcatcccgcatgttgcaccgacccatcgctgcattgctccagacctgatcggtatgggcaaatccgac aaaccagacctgggttatttcttcgacgaccacgtccgcttcatggatgccttcatcgaagccctgggtctggaaga ggtcgtcctggtcattcacgactggggctccgctctgggtttccactgggccaagcgcaatccagagcgcgtcaaag gtattgcatttatggagttcatccgccctatcccgacctgggacgaatggccagaatttgcccgcgagaccttccag gccttccgcaccaccgacgtcggccgcaagctgatcatcgatcagaacgtttttatcgagggtacgctgccgatggg tgtcgtccgcccgctgactgaagtcgagatggaccattaccgcgagccgttcctgaatcctgttgaccgcgagccac tgtggcgcttcccaaacgagctgccaatcgccggtgagccagcgaacatcgtcgcgctggtcgaagaatacatggac tggctgcaccagtcccctgtcccgaagctgctgttctggggcaccccaggcgttctgatcccaccggccgaagccgc tcgcctggccaaaagcctgcctaactgcaaggctgtggacatcggcccgggtctgaatctgctgcaagaagacaacc cggacctgatcggcagcgagatcgcgcgctggctgtccacgctcgagatttccggcgggggaggaggcagcggggga gggggttctgggggtggtggatcaggcgggggaggctcaggtggcgggggaagtatgactactgcattcccgagcca agtgcggcagaattaccaccaggactctgaagcggccatcaaccgacaaatcaacctggaactgcatgcgtcttacg tttatctgtcaatgagcttttactttgatagagacgatgtcgcattgaagaacttcgccaaatattttcttcatcag agccatgaggaaagggaacatgcagaaaaacttatgaaattgcagaaccagcgcggtggaaggattttcctccaaga cataaagaaaccggatcaggacgactgggagaatggcctgaaggcaatggaatgtgcacttcacctcgaaaagaacg tgaacgagagcctcctggaactgcataaattggccactgacaaaaacgatccacacctgtgcgatttccttgagact cattatcttaacgagcaagtgaaagcaattaaagagttgggtgatcatgtcactaacctgagacgcatgggggcacc agaaagcggcatggcagagtatttgtttgacaagcatacacttggtgagtgtgacgagtcttga SEQIDNO:9isanexemplarynucleotidesequenceencodingMS2stemloop bindingprotein(MCP). atggcttctaactttactcagttcgttctcgtcgacaatggcggaactggcgacgtgactgtcgccccaagcaactt cgctaacgggatcgctgaatggatcagctctaactcgcgttcacaggcttacaaagtaacctgtagcgttcgtcaga gctctgcgcagaatcgcaaatacaccatcaaagtcgaggtgcctaaaggcgcctggcgttcgtacttaaatatggaa ctaaccattccaattttcgccacgaattccgactgcgagcttattgttaaggcaatgcaaggtctcctaaaagatgg aaacccgattccctcagcaatcgcagcaaactccggcatctac SEQIDNO:10isanexemplarynucleotidesequenceencodinglambdaN22 RNAbindingprotein(N22p). atgggtaatgctcggacccggcgaagagagaggcgggctgagaagcaggcacagtggaaggctgcaaac SEQIDNO:11isanexemplarynucleotidesequenceencodingPP7RNAstem loopcoatprotein(PCP). atgggttccaaaaccatcgttctttcggtcggcgaggctactcgcactctgactgagatccagtccaccgcagaccg tcagatcttcgaagagaaggtcgggcctctggtgggtcggctgcgcctcacggcttcgctccgtcaaaacggagcca agaccgcgtatcgcgtcaacctaaaactggatcaggcggacgtcgttgattccggacttccgaaagtgcgctacact caggtatggtcgcacgacgtgacaatcgttgcgaatagcaccgaggcctcgcgcaaatcgttgtacgatttgaccaa gtccctcgtcgcgacctcgcaggtcgaagatcttgtcgtcaaccttgtgccgctgggccgt SEQIDNO:12isanexemplarynucleotidesequenceencodinganti-suntag scFv. atgggtccagacatagtgatgacgcagagtccgtctagtctctcagcttctgtcggcgaccgggttactattacatg ccgctccagcactggagcagtgacaacgtctaactacgcttcatgggttcaagaaaagccaggaaaactcttcaaag gcctgattggtgggaccaacaatcgagcacccggtgttcctagccggttttctggcagcctcataggagataaagcg acgctgactatatcaagtttgcaacctgaggatttcgccacatacttctgcgccctttggtattccaaccactgggt cttcggacaaggcactaaggtggaactgaagagaggcggtggcggctccggcggtggtggctccgggggcggcgggt ccagcggtggtgggagcgaagtaaagttgctcgaatccgggggaggactcgtgcaacccggaggatcattgaaactg tcctgcgcggtgtcaggattctcactcacagactacggagtaaattgggttcgccaagctccgggccggggtctgga atggatcggcgtgatctggggcgatggtatcaccgactataactctgcactcaaagataggtttatcatttccaaag acaatgggaagaacacggtatacctgcagatgtctaaggtgagaagcgatgacacagcgttgtattattgtgtgact gggctttttgattattggggtcagggcacactcgtgactgtctccagc SEQIDNO:13isanexemplarynucleotidesequenceencodinganti-mCherry V.sub.HH. atggctcaagttcagcttgtcgagagcggcggcagtttggttcaacctggaggtagtcttcggctctcttgcgcggc tagtgggcggtttgcggagtcttctagtatggggtggtttcggcaggccccaggcaaagaacgcgagtttgttgcag cgattagttggagtggtggggcgacgaattatgcagatagcgcaaagggccgatttacgcttagccgggacaacact aagaacaccgtttacttgcaaatgaactcattgaaaccggacgatacagcggtttattactgcgcggccaacttggg gaactatatatcaagcaaccagaggctctacggttactggggccaagggacgcaagttacagtatctagccctttca cg SEQIDNO:14isanexemplarynucleotidesequenceencodingPUFa. tctagaggccgcagccgccttttggaagattttcgaaacaaccggtaccccaatttacaactgcgggagattgctgg acatataatggaattttcccaagaccagcatgggtccagattcattcagctgaaactggagcgtgccacaccagctg agcgccagcttgtcttcaatgaaatcctccaggctgcctaccaactcatggtggatgtgtttggtaattacgtcatt cagaagttctttgaatttggcagtcttgaacagaagctggctttggcagaacggattcgaggccacgtcctgtcatt ggcactacagatgtatggcagccgtgttatcgagaaagctcttgagtttattccttcagaccagcagaatgagatgg ttcgggaactagatggccatgtcttgaagtgtgtgaaagatcagaatggcaatcacgtggttcagaaatgcattgaa tgtgtacagccccagtctttgcaatttatcatcgatgcgtttaagggacaggtatttgccttatccacacatcctta tggctgccgagtgattcagagaatcctggagcactgtctccctgaccagacactccctattttagaggagcttcacc agcacacagagcagctggtacaggatcaatatggaaattatgtaatccaacatgtactggagcacggtcgtcctgag gataaaagcaaaattgtagcagaaatccgaggcaatgtacttgtattgagtcagcacaaatttgcaagcaatgttgt ggagaagtgtgttactcacgcctcacgtacggagcgcgctgtgctcatcgacgaggtgtgcaccatgaacgacggtc cccacagtgccttatacaccatgatgaaggaccagtatgccaactacgtggtccagaagatgattgacgtggcggag ccaggccagcggaagatcgtcatgcataagatccggccccacatcgcaactcttcgtaagtacacctatggcaagca cattctggccaagctggagaagtactacatgaagaacggtgttgacttaggggggccggcc SEQIDNO:15isanexemplarynucleotidesequenceencodingPUFb. tctagaggccgcagccgccttttggaagattttcgaaacaaccggtaccccaatttacaactgcgggagattgctgg acatataatggaattttcccaagaccagcatgggtccagattcattcagctgaaactggagcgtgccacaccagctg agcgccagcttgtcttcaatgaaatcctccaggctgcctaccaactcatggtggatgtgtttggtaattacgtcatt cagaagttctttgaatttggcagtcttgaacagaagctggctttggcagaacggattcgaggccacgtcctgtcatt ggcactacagatgtatggctgccgtgttatccagaaagctcttgagtttattccttcagaccagcagaatgagatgg ttcgggaactagatggccatgtcttgaagtgtgtgaaagatcagaatggcaatcacgtggttcagaaatgcattgaa tgtgtacagccccagtctttgcaatttatcatcgatgcgtttaagggacaggtatttgccttatccacacatcctta tggctgccgagtgattcagagaatcctggagcactgtctccctgaccagacactccctattttagaggagcttcacc agcacacagagcagctggtacaggatcaatatggaagttatgtaatcgaacatgtactggagcacggtcgtcctgag gataaaagcaaaattgtagcagaaatccgaggcaatgtacttgtattgagtcagcacaaatttgcaaacaatgttgt gcagaagtgtgttactcacgcctcacgtacggagcgcgctgtgctcatcgatgaggtgtgcaccatgaacgacggtc cccacagtgccttatacaccatgatgaaggaccagtatgccaactacgtggtccagaagatgattgacgtggcggag ccaggccagcggaagatcgtcatgcataagatccggccccacatcgcaactcttcgtaagtacacctatggcaagca cattctggccaagctggagaagtactacatgaagaacggtgttgacttaggggggccggcc SEQIDNO:16isanexemplarynucleotidesequenceencodingFRB. gagatgtggcatgaaggcctagaagaggcctctcgcttgtactttggggagaggaacgtcaaaggcatgtttgaggt gctggagcccctgcatgctatgatggaacgcggtccccagaccctgaaggaaacgtcctttaatcaggcatatggtc gagatttaatggaggcacaagaatggtgccgaaagtacatgaaatcagggaacgtcaaggacctcctccaagcctgg gacctctactatcacgtgttcagacgaatctcaaagcag SEQIDNO:17isanexemplarynucleotidesequenceencodingFKBP. ggagtgcaggtggaaaccatctccccaggagacgggcgcaccttccccaagcgcggccagacctgcgtggtgcacta caccgggatgcttgaagatggaaagaaatttgattcctcccgggacagaaacaagccctttaagtttatgctaggca agcaggaggtgatccgaggctgggaagaaggggttgcccagatgagtgtgggtcagagagccaaactgactatatct ccagattatgcctatggtgccactgggcacccaggcatcatcccaccacatgccactctcgtcttcgatgtggagct tctaaaactg SEQIDNO:18isanexemplarynucleotidesequenceencodingdSpCas9. gacaagaagtactccattgggctcgctatcggtaccaacagcgtcggctgggccgtcattacggacgagtacaaggt gccgagcaaaaaattcaaagttctgggcaataccgatcgccacagcataaagaagaacctcattggagccctcctgt tcgactccggggagacggccgaagccacgcggctcaaaagaacagcacggcgcagatatacccgcagaaagaatcgg atctgctacctgcaggagatctttagtaatgagatggctaaggtggatgactctttcttccataggctggaggagtc ctttttggtggaggaggataaaaagcacgagcgccacccaatctttggcaatatcgtggacgaggtggcgtaccatg aaaagtacccaaccatatatcatctgaggaagaagctggtagacagtactgataaggctgacttgcggttgatctat ctcgcgctggcgcacatgatcaaatttcggggacacttcctcatcgagggggacctgaacccagacaacagcgatgt cgacaaactctttatccaactggttcagacttacaatcagcttttcgaggagaacccgatcaacgcatccggcgttg acgccaaagcaatcctgagcgctaggctgtccaaatcccggcggctcgaaaacctcatcgcacagctccctggggag aagaagaacggcctgtttggtaatcttatcgccctgtcactcgggctgacccccaactttaaatctaacttcgacct ggccgaagatgccaagctgcaactgagcaaagacacctacgatgatgatctcgacaatctgctggcccagatcggcg accagtacgcagacctttttttggcggcaaagaacctgtcagacgccattctgctgagtgatattctgcgagtgaac acggagatcaccaaagctccgctgagcgctagtatgatcaagcgctatgatgagcaccaccaagacttgactttgct gaaggcccttgtcagacagcaactgcctgagaagtacaaggaaattttcttcgatcagtctaaaaatggctacgccg gatacattgacggcggagcaagccaggaggaattttacaaatttattaagcccatcttggaaaaaatggacggcacc gaggagctgctggtaaagctgaacagagaagatctgttgcgcaaacagcgcactttcgacaatggaagcatccccca ccagattcacctgggcgaactgcacgctatcctcaggcggcaagaggatttctacccctttttgaaagataacaggg aaaagattgagaaaatcctcacatttcggataccctactatgtaggccccctcgctcggggaaattccagattcgcg tggatgactcgcaaatcagaagagaccatcactccctggaacttcgaggaagtcgtggataagggggcctctgccca gtccttcatcgaaaggatgactaactttgataaaaatctgcctaacgaaaaggtgcttcctaaacactctctgctgt acgagtacttcacagtttataacgagctcaccaaggtcaaatacgtcacagaagggatgagaaagccagcattcctg tctggagagcagaagaaagctatcgtggacctcctcttcaagacgaaccggaaagttaccgtgaaacagctcaaaga agactatttcaaaaagattgaatgtttcgactctgttgaaatcagcggagtggaggatcgcttcaacgcatccctgg gaacgtatcacgatctcctgaaaatcattaaagacaaggacttcctggacaatgaggagaacgaggacattcttgag gacattgtcctcacccttacgttgtttgaagatagggagatgattgaagaacgcttgaaaacttacgctcatctctt cgacgacaaagtcatgaaacagctcaagagacgccgatatacaggatgggggcggctgtcaagaaaactgatcaatg gcatccgagacaagcagagtggaaagacaatcctggattttcttaagtccgatggatttgccaaccggaacttcatg cagttgatccatgatgactctctcacctttaaggaggacatccagaaagcacaagtttctggccagggggacagtct tcacgagcacatcgctaatcttgcaggtagcccagctatcaaaaagggaatactgcagaccgttaaggtcgtggatg aactcgtcaaagtaatgggaaggcataagcccgagaatatcgttatcgagatggcccgagagaaccaaactacccag aagggacagaagaacagtagggaaaggatgaagaggattgaagagggtataaaagaactggggtcccaaatccttaa ggaacacccagttgaaaacacccagcttcagaatgagaagctctacctgtactacctgcagaacggcagggacatgt acgtggatcaggaactggacatcaaccggttgtccgactacgacgtggatgctatcgtgccccaaagctttctcaaa gatgattctattgataataaagtgttgacaagatccgataaaaatagagggaagagtgataacgtcccctcagaaga agttgtcaagaaaatgaaaaattattggcggcagctgctgaacgccaaactgatcacacaacggaagttcgataatc tgactaaggctgaacgaggtggcctgtctgagttggataaagccggcttcatcaaaaggcagcttgttgagacacgc cagatcaccaagcacgtggcccaaattctcgattcacgcatgaacaccaagtacgatgaaaatgacaaactgattcg agaggtgaaagttattactctgaagtctaagctggtctcagatttcagaaaggactttcagttttataaggtgagag agatcaacaattaccaccatgcgcatgatgcctacctgaatgcagtggtaggcactgcacttatcaaaaaatatccc aagctggaatctgaatttgtttacggagactataaagtgtacgatgttaggaaaatgatcgcaaagtctgagcagga aataggcaaggccaccgctaagtacttcttttacagcaatattatgaattttttcaagaccgagattacactggcca atggagagattcggaagcgaccacttatcgaaacaaacggagaaacaggagaaatcgtgtgggacaagggtagggat ttcgcgacagtccgcaaggtcctgtccatgccgcaggtgaacatcgttaaaaagaccgaagtacagaccggaggctt ctccaaggaaagtatcctcccgaaaaggaacagcgacaagctgatcgcacgcaaaaaagattgggaccccaagaaat acggcggattcgattctcctacagtcgcttacagtgtactggttgtggccaaagtggagaaagggaagtctaaaaaa ctcaaaagcgtcaaggaactgctgggcatcacaatcatggagcgatccagcttcgagaaaaaccccatcgactttct cgaagcgaaaggatataaagaggtcaaaaaagacctcatcattaagctgcccaagtactctctctttgagcttgaaa acggccggaaacgaatgctcgctagtgcgggcgagctgcagaaaggtaacgagctggcactgccctctaaatacgtt aatttcttgtatctggccagccactatgaaaagctcaaagggtctcccgaagataatgagcagaagcagctgttcgt ggaacaacacaaacactaccttgatgagatcatcgagcaaataagcgagttctccaaaagagtgatcctcgccgacg ctaacctcgataaggtgctttctgcttacaataagcacagggataagcccatcagggagcaggcagaaaacattatc cacttgtttactctgaccaacttgggcgcgcctgcagccttcaagtacttcgacaccaccatagacagaaagcggta cacctctacaaaggaggtcctggacgccacactgattcatcagtcaattacggggctctatgaaacaagaatcgacc tctctcagctcggtggagac SEQIDNO:19istheaminoacidsequenceofNLS-GFPV.sub.HH-GSlinker- mCherry-GSlinker-E.coliferritin. MPKKKRKVGSGMADVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSV KGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVSSGSGWSHPQFEKGSGHHHHHHGSGPKK KRKVMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYG SKAYVKHPADIPDYLKLSEPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA SSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHS TGGMDELYKGSGSGSMKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERI LFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELD LIQKMGLQNYLQAQIREEG SEQIDNO:20istheaminoacidsequenceofFLAG-E.coliferritin. MDYKDHDGDYKDHDIDYKDDDDKGGGSGGGSGGGSMLKPEMIEKLNEQMNLELYSSLLYQQMSAWCSYHTFEGAAAF LRRHAQEEMTHMQRLFDYLTDTGNLPRINTVESPFAEYSSLDELFQETYKHEQLITQKINELAHAAMTNQDYPTFNF LQWYVSEQHEEEKLFKSIIDKLSLAGKSGEGLYFIDKELSTLDTQN SEQIDNO:21istheaminoacidsequenceofhorseferritinheavychain. MTTAFPSQVRQNYHQDSEAAINRQINLELHASYVYLSMSFYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQR GGRIFLQDIKKPDQDDWENGLKAMECALHLEKNVNESLLELHKLATDKNDPHLCDFLETHYLNEQVKAIKELGDHVT NLRRMGAPESGMAEYLFDKHTLGECDES SEQIDNO:22istheaminoacidsequenceofFLAG-helicobacterferritin. MDYKDHDGDYKDHDIDYKDDDDKGGGSGGGSGGGSMLSKDIIKLLNEQVNKEMQSSNLYMSMSSWCYTHSLDGAGLF LFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNF LQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS SEQIDNO:23istheaminoacidsequenceofFLAG-humanferritinheavychain. MDYKDHDGDYKDHDIDYKDDDDKGGGSGGGSGGGSMSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDD VALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGS ARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD SEQIDNO:24istheaminoacidsequenceofFLAG-NLS-GFPV.sub.HH-GS linker-horseferritinheavychain. MDYKDHDGDYKDHDIDYKDDDDKPKKKRKVGMADVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKE REWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVSSGGGSGG GSGGGSMTTAFPSQVRQNYHQDSEAAINRQINLELHASYVYLSMSFYFDRDDVALKNFAKYFLHQSHEEREHAEKLM KLQNQRGGRIFLQDIKKPDQDDWENGLKAMECALHLEKNVNESLLELHKLATDKNDPHLCDFLETHYLNEQVKAIKE LGDHVTNLRRMGAPESGMAEYLFDKHTLGECDES SEQIDNO:25istheaminoacidsequenceofFLAG-NLS-GFPV.sub.HH-GS linker-mCherry-GSlinker-horseferritinheavychain. MDYKDHDGDYKDHDIDYKDDDDKPKKKRKVGMADVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKE REWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVSSGGGSGG GSGGGSMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFM YGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGW EASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGR HSTGGMDELYKGGGSGGGSGGGSGGGSGGGSMTTAFPSQVRQNYHQDSEAAINRQINLELHASYVYLSMSFYFDRDD VALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDQDDWENGLKAMECALHLEKNVNESLLELHKLAT DKNDPHLCDFLETHYLNEQVKAIKELGDHVTNLRRMGAPESGMAEYLFDKHTLGECDES SEQIDNO:26istheaminoacidsequenceofFLAG-NLS-GFPV.sub.HH-GS linker-halotag-GSlinker-horseferritinheavychain. MDYKDHDGDYKDHDIDYKDDDDKPKKKRKVGMADVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKE REWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVSSGGGSGG GSGGGSEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSD KPDLGYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQ AFRTTDVGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMD WLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEISGGGGGSGG GGSGGGGSGGGGSGGGGSMTTAFPSQVRQNYHQDSEAAINRQINLELHASYVYLSMSFYFDRDDVALKNFAKYFLHQ SHEEREHAEKLMKLQNQRGGRIFLQDIKKPDQDDWENGLKAMECALHLEKNVNESLLELHKLATDKNDPHLCDFLET HYLNEQVKAIKELGDHVTNLRRMGAPESGMAEYLFDKHTLGECDES SEQIDNO:27istheaminoacidsequenceofMS2bindingprotein(MCP). MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKGAWRSYLNME LTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY SEQIDNO:28istheaminoacidsequenceoflambdaN22RNAbindingprotein (N22p). MGNARTRRRERRAEKQAQWKAAN SEQIDNO:29istheaminoacidsequenceofPP7RNAstemloopcoatprotein (PCP). MGSKTIVLSVGEATRTLTEIQSTADRQIFEEKVGPLVGRLRLTASLRQNGAKTAYRVNLKLDQADVVDSGLPKVRYT QVWSHDVTIVANSTEASRKSLYDLTKSLVATSQVEDLVVNLVPLGR SEQIDNO:30istheaminoacidsequenceofanti-suntagscFv. MGPDIVMTQSPSSLSASVGDRVTITCRSSTGAVTTSNYASWVQEKPGKLFKGLIGGTNNRAPGVPSRFSGSLIGDKA TLTISSLQPEDFATYFCALWYSNHWVFGQGTKVELKRGGGGSGGGGSGGGGSSGGGSEVKLLESGGGLVQPGGSLKL SCAVSGFSLTDYGVNWVRQAPGRGLEWIGVIWGDGITDYNSALKDRFIISKDNGKNTVYLQMSKVRSDDTALYYCVT GLFDYWGQGTLVTVSS SEQIDNO:31istheaminoacidsequenceofanti-mCherryV.sub.HH. MAQVQLVESGGSLVQPGGSLRLSCAASGRFAESSSMGWFRQAPGKEREFVAAISWSGGATNYADSAKGRFTLSRDNT KNTVYLQMNSLKPDDTAVYYCAANLGNYISSNQRLYGYWGQGTQVTVSSPFT SEQIDNO:32istheaminoacidsequenceofPUFa. SRGRSRLLEDFRNNRYPNLQLREIAGHIMEFSQDQHGSRFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVI QKFFEFGSLEQKLALAERIRGHVLSLALQMYGSRVIEKALEFIPSDQQNEMVRELDGHVLKCVKDQNGNHVVQKCIE CVQPQSLQFIIDAFKGQVFALSTHPYGCRVIQRILEHCLPDQTLPILEELHQHTEQLVQDQYGNYVIQHVLEHGRPE DKSKIVAEIRGNVLVLSQHKFASNVVEKCVTHASRTERAVLIDEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAE PGQRKIVMHKIRPHIATLRKYTYGKHILAKLEKYYMKNGVDLGGPA SEQIDNO:33istheaminoacidsequenceofPUFb. SRGRSRLLEDFRNNRYPNLQLREIAGHIMEFSQDQHGSRFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVI QKFFEFGSLEQKLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQNEMVRELDGHVLKCVKDQNGNHVVQKCIE CVQPQSLQFIIDAFKGQVFALSTHPYGCRVIQRILEHCLPDQTLPILEELHQHTEQLVQDQYGSYVIEHVLEHGRPE DKSKIVAEIRGNVLVLSQHKFANNVVQKCVTHASRTERAVLIDEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAE PGQRKIVMHKIRPHIATLRKYTYGKHILAKLEKYYMKNGVDLGGPA SEQIDNO:34istheaminoacidsequenceofFRB. EMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLLQAW DLYYHVFRRISKQ SEQIDNO:35istheaminoacidsequenceofFKBP. GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTIS PDYAYGATGHPGIIPPHATLVFDVELLKL SEQIDNO:36istheaminoacidsequenceofdSpCas9. DKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNR ICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIY LALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGE KKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVN TEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGT EELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFA WMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFL SGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILE DIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFM QLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQ KGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLK DDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETR QITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYP KLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRD FATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKK LKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYV NFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENII HLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD SEQIDNO:37istheaminoacidsequenceofaglycine-serinepeptidelinker. GGGSGGGSGGGS SEQIDNO:38isanexemplarynucleicacidsequenceencodingahalotag. gaaatcggtactggctttccattcgacccccattatgtggaagtcctgggcgagcgcatgcactacgtcgatgttgg tccgcgcgatggcacccctgtgctgttcctgcacggtaacccgacctcctcctacgtgtggcgcaacatcatcccgc atgttgcaccgacccatcgctgcattgctccagacctgatcggtatgggcaaatccgacaaaccagacctgggttat ttcttcgacgaccacgtccgcttcatggatgccttcatcgaagccctgggtctggaagaggtcgtcctggtcattca cgactggggctccgctctgggtttccactgggccaagcgcaatccagagcgcgtcaaaggtattgcatttatggagt tcatccgccctatcccgacctgggacgaatggccagaatttgcccgcgagaccttccaggccttccgcaccaccgac gtcggccgcaagctgatcatcgatcagaacgtttttatcgagggtacgctgccgatgggtgtcgtccgcccgctgac tgaagtcgagatggaccattaccgcgagccgttcctgaatcctgttgaccgcgagccactgtggcgcttcccaaacg agctgccaatcgccggtgagccagcgaacatcgtcgcgctggtcgaagaatacatggactggctgcaccagtcccct gtcccgaagctgctgttctggggcaccccaggcgttctgatcccaccggccgaagccgctcgcctggccaaaagcct gcctaactgcaaggctgtggacatcggcccgggtctgaatctgctgcaagaagacaacccggacctgatcggcagcg agatcgcgcgctggctgtccacgctcgagatttccggc SEQIDNO:39istheaminoacidsequenceofahalotag. EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGY FFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTD VGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQSP VPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEISG SEQIDNO:40isanexemplarynucleicacidsequenceencodingmCherry. atggttagcaagggcgaggaggataatatggccattatcaaagaattcatgcgctttaaggtccacatggagggtag tgtcaacggtcatgaatttgagatagagggtgaaggggaaggtaggccttacgagggtactcaaactgcgaaattga aagtcacaaaggggggtcccctcccttttgcgtgggatatactctccccacaatttatgtacggttcaaaagcctat gttaagcaccctgcggacatccccgactacctgaaactcagttttcctgaaggcttcaagtgggagcgggtcatgaa ttttgaggacggtggggtcgtaacggtcactcaggactcatctcttcaagatggtgagtttatctataaagtaaagt tgcgcggtactaactttccgtccgacggaccagtaatgcaaaaaaaaacaatgggttgggaggcttcatccgaacgg atgtatcccgaagacggggctctcaagggtgagattaaacaaaggcttaaactgaaggatggaggccattacgatgc tgaagttaaaaccacgtataaagcgaagaaacccgttcagctgcctggtgcatataatgtgaatatcaaattggata taacctcacacaatgaggactatactatcgtagaacaatatgaacgggcggaaggacgacactcaaccgggggaatg gatgaactttataaa SEQIDNO:41istheaminoacidsequenceofmCherry. MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAY VKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSER MYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGM DELYK SEQIDNO:42isanexemplarynucleotidesequenceencodingGFPV.sub.HH-GS linker-mCherry-GSlinker-horseferritinheavychain. atggatgtgcagttggttgagtctggcggggcactcgtgcagccggggggtagtctgagattgagttgtgccgcctc cggatttccagtcaacagatattcaatgcgctggtatcgacaggcgccagggaaagagagagaatgggttgcgggta tgtcatcagcgggtgatcgatcctcttacgaggattcagtgaaagggcggtttacaataagccgagatgacgccaga aatacggtatacctccagatgaactccctcaagccggaagatacggcagtttactattgtaacgttaatgttggatt tgagtattggggccaaggaacgcaagtgaccgtcagcagtggtggtggaagtggcggagggtcaggaggcggatcta tggttagcaagggcgaggaggataatatggccattatcaaagaattcatgcgctttaaggtccacatggagggtagt gtcaacggtcatgaatttgagatagagggtgaaggggaaggtaggccttacgagggtactcaaactgcgaaattgaa agtcacaaaggggggtcccctcccttttgcgtgggatatactctccccacaatttatgtacggttcaaaagcctatg ttaagcaccctgcggacatccccgactacctgaaactcagttttcctgaaggcttcaagtgggagcgggtcatgaat tttgaggacggtggggtcgtaacggtcactcaggactcatctcttcaagatggtgagtttatctataaagtaaagtt gcgcggtactaactttccgtccgacggaccagtaatgcaaaaaaaaacaatgggttgggaggcttcatccgaacgga tgtatcccgaagacggggctctcaagggtgagattaaacaaaggcttaaactgaaggatggaggccattacgatgct gaagttaaaaccacgtataaagcgaagaaacccgttcagctgcctggtgcatataatgtgaatatcaaattggatat aacctcacacaatgaggactatactatcgtagaacaatatgaacgggcggaaggacgacactcaaccgggggaatgg atgaactttataaagggggaggaagcgggggagggtctgggggtggttcaggcgggggatcaggtggcgggagtatg actactgcattcccgagccaagtgcggcagaattaccaccaggactctgaagcggccatcaaccgacaaatcaacct ggaactgcatgcgtcttacgtttatctgtcaatgagcttttactttgatagagacgatgtcgcattgaagaacttcg ccaaatattttcttcatcagagccatgaggaaagggaacatgcagaaaaacttatgaaattgcagaaccagcgcggt ggaaggattttcctccaagacataaagaaaccggatcaggacgactgggagaatggcctgaaggcaatggaatgtgc acttcacctcgaaaagaacgtgaacgagagcctcctggaactgcataaattggccactgacaaaaacgatccacacc tgtgcgatttccttgagactcattatcttaacgagcaagtgaaagcaattaaagagttgggtgatcatgtcactaac ctgagacgcatgggggcaccagaaagcggcatggcagagtatttgtttgacaagcatacacttggtgagtgtgacga gtcttga SEQIDNO:43istheaminoacidsequenceofGFPV.sub.HH-GSlinker-mCherry-GS linker-horseferritinheavychain. DVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARN TVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVSSGGGSGGGSGGGSMVSKGEEDNMAIIKEFMRFKVHMEGSV NGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAE VKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKGGGSGGGSGGGSGGGSGGGSMT TAFPSQVRQNYHQDSEAAINRQINLELHASYVYLSMSFYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGG RIFLQDIKKPDQDDWENGLKAMECALHLEKNVNESLLELHKLATDKNDPHLCDFLETHYLNEQVKAIKELGDHVTNL RRMGAPESGMAEYLFDKHTLGECDES SEQIDNO:44isanexemplarynucleotidesequenceencodingGFPV.sub.HH. gatgtgcagttggttgagtctggcggggcactcgtgcagccggggggtagtctgagattgagttgtgccgcctccgg atttccagtcaacagatattcaatgcgctggtatcgacaggcgccagggaaagagagagaatgggttgcgggtatgt catcagcgggtgatcgatcctcttacgaggattcagtgaaagggcggtttacaataagccgagatgacgccagaaat acggtatacctccagatgaactccctcaagccggaagatacggcagtttactattgtaacgttaatgttggatttga gtattggggccaaggaacgcaagtgaccgtcagcagt SEQIDNO:45istheaminoacidsequenceofGFPV.sub.HH. DVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARN TVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVSS

DETAILED DESCRIPTION

I. Summary of Terms

[0035] Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes X, published by Jones & Bartlett Publishers, 2009; and Meyers et al. (eds.), The Encyclopedia of Cell Biology and Molecular Medicine, published by Wiley-VCH in 16 volumes, 2008; and other similar references. As used herein, the singular forms a, an, and the, refer to both the singular as well as plural, unless the context clearly indicates otherwise. As used herein, the term comprises means includes. Although many methods and materials similar or equivalent to those described herein can be used, particular suitable methods and materials are described below. In case of conflict, the present specification, including explanations of terms, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. To facilitate review of the various embodiments, the following explanations of terms are provided:

[0036] Antigen: An intracellular component that can be specifically bound by a targeting domain As used herein, an intracellular antigen includes both native antigens found in cells, as well as non-native antigens expressed in a cell by recombinant methods. Non-limiting examples of antigens include, but are not limited to, proteins, lipids, polysaccharides, and nucleic acids.

[0037] Detecting: To identify the existence, presence, or fact of something. General methods of detecting may be supplemented with the protocols and reagents disclosed herein. For example, included herein are methods of detecting the localization of an intracellular antigen using FIREnano probes for fluorescence and electron microscopy.

[0038] Detection tag: A polypeptide that, when fused to a heterologous protein to form a fusion protein, facilitates the detection of the location of the fusion protein when it is expressed in cells. Non-limiting examples of detection tags include fluorescent proteins (such as mCherry) and fluorescent dye binding proteins, such as a halotag.

[0039] Expression: Translation of a nucleic acid into a protein.

[0040] Expression Control Sequences: Nucleic acid sequences that regulate the expression of a heterologous nucleic acid sequence to which it is operatively linked. Expression control sequences are operatively linked to a nucleic acid sequence when the expression control sequences control and regulate the transcription and, as appropriate, translation of the nucleic acid sequence. Thus expression control sequences can include appropriate promoters, enhancers, transcription terminators, a start codon (ATG) in front of a protein-encoding gene, splicing signal for introns, maintenance of the correct reading frame of that gene to permit proper translation of mRNA, and stop codons. The term control sequences is intended to include, at a minimum, components whose presence can influence expression, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences. Expression control sequences can include a promoter.

[0041] A promoter is a minimal sequence sufficient to direct transcription. Also included are those promoter elements which are sufficient to render promoter-dependent gene expression controllable for cell-type specific, tissue-specific, or inducible by external signals or agents; such elements may be located in the 5 or 3 regions of the gene. Both constitutive and inducible promoters are included (see for example, Bitter et al., Methods in Enzymology 153:516-544, 1987). For example, when cloning in bacterial systems, inducible promoters such as pL of bacteriophage lambda, plac, ptrp, ptac (ptrp-lac hybrid promoter) and the like may be used. In one embodiment, when cloning in mammalian cell systems, promoters derived from the genome of mammalian cells (such as metallothionein promoter) or from mammalian viruses (such as the retrovirus long terminal repeat; the adenovirus late promoter; the vaccinia virus 7.5K promoter) can be used. Promoters produced by recombinant DNA or synthetic techniques may also be used to provide for transcription of the nucleic acid sequences.

[0042] A polynucleotide can be inserted into an expression vector that contains a promoter sequence which facilitates the efficient transcription of the inserted genetic sequence of the host. The expression vector typically contains an origin of replication, a promoter, as well as specific nucleic acid sequences that allow phenotypic selection of the transformed cells.

[0043] Expression vector: A vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed. An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system. Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.

[0044] Ferritin: Ferritins are a family of proteins that self-assemble into a multi-subunit globular-shaped nm-sized protein complex containing a cavity in which hydrated ferric oxide is mineralized. Specifically, 24 ferritin subunits self-assemble to form 12 nm spherical nanoparticles with a hollow inner cavity and octahedral symmetry. In nature, the ferritin nanoparticle have ferroxidase activity, store ferric oxide in their cavity, and release it in a controlled fashion. Only the heavy chain subunit oxidizes ferrous iron to ferric oxide. Ferritin that is not combined with iron is called apoferritin.

[0045] Fluorescent protein: A protein that has the ability to emit light of a particular wavelength (emission wavelength) when exposed to light of another wavelength (excitation wavelength). Non-limiting examples of fluorescent proteins are the green fluorescent protein (GFP) from Aequorea victoria and natural and engineered variants thereof, spectral variants of GFP which have a different fluorescence spectrum (e.g., YFP, CFP), and GFP-like fluorescent proteins (e.g., DsRed; and DsRed variants, for example, DsRed1, DsRed2, mCherry, mApple, mOrange, and mRasberry).

[0046] Fusion Protein: A single polypeptide chain including the sequence of two or more heterologous proteins, often linked by a peptide linker.

[0047] Host cells: Cells in which a vector can be propagated and its nucleic acid expressed. The cell may be prokaryotic or eukaryotic. The term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. However, such progeny are included when the term host cell is used.

[0048] Isolated: An isolated biological component (such as a protein, for example a disclosed recombinant ferritin nanoparticle that has been substantially separated or purified away from other biological components, such as other chromosomal and extrachromosomal DNA, RNA, and proteins. Proteins, peptides and nucleic acids that have been isolated include those purified by standard purification methods. The term also embraces proteins or peptides prepared by recombinant expression in a host cell as well as chemically synthesized proteins, peptides and nucleic acid molecules. Isolated does not require absolute purity, and can include protein, peptide, or nucleic acid molecules that are at least 50% isolated, such as at least 75%, 80%, 90%, 95%, 98%, 99%, or even 99.9% isolated.

[0049] Nucleic acid molecule: A deoxyribonucleotide or ribonucleotide polymer or combination thereof including without limitation, cDNA, mRNA, genomic DNA, and synthetic (such as chemically synthesized) DNA or RNA. The nucleic acid can be double stranded (ds) or single stranded (ss). Where single stranded, the nucleic acid can be the sense strand or the antisense strand. Nucleic acids can include natural nucleotides (such as A, T/U, C, and G), and can include analogs of natural nucleotides, such as labeled nucleotides. Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene encodes a protein if transcription and translation of mRNA produced by that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and non-coding strand, used as the template for transcription, of a gene or cDNA can be referred to as encoding the protein or other product of that gene or cDNA. Unless otherwise specified, a nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. Nucleotide sequences that encode proteins and RNA may include introns.

[0050] Operably linked: A first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked nucleic acid sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.

[0051] Peptide Linker: A polypeptide of 50 or fewer amino acids that is used to fuse two heterologous polypeptides into one contiguous polypeptide chain. Non-limiting examples of peptide linkers include glycine linkers, serine linkers, and glycine-serine linkers, such as a 10 amino acid glycine-serine linker. Unless context indicates otherwise, reference to linking or fusing a first polypeptide and a second polypeptide (or to two polypeptides linked or fused together) by peptide linker refers to covalent linkage of the first and second polypeptides to the N- and C-termini of the peptide linker to form a single polypeptide chain. Such linkage is typically accomplished using molecular biology techniques to genetically manipulate DNA encoding the first polypeptide linked to the second polypeptide by the peptide linker.

[0052] Polypeptide and Protein: Any chain of amino acids, regardless of length or post-translational modification (e.g., glycosylation or phosphorylation). Polypeptide applies to amino acid polymers including naturally occurring amino acid polymers and non-naturally occurring amino acid polymer as well as in which one or more amino acid residue is a non-natural amino acid, for example an artificial chemical mimetic of a corresponding naturally occurring amino acid. A residue refers to an amino acid or amino acid mimetic incorporated in a polypeptide by an amide bond or amide bond mimetic. A polypeptide has an amino terminal (N-terminal) end and a carboxy terminal (C-terminal) end. Polypeptide is used interchangeably with protein.

[0053] Probe: A fusion protein comprising one or more detection tags (for example, one or more fluorescent proteins) or other reporter moiety (such as a heavy chain ferritin subunit linked to ferric oxide) that is used to detect the location of a target antigen in a cell.

[0054] Sequence identity: The similarity between amino acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity; the higher the percentage, the more similar the two sequences are. Homologs, orthologs, or variants of a polypeptide will possess a relatively high degree of sequence identity when aligned using standard methods.

[0055] Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith & Waterman, Adv. AppL Math. 2:482, 1981; Needleman & Wunsch, J. Mol. Biol. 48:443, 1970; Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444, 1988; Higgins & Sharp, Gene, 73:237-44, 1988; Higgins & Sharp, CABIOS 5:151-3, 1989; Corpet et al., Nuc. Acids Res. 16:10881-90, 1988; Huang et al. Computer Appls. In the Biosciences 8, 155-65, 1992; and Pearson et al., Meth. Mol. Bio. 24:307-31, 1994. Altschul et al., J. Mol. Biol. 215:403-10, 1990, presents a detailed consideration of sequence alignment methods and homology calculations.

[0056] Variants of a polypeptide are typically characterized by possession of at least about 75%, for example, at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full length alignment with the amino acid sequence of interest. Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95% depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet.

[0057] As used herein, reference to at least 90% identity (or similar language) refers to at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or even 100% identity to a specified reference sequence.

[0058] Single chain antibody: A single polypeptide chain that includes at least one antibody variable region, or an engineered variant thereof, that specifically binds to a target antigen. Single chain antibodies include, for example, antibody formats containing heavy and light chain variable regions (V.sub.H and V.sub.L, respectively) expressed as a single polypeptide chain, such as a single-chain variable fragment (scFv), as well as antibody formats containing a single variable region that specifically binds to the target antigen, such as a single domain antibodies (sdAb or nanobody). An scFv is a genetically engineered molecule containing the heavy and light chain variable domains of one or more antibody(ies) linked by a suitable polypeptide linker as a genetically fused single chain molecule. The intramolecular orientation of the heavy chain variable domain and the light chain variable domain in a scFv is typically not decisive for scFvs. Thus, scFvs with both possible arrangements (V.sub.H-domain-linker domain-V.sub.L-domain; V.sub.L-domain-linker domain-V.sub.H-domain) may be used. A single domain antibody is a monomeric variable region that specifically binds to a target antigen. In some embodiments, single-domain antibodies are based on heavy-chain only antibodies found in camelids, which are called V.sub.HH fragments or camelid antibodies. Additional description of single chain antibody formats can be found, for example, in Kontermann and Dubel (Ed), Antibody Engineering, Vols. 1-2, 2.sup.nd Ed., Springer Press, 2010.

[0059] Specifically bind: When referring to the targeting domain of a genetically encoded FIREnano probe as provided herein, specifically bind refers to a binding reaction which determines the presence of a target antigen in the presence of a heterogeneous population of proteins and other biologics. Thus, under designated conditions, a targeting domain binds preferentially to a particular target antigen in a cell and does not bind in a significant amount to other biological components of the cell (such as proteins or polysaccharides). Specific binding can be determined by methods known in the art.

[0060] Targeting domain: A polypeptide that that specifically binds to an intracellular target antigen, and that when fused to a heterologous protein to form a fusion protein, facilitates the co-localization of the fusion protein with the target antigen in cells. Non-limiting examples of targeting domains include single domain antibodies that specifically bind to an intracellular antigen, such as genomic DNA or RNA.

[0061] Target antigen: An intracellular antigen whose detection and/or intracellular localization is intended.

[0062] Under conditions sufficient for: A phrase that is used to describe any environment that permits a desired activity.

II. FIREnano Probes

[0063] This disclosure provides novel genetically encoded probes that are expressed in a cell to label an intracellular target (e.g., protein/DNA) for both light microscopy (e.g., fluorescence) and EM. The probes are termed fluorescent-iron EM ferritin nanoparticle (FIREnano) probes and are comprised of an assembly of fusion proteins. The fusion proteins comprise a targeting domain that specifically binds to the intracellular target, a detection tag that can be used to detect the intracellular location of the probe using light (e.g., fluorescence) microscopy, and a mammalian (e.g., horse) ferritin heavy chain subunit. The ferritin subunit in the fusion protein self-assembles in mammalian cells to form a globular multi-subunit ferritin nanoparticle that oxidizes ferrous iron to ferric oxide. When assembled, the targeting domains and the detection tags extend radially outward from the exterior surface of the globular ferritin nanoparticle. The detection tag can be used to identify the intracellular location of the fusion protein by light microscopy, and the ferric oxide in the ferritin nanoparticle can be to detect the intracellular location of the probe using EM.

[0064] The order of the components of the fusion protein can vary. However, the ferritin heavy chain subunit is included at the C-terminal portion of the fusion protein. In some embodiments, the fusion protein comprises, in an N- to C-terminal direction, the targeting domain that specifically binds to an intracellular antigen, the detection tag, and the ferritin heavy chain subunit. In other embodiments, the fusion protein comprises, in an N- to C-terminal direction, the detection tag, the targeting domain that specifically binds to an intracellular antigen, and the ferritin heavy chain subunit.

[0065] In the context of the fusion protein, the ferritin heavy chain subunit self-assembles into a globular multi-subunit ferritin nanoparticle in an intracellular environment. If endogenous ferritin heavy and light chain molecules are present in the intracellular environment, then the resulting globular multi-subunit ferritin nanoparticle may also include one or more endogenous ferritin heavy or light chains. For example, adding iron salt into cell culture medium can induce expression of endogenous human ferritin heavy and light chain, which may be incorporated into the globular multi-subunit ferritin nanoparticle containing the fusion protein of the FIREnano probe. The mixing ratio of endogenous ferritin heavy and light chains to the fusion protein of the FIREnano probe can be controlled, for example, by the ratio of endogenous ferritin heavy and light chains to the fusion protein of the FIREnano probe and monitored by native gel assay

[0066] Further, the self-assembled ferritin heavy chain subunit of the fusion protein oxidizes ferrous iron to ferric oxide. The ferric oxide can be detected as a heavy particle using EM. In some embodiments, the ferritin subunit included in the fusion protein is a horse ferritin subunit that comprises or consists of the amino acid sequence set forth as SEQ ID NO: 21.

[0067] The detection tag included in the fusion protein facilitates detection of the intracellular location of the probe using light (e.g., fluorescence) microscopy. In some embodiments, the detection tag is a fluorescent protein. Any suitable fluorescent protein can be used, for example, GFP or a variant thereof, such as YFP or CFP, or a GFP-like fluorescent protein, such as DsRed and DsRed variants, such as DsRed1, DsRed2, mCherry, mApple, mOrange, or mRasberry. In some embodiments, the detection tag is an mCherry fluorescent protein that comprises or consists of the amino acid sequence set forth as SEQ ID NO: 41. In additional embodiments, the detection tag is a fluorescent dye binding protein, such as a halotag. In such embodiments, the intracellular location of the fusion protein can be detected by applying the fluorescent dye that binds to the fluorescent dye binding protein to the cells. In some embodiments, the detection tag is a halotag comprising or consisting of the amino acid sequence set forth as SEQ ID NO: 39.

[0068] The targeting domain included in the fusion protein specifically binds to an intracellular target antigen, thereby facilitating the co-localization of the fusion protein with the target antigen. In some embodiments, the targeting domain is a single chain antibody (such as a scFv or a V.sub.HH) that specifically binds to the target antigen.

[0069] The target antigen can be any intracellular antigen of interest, such as a protein (e.g., chromatin) or a nucleic acid (e.g., DNA or RNA). In some embodiments, the target antigen is a heterologous protein expressed in the cell, and the targeting domain specifically binds to the heterologous antigen. In other embodiments, the target antigen is a native antigen expressed within the cell, and the targeting domain specifically binds to the native antigen.

[0070] Non-limiting examples of targeting domains include a GFPV.sub.HH targeting domain (which specifically binds to GFP), an anti-suntag scFv (which specifically binds to suntag), an anti-mCherry nanobody (which specifically binds to mCherry), RNA binding proteins that specifically bind to an RNA tag (such as MCP, which specifically bind to the MS2 RNA tag, PCP, which specifically bind to the PP7 RNA tag, and N22p, which specifically bind to the lambda N22 RNA tag), and a PUF protein that specifically binds to PUF sequences in the 3 untranslated region (3UTR) of specific target mRNAs.

[0071] For targeting of particular DNA sequences, DNA binding proteins, such as transcription factors, can used as a targeting domain In additional embodiments, the targeting domain is a dCas9 protein or a dCas13d protein that can be used with CRISPR technology to label a particular genomic locus, or a transcription activator-like effector (TALE) that can be used with TALEN technology to label a particular genomic locus.

[0072] In some embodiments, the targeting domain is a subunit of a dimerization domain, such as an inducible dimerization domain.

[0073] In some embodiments, the targeting domain comprises or consists of the amino acid sequence set forth as any one of SEQ ID NO: 27 (MS2 binding protein, MCP), SEQ ID NO: 28 (lambda N22 RNA binding protein, N22p), SEQ ID NO: 29 (PP7 RNA stem loop coat protein, PCP), SEQ ID NO: 30 (anti-suntag scFv), SEQ ID NO: 32 (PUFa), SEQ ID NO: 33 (PUFb), SEQ ID NO: 34 (FRB), SEQ ID NO: 35 (FKBP), SEQ ID NO: 36 (dSpCas9), or SEQ ID NO: 45 (GFPV.sub.HH).

[0074] The targeting domain, the detection tag, and the ferritin heavy chain subunit included in the fusion protein can be directly linked via peptide bond, or indirectly linked by a peptide linker. Any appropriate peptide linker can be used, such as a glycine-serine peptide linker, for example as set forth as SEQ ID NO: 37 (GGGSGGGSGGGS). In some embodiments, the detection tag and the ferritin heavy chain subunit are fused via a peptide linker, such as a glycine-serine peptide linker, for example as set forth as SEQ ID NO: 37. In some embodiments, the targeting domain and the detection tag are fused via a peptide linker, such as a glycine-serine peptide linker, for example as set forth as SEQ ID NO: 37. In some embodiments, the detection tag and the ferritin heavy chain subunit, and the targeting domain and the detection tag, are fused via a peptide linker, such as a glycine-serine peptide linker, for example as set forth as SEQ ID NO: 37.

[0075] In some embodiments, the fusion protein further comprises a nuclear localization sequence (NLS) to increase localization of the fusion protein in the nucleus of cells. Any suitable NLS can be incorporated into the fusion protein, such as the SV40 Large T-antigen NLS, which has the sequence of PKKKRKV (residues 24-30 of SEQ ID NO: 25). The nuclear localization sequence can be included at any appropriate location within the fusion protein, typically N-terminal to the targeting domain

[0076] In some embodiments, the fusion protein further comprises additional proteins tags for various purposes, for example for purification and/or detection. In some embodiments, the fusion protein further comprises a FLAG tag (DYKDDDK, residues 16-23 of SEQ ID NO: 25) near or at the N-terminus of the fusion protein.

[0077] In some embodiments, the fusion protein comprises or consists of the amino acid sequence set forth as any one of SEQ ID NOs: 25, 26, or 43.

[0078] The fusion protein can include sequence modifications, such as amino acid substitutions, deletions or insertions, as long as the fusion protein retains the functional properties of the targeting domain (specific binding to the target antigen), detection tag (detection by light (e.g., fluorescence) microscopy), and ferritin heavy chain subunit (self-assembly into a ferritin nanoparticle and oxidation of ferrous iron to ferric oxide). These variations in sequence can be naturally occurring variations or they can be engineered through the use of appropriate genetic engineering techniques. The fusion protein can be derivatized or linked to another molecule (such as another peptide or protein), as long as the fusion protein retains the functional properties of the targeting domain (specific binding to the target antigen), detection tag (detection by light (e.g., fluorescence) microscopy), and ferritin heavy chain subunit (self-assembly into a ferritin nanoparticle and oxidation of ferrous iron to ferric oxide).

[0079] In some embodiments, the fusion protein can be produced in cells (for example by expression from a nucleic acid molecule that encodes the probe (see Section III below), and isolated, for example, by preparative chromatography and immunological separations.

III. Polynucleotides and Expression

[0080] Polynucleotides encoding a subunit of the disclosed FIREnano probes are also provided. These polynucleotides include, for example, DNA, cDNA and RNA sequences encoding a subunit of the disclosed FIREnano probes. One of skill in the art can readily use the genetic code to construct a variety of functionally equivalent nucleic acids, such as nucleic acids which differ in sequence but which encode the same protein sequence. In a non-limiting embodiment, the polynucleotide comprises the sequence set forth as any one of SEQ ID NOs: 7, 8, or 42.

[0081] Exemplary nucleic acids can be prepared by cloning techniques. Examples of appropriate cloning and sequencing techniques, and instructions sufficient to direct persons of skill through many cloning exercises are known (see, e.g., Sambrook et al. (Molecular Cloning: A Laboratory Manual, 4.sup.th ed., Cold Spring Harbor, New York, 2012) and Ausubel et al. (In Current Protocols in Molecular Biology, John Wiley & Sons, New York, through supplement 104, 2013). Product information from manufacturers of biological reagents and experimental equipment also provide useful information. Such manufacturers include the SIGMA Chemical Company (Saint Louis, Mo.), R&D Systems (Minneapolis, Minn.), Pharmacia Amersham (Piscataway, N.J.), CLONTECH Laboratories, Inc. (Palo Alto, Calif.), Chem Genes Corp., Aldrich Chemical Company (Milwaukee, Wis.), Glen Research, Inc., GIBCO BRL Life Technologies, Inc. (Gaithersburg, Md.), Fluka Chemica-Biochemika Analytika (Fluka Chemie AG, Buchs, Switzerland), Invitrogen (Carlsbad, Calif.), and Applied Biosystems (Foster City, Calif.), as well as many other commercial sources known to one of skill.

[0082] Nucleic acids can also be prepared by amplification methods Amplification methods include polymerase chain reaction (PCR), the ligase chain reaction (LCR), the transcription-based amplification system (TAS), the self-sustained sequence replication system (3SR). A wide variety of cloning methods, host cells, and in vitro amplification methodologies are well known to persons of skill.

[0083] The polynucleotides encoding a subunit of a disclosed FIREnano probe can include a recombinant DNA which is incorporated into a vector (such as an expression vector) into an autonomously replicating plasmid or virus or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (such as a cDNA) independent of other sequences. The nucleotides can be ribonucleotides, deoxyribonucleotides, or modified forms of either nucleotide. The term includes single and double forms of DNA.

[0084] Polynucleotide sequences encoding a subunit of a disclosed FIREnano probe can be operatively linked to expression control sequences. An expression control sequence operatively linked to a coding sequence is ligated such that expression of the coding sequence is achieved under conditions compatible with the expression control sequences. The expression control sequences include, but are not limited to, appropriate promoters, enhancers, transcription terminators, a start codon (i.e., ATG) in front of a protein-encoding gene, splicing signal for introns, maintenance of the correct reading frame of that gene to permit proper translation of mRNA, and stop codons.

[0085] DNA sequences encoding a subunit of a disclosed FIREnano probe can be expressed in vitro by DNA transfer into a suitable host cell. The cell may be prokaryotic or eukaryotic. The term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. Methods of stable transfer, meaning that the foreign DNA is continuously maintained in the host, are known in the art.

[0086] Hosts can include microbial, yeast, insect and mammalian organisms. Methods of expressing nucleic acid sequences having eukaryotic or viral sequences in prokaryotes are well known in the art. Non-limiting examples of suitable host cells include bacteria, archea, insect, fungi (for example, yeast), plant, and animal cells (for example, mammalian cells, such as human) Exemplary cells of use include Escherichia coli, Bacillus subtilis, Saccharomyces cerevisiae, Salmonella typhimurium, Neurospora, and immortalized mammalian cell lines. Techniques for the propagation of mammalian cells in culture are well-known (see, e.g., Helgason and Miller (Eds.), 2012, Basic Cell Culture Protocols (Methods in Molecular Biology), 4.sup.th Ed., Humana Press). Examples of commonly used mammalian host cell lines are HeLa cells, CHO cells, and COS cell lines, although cell lines may be used, such as cells designed to provide higher expression, desirable glycosylation patterns, or other features. In some embodiments, the host cells include HEK293 cells.

[0087] Transformation of a host cell with recombinant DNA is typically carried out by conventional techniques. Where the host is prokaryotic, such as, but not limited to, E. coli, competent cells which are capable of DNA uptake can be prepared from cells harvested after exponential growth phase and subsequently treated by the CaCl.sub.2 method using procedures well known in the art. Alternatively, MgCl.sub.2 or RbCl can be used. Transformation can also be performed after forming a protoplast of the host cell if desired, or by electroporation.

[0088] When the host is a eukaryote, such methods of transfection of DNA as calcium phosphate coprecipitates, conventional mechanical procedures such as microinjection, electroporation, insertion of a plasmid encased in liposomes, or viral vectors can be used. Eukaryotic cells can also be co-transformed with polynucleotide sequences encoding a disclosed antigen, and a second foreign DNA molecule encoding a selectable phenotype, such as the herpes simplex thymidine kinase gene. Another method is to use a eukaryotic viral vector, such as simian virus 40 (SV40) or bovine papilloma virus, to transiently infect or transform eukaryotic cells and express the protein (see for example, Viral Expression Vectors, Springer press, Muzyczka ed., 2011). One of skill in the art can readily use an expression systems such as plasmids and vectors of use in producing proteins in cells including higher eukaryotic cells such as the COS, CHO, HeLa, and myeloma cell lines.

[0089] Modifications can be made to a nucleic acid encoding a subunit of the disclosed FIREnano probe without diminishing its biological activity. Some modifications can be made to facilitate the cloning, expression, or incorporation of the FIREnano probe into a fusion protein. Such modifications include, for example, termination codons, a methionine added at the amino terminus to provide an initiation, site, additional amino acids placed on either terminus to create conveniently located restriction sites, or additional amino acids (such as poly His) to aid in purification steps.

V. Methods of Detection

[0090] Further provided are methods of detecting the location of a target antigen in a cell. The method comprises expressing a nucleic acid molecule encoding a FIREnano probe in the cell. As discussed above, the FIREnano probe is a fusion protein comprising a targeting domain that specifically binds to the intracellular target antigen, a detection tag that can be used to detect the intracellular location of the probe using light (e.g., fluorescence) microscopy, and a mammalian (e.g., horse) ferritin heavy chain subunit that self-assembles into globular multi-subunit ferritin nanoparticle that oxidizes ferrous iron to ferric oxide, and that can be used to detect the intracellular location of the probe using EM. Once expressed in the cell, the targeting domain of the fusion protein specifically binds to the target antigen, and the location of the detection tag and the ferritin nanoparticle in the host cell can be detected using fluorescence microscopy and EM, respectively, to detect the location of the target antigen in the cell.

[0091] In several embodiments, the method is performed in vitro, with host cells expressing the fusion protein. In several embodiments, the host cells are incubated in growth medium comprising transferrin and/or ferric ammonium citrate.

[0092] In some embodiments, the fusion protein is expressed in the host cells, and then the host cells are fixed prior to analysis with light (e.g., fluorescence) microscopy and EM. In other embodiments, the fusion protein is expressed in the host cells, and the fusion protein is detected by live cell imaging prior to fixation for analysis with light (e.g., fluorescence) microscopy and/or EM.

[0093] Any appropriate light and/or electron microscopy technique (e.g., fluorescence microscopy, TEM, EMT, ChromEMT) can be used to detect the detection tag and the ferritin nanoparticle in order to determine the location of the fusion protein in the host cells.

[0094] Further, any appropriate host cell can be used in the disclosed methods. In several embodiments the host cell is a mammalian cell, such as a human cell.

EXAMPLES

[0095] The following examples are provided to illustrate particular features of certain embodiments, but the scope of the claims should not be limited to those features exemplified.

Example 1

Genetically Encoded FIREnano Probes for Visualizing Structures within Intact Cells by Fluorescent and Electron Microscope

[0096] The example illustrates genetically encoded FIREnano probes that are expressed in a cell to label an intracellular target (e.g., protein/DNA) for both fluorescence and EM. The disclosed probes can be used for dynamic live imaging and EM ultrastructure.

[0097] Ferritins are a family of large multi-subunit proteins that self-assemble to form a cavity in which hydrated ferric oxide is mineralized and stored (FIG. 1B). Ferritin subunits self-assemble to form 24mer 12 nm spherical particles with a hollow inner cavity and octahedral symmetry. Mammalian ferritins include heavy and light chains, however, only the heavy chain subunit oxidizes ferrous iron to ferric oxide. Interestingly, the mammalian ferritin heavy chain self-assembles into a ferritin 24mer in the absence of the light chain. Metal ions pass into the inner cavity through channels between ferritin subunits. Each subunit includes four long helical bundles and a tilted short R-helix connected by a flexible loop.

[0098] Several different embodiments of the genetically encoded FIREnano probes were designed and tested. Human codon-optimized E. coli ferritin constructs were fused to the mCherry fluorescent protein and a lama antibody that specifically binds to GFP (termed GFPV.sub.HH-mCherry-E. coli Ferritin). Llama antibodies are single chain antibodies that only contain a heavy chain variable region (V.sub.HH). Ferritin assembles in cytoplasm. Therefore, to concentrate the synthetic constructs in the nucleus a nuclear localization sequence (NLS) was also included. The DNA sequence encoding the GFPV.sub.HH-mCherry-E. coli Ferritin probe is provided as SEQ ID NO: 1. To test this probe, several different cell-lines that stably express GFP linked to a subcellular targeting element were used: Adenovirus protein ORF3-GFP which forms huge GFP labeled fibers; Connexin43-GFP which forms GFP-labeled gap junction structures; TRF1-GFP, which contains GFP-labeled telomere ends (human telomeres are tethered to the nuclear envelope during postmitotic nuclear assembly); and LacI-GFP, which contains GFP-labeled lacO sequences in chromosome 1. The colocalization of mCherry with GFP in these cell lines demonstrates that the GFPV.sub.HH-mCherry-E. coli Ferritin constructs labeled GFP tagged locus very well (FIG. 2).

[0099] TRF1-GFP cells were transfected with GFPV.sub.HH-mCherry-E. coli Ferritin. 24 hours after transfection, cells were fixed with glutaraldehyde, further fixed by aqueous osmium teteroxide, dehydrated in ethanol series, and finally embedded in durcupan ACM resin. Navminator software was used to correlate light and EM images and find the same region in EM sections. TEM images of thin sections are shown in FIG. 3. Despite the ability of the GFPV.sub.HH-mCherry-E. coli Ferritin construct to co-localize and fluorescently label GFP tagged proteins, iron particles in the corresponding EM sections of the regions of interest were not detected. Similar results were obtained in corresponding assays in the cells expressing LacI-GFP (to label lacO sequences in chromosome 1) (FIG. 4) and cells expressing connexin43-GFP which forms GFP-labeled gap junction structures (FIG. 5).

[0100] It was reasoned that the lack of EM contrast could be due to the failure of E. coli ferritin fusion proteins to assemble and/or load iron in the nucleus of mammalian cells. Additionally, ferritin is found across the different kingdoms of life (FIG. 6). Thus, it was also reasoned that ferritin other than E. coli ferritin might perform better in mammalian cells. Therefore, ferritin from several different organisms was fused with an N-terminal 3 FLAG tag and assessed for assembly into iron storing particles in mammalian cells (FIG. 7). These included ferritins from Helicobacter pylori, Horses, Humans, E. coli. The FLAG-ferritin protein was immunoprecipitated from mammalian cells lysate using RIPA buffer. FLAG-ferritin was eluted by competition with flag peptide and analyzed using a combination of SDS PAGE and native gel electrophoresis to reveal the expression and self-assembly of the FLAG-ferritin. Ferritin monomers are about 21 kDa molecular weight, whereas the self-assembled nanoparticle is about 600-700 kDa. The native gel analysis revealed that the FLAG-E. coli ferritin self-assemble into the complex poorly, indicating that the GFPV.sub.HH-mCherry-E. coli Ferritin expressed in mammalian cells also failed to self-assemble. It was determined that mammalian ferritins assembled better than bacteria ferritins in human cells. Horse ferritin heavy chain performed particularly well when compared to other ferritin fusion constructs, therefore, horse ferritin was selected for further analysis.

[0101] Mammalian ferritins comprise both heavy and light chains. However, only the heavy chain oxidizes ferrous iron to ferric oxide, and the iron core is where EM contrast comes from. The E. coli ferritin particles comprise heavy chains only, which is a very simple system. Also, many bacterial proteins can express and function well in human cells, such as bacterial proteins used in the CRISPER technology. Thus, it is surprising that the E. coli ferritin did not self-assemble well in human cells.

[0102] Assembly of candidate genetically modified FIREnano probes by using horse ferritin was assessed (FIG. 8). These probes were expressed in mammalian cells and detected by mCherry fluorescence or Halo tag labeling, showing that these probes do not aggregate in cells. The expressed constructs were subjected to native PAGE, which showed that all the horse ferritin constructs were able to assemble as >500 kDa particles. However, iron loading was relatively inefficient as evidenced by Prussian Blue staining of ferritins on native gels when compared to purified horse spleen ferritin as a positive control. The results indicate the FIREnano probes form ferritin nanoparticles but are not iron-loaded efficiently when expressed under typical cell-culture conditions.

[0103] To overcome this, transferrin and/or ferric ammonium citrate (FAC) was added into the cell culture medium. Prussian blue staining of particles in native gels showed that the iron loading efficiency was increased from 5% to 42% after optimization (FIG. 9).

[0104] Finally, both TEM and Cryo-EM was performed on horse spleen ferritin and the FLAG-NLS-GFPV.sub.HH-horse ferritin purified from human cells, which show that they self-assemble into particles that have 12 nm protein shells and 4-5 nm ferric oxide cores (FIG. 10), very similar to the commercially purchased horse spleen ferritin.

[0105] To show that the GFPV.sub.HH-mCherry-horse ferritin probe could label GFP tagged intracellular targets through GFPV.sub.HH binding, an adenoviral protein E4-ORF3 marker was used as an example since it assembles huge fibers when it is transiently over-expressed. The large fiber morphology allows facile correlation of light and EM images, which facilitates EM analysis. ORF3-GFP expressing U2OS cells were transfected with GFPV.sub.HH-mCherry-ferritin encoding plasmid and the cells were cultured with 500 M FAC to iron-load the FIREnano probe. GFPV.sub.HH-mCherry-ferritin successfully labeled ORF3-GFP fiber by fluorescent signal. Furthermore, iron core signals (dark round spots) originating from ferritin particles were identified in the ORF3-GFP fiber region by TEM (FIG. 11). Using Electron energy loss spectroscopy (EELS), the enrichment of iron element at the ferritin labeled ORF3 region was confirmed (FIG. 12), indicating the dark particles are loaded with ferric oxide and their identity as ferritin particles.

[0106] mCherry can form a dimer. Therefore, to offset the possibility that mCherry-ferritin constructs can nucleate with each other at high local concentrations, mCherry was replaced with a Halo-tag. The Halo tag is a modified hydrolase that covalently links chloroalkane-bound to functional groups, such as fluorescent dyes or biotin. Using the halotag the probe can be visualized using brighter and more stable fluorescent molecules, with different excitation and emission spectrums than that of mCherry. Halotag detection is also compatible with super-resolution methods such as Storm imaging. Native gel and silver staining shows that GFPV.sub.HH-Halo-ferritin can form particles even more efficiently than GFPV.sub.HH-mCherry-ferritin.

[0107] To show that the GFPV.sub.HH-mCherry-horse ferritin probe could label GFP tagged intracellular targets through GFPV.sub.HH binding, an adenoviral protein E4-ORF3 marker was used as an example since it assembles huge fibers when it is transiently over-expressed. The large fiber morphology allows facile correlation of light and EM images, which facilitates EM analysis. ORF3-GFP expressing U2OS cells were transfected with GFPV.sub.HH-mCherry-ferritin encoding plasmid and the cells were cultured with 500 M FAC to iron-load the FIREnano probe. GFPV.sub.HH-mCherry-ferritin successfully labeled ORF3-GFP fiber by fluorescent signal. Furthermore, iron core signals (dark round spots) originating from ferritin particles were identified in the ORF3-GFP fiber region by TEM (FIG. 11). Using Electron energy loss spectroscopy (EELS) and correlated light/EM tomography, the enrichment of iron element at the ferritin labeled ORF3 region was confirmed (FIGS. 12 and 13), indicating the dark particles are loaded with ferric oxide and their identity as ferritin particles.

[0108] The GFPV.sub.HH-mCherry-horse ferritin probe was next used to observe a nuclear structure, namely telomeres. Telomeres are repetitive DNA sequences that bind to TRF1 and TRF2 and that form the shelterin complex to protect the chromosome end. A stable TRF1-GFP expressing Hela cell line was used in these assays. Telomere is a good target since each telomere contains around 500-3000 TTAGGG repeats, thus thousands of TRF1-GFP proteins are associated with each telomere. GFPV.sub.HH-mCherry-horse ferritin was expressed in the stable TRF1-GFP expressing Hela cell line with 500 M FAC to iron-load the FIREnano probe. Labeling of GFP-TRF1 telomeres was assessed fluorescence microscopy and EM. Remarkably, even in TEM thin sections, GFPV.sub.HH-mCherry-horse ferritin particles can be readily observed as clusters, with each cluster representing one telomere DNA repeat and organization in the nucleus (FIG. 14). This shows that the strategy in using ferritin particles to label a specific gene locus was successful and enables direct observation of ferritin particles in EM images.

[0109] Additionally, assays were performed to show that the FIREnano probe can be combined with ChromEMT to visualize the structure of DNA and chromatin at telomeric repeats. ChromEMT combines electron microscopy tomography (EMT) with the (ChromEM) DNA labeling method that selectivity enhances the contrast of DNA. The technique is described in Ou et al (ChromEMT: Visualizing 3D chromatin structure and compaction in interphase and mitotic cells, Science, 357(6349), 2017), which is incorporated by reference herein. ChromEMT exploits a fluorescent dye (DRAQ5), which binds to DNA, and upon excitation, catalyzes the deposition of diaminobenzidine polymers on the surface, enabling chromatin to be visualized with OsO4 in EM. Hela TRF1-GFP cells were transfected with GFPV.sub.HH-mCherry-horse ferritin with 500 M FAC in the media to iron-load the FIREnano probe, and 24 hours after transfection the cells were fixed with glutaraldehyde and stained with DRAQ5. Photo-oxidation was performed. The transmitted light image of post-photo-oxidation shows that DRAQ5 has photo-oxidized DAB monomer into DAB polymer that coated chromatin (FIG. 15). To reveal chromatin ultrastructure, Navminator was used to locate a telomere region and collected a 4-tilt EM tomography. Impressively, hundreds of ferritin particles were found in the background of DRAQ5 photo-oxidation, while the chromatin polymers are clearly visible by ChromEM labeling (FIG. 16). These results were repeated consistently in different cells and experiments, indicating the ferritin probe is compatible with ChromEM. The results of these assays provide, for the first time, in situ chromatin ultrastructure of a telomere.

[0110] In another example, the GFPV.sub.HH-mCherry-horse ferritin probe was used to label Connexin43-GFP (Cx43-GFP), which is an important component in characteristic gap junction structure in the cytoplasm (FIG. 17). GFPV.sub.HH-mCherry-ferritin successfully labeled and colocalized with Connexin43-GFP by fluorescent signal. Through 70 nm thin section TEM, iron-loaded ferritin particles were observed to co-localize with the Cx43-GFP with very uniform size of 4-5 nm diameter from the GFPV.sub.HH-mCherry-ferritin labeled Gap junction region. A corresponding assay was conducted using the GFPV.sub.HH-halo-ferritin to label the Cx43-GFP gap junction region. Ferritin particles were detected by 4-tilt tomogram. The projection of 30 tomogram slices shows very clear alignment of many ferritin particles close to the gap junction, with their distance to the cell membrane all at comparable level.

[0111] To show that the FIREnano probe can be used to label chromosomal structures near regulatable genomes structures, the probes were assessed for labeling of LacO binding sites in a LacO/TetOn genomic insert. FIG. 18 provides an overview of the genomic insert. About 4 Mb sequences containing 200 gene arrays are artificially incorporated into chromosome 1 in the U2OS cell line. In each gene array, there are about 256 lacO binding sites, 96 Tet On promoter repeats, a mini CMV promoter, a CFP-SKL reporter which will locate in peroxisome in cytoplasm, and 24 MS2 stem loops, intron and exon. The CFP-SKL expression can be induced by adding doxycycline to the cell culture media. As depicted in the schematic, the FIREnano probe (e.g., GFPV.sub.HH-Halo-horse ferritin) can be applied to label LacI-GFP which binds to LacO sequences in both silent (without doxycycline) and active (with doxycycline) state. The modified cell line was transfected with GFPV.sub.HH-mCherry-ferritin encoding plasmid and the resulting FIREnano probe successfully label LacI-GFP in both silent (upper) and active (bottom) state (FIG. 18B).

[0112] The modified cell line depicted in FIG. 18 was transfected with GFPV.sub.HH-mCherry-ferritin encoding plasmid and the cells were cultured with 500 M FAC to iron-load the FIREnano probe and subsequently processed for light and EM analysis. Confocal and ChromEMT analysis show co-localization of the LacI-GFP and FIREnano probes, and labeling of the LacO genomic insert (FIG. 19). Labeling was unaffected by the presence or absence of Doxycycline (FIG. 20). However, as shown in FIG. 21-22, the FIREnano distribution under silent state (without doxycycline) indicated LacO array formed a compact sphere structure, wherein as the FIREnano distribution under active state indicated that the LacO array occupied a bigger area a more open structure than in silent state.

[0113] Further, these assays indicate that replacement of the GFPV.sub.HH targeting domain of the ferritin probe with other targeting domains can be used to label many different targets within cells, such as DNA, RNA, and proteins. For example, replacement of the GFPV.sub.HH targeting domain with dCas9 can facilitate labeling any genomic locus using the dCas9/TALEN technology. An increasing number of single chain antibodies that recognize different intracellular targets are available, such as anti-suntag single chain antibody (scFv), anti-mCherry nanobody. Similarly, RNA tags, including MS2, PP7 and lambda N22, can be recognized by RNA binding proteins, such as MCP, PCP, and N22p, which can be used as targeting domains. Further, PUF proteins bind to related sequence motifs in the 3 untranslated region (3UTR) of specific target mRNAs, and therefore can also be used as targeting domains.

[0114] For targeting of particular DNA sequences, DNA binding proteins, such as transcription factors, can used as a targeting domain Further, a CRISPER/dCas9 fusion, or TALE fusion with a detection tags and a mammalian (e.g., horse) ferritin can be made. CRISPR uses a small guide (sg) RNA with a protospacer motif to target the Cas9 endonuclease protein to target DNA sequences. Mutations that ablate the nuclease activity of Cas9 (dCas9) enable it to be repurposed to label endogenous genomic loci. Transcription activator-like effector nucleases (TALEN) are restriction enzymes that can be engineered to cut specific sequences of DNA. They are made by fusing a TAL effector DNA-binding domain to a DNA cleavage domain (a nuclease which cuts DNA strands). Direct (dCas9-detection tag-ferritin; TALE-detection tag-ferritin) or indirect (dCas9-GFP; TALE-GFP: GFPV.sub.HH-halo-ferritin) fusion allows the labeling any genomic sequences of interest.

[0115] Finally, to avoid transient transfection which might affect the ultrastructure of the cell and also to attain more even staining, the FIREnano probe can be expressed in cells using an adenovirus vector, which enables temporal control (hours post infection) as well as transcriptional control and downstream multiplexing of different labeling methods.

Materials and Methods

[0116] Cloning. To make the ferritin constructs, E. coli ferritin, Helicobacter ferritin, horse ferritin heavy chain, human ferritin heavy chain were human codon optimized. Different element/modules liken NLS, GFPV.sub.HH, mCherry, halo tag, FLAG tag, GS linker were position adjusted and designed for whole ferritin fusion constructs. The whole encoding sequence (e.g., FLAG-NLS-GFPV.sub.HH-halo-horse ferritin heavy chain) was synthesized through IDT and inserted into the multiple cloning sites of pcDNA3 through Gibson reaction.

[0117] Cell culture and transfection. HeLa TRF1-GFP, Hela Cx43-GFP, or U2OS cells were cultured in Dulbecco's Modified Eagle Medium (Invitrogen) supplemented with 10% fetal bovine serum. Transfection was performed in 35 mm MatTek dishes. 1 g ferritin construct DNA was transfected (for 3.5 cm dishes) using X-tremeGENE (sigma). 24 hours after transfection, ferric ammonium citrate was added into cell culture media (final concentration: 500 M). 48 hours after transfection, cells were fixed with 2.5% glutaraldehyde, and imaged, followed by sample embedding.

[0118] EM sample preparation. Cells were fixed with 2.5% EM grade glutaraldehyde (Electron Microscopy Sciences) in 5 mM CaCl2, 0.1M sodium cacodylate acid buffer, pH 7.4, at room temperature for 5 minutes with continued fixation for an additional hour on ice. From this step on, the cells were always treated either on ice or on a cold stage set at 4 C. All solutions were cold before applying to cells. After imaging, cells were stained for 30 minutes with a final concentration of 2% osmium tetroxide, 2 mM CaCl2, 1.5% potassium ferrocyanide (no performed when EELS was collected) in 0.15M sodium cacodylate acid buffer. After staining, cells were washed with double distilled water 52 minutes. Then cells were ethanol dehydrated in increasing concentration of ethanol (20-50-70-90-100-100% of ice cold ethanol with 3 minutes incubation for each concentration). Durcupan resin is prepared with the following ratio: components A:B:C:D=11:10:0.3:0.1 g. Dehydrated cells were infiltrated with solution containing 50% ethanol, 50% pre-mixed Durcupan resin for 30 minutes. The solution was replaced with 100% Durcupan resin and infiltrated for 30 minutes. This step was repeated 4 more times and the embedded cells placed in a vacuum oven for 48 hours (60 C.). For TEM, epoxy embedded cells were cut using a diamond knife into 70-80 nm sections. For tomography, embedded cells were cut into 250 nm sections.

[0119] FLAG-tagged ferritin purification. 24 g FLAG-tagged ferritin constructs was transfected into 10 cm dishes using lipo2000 (ThermoFisher). 24 hours after transfection, ferric ammonium citrate was added into cell culture media (final concentration: 500 M). 48 hours after transfection, cells were lysed using RIPA buffer. Clarified cell lysate was incubated with 50 l ANTI-FLAG M2 Magnetic Beads (Sigma) overnight. Beads was washed with RIPA buffer and PBS buffer 3 times each. 100 l PBS with FLAG peptide (4 mg/ml) was incubated with beads for 3 hours for elute FLAG-ferritin off the beads. Eluted fractions were subjected to 3-12% Bis-Tris SDS-PAGE, or NativePAGE Bis-Tris Gels (ThermoFisher).

[0120] Silver staining. After SDS-PAGE and native gel running, silver staining was performed using Pierce Silver Stain Kit (ThermoFisher).

[0121] Prussian blue staining. After SDS-PAGE and native gel running, the gel was washed with water for 5 minutes. Prussian blue staining reagent was prepare: 2% ferrocyanide, 2% HCl (1-1.5 g potassium ferrocyanide, 43.7 ml ddH2O, 2.7 mL HCl). Gel was incubated in prussian blue staining for 1 hour in room temperature. Gel was washed with water frequently for 1 hour. Dissolve 12.5 mg of DAB powder in 500 uL of DMSO, add 1 TBS (50 mM Tris-Cl, pH 7.5 150 mM NaCl) till 50 mL, and 84 uL 30% H2O2. Gel was incubated in DAB buffer at room temperature until dark bands show up, then block the reaction with water.

[0122] Tomography Data collection. Plastic sections were first carbon coated to improve their stability under the electron beam. 5 and 10 nm colloidal gold particles were deposited on both sides of the sections as fiducial markers for image alignment purpose. The tomography data was collected on a FEI Titan microscope operating at 300 kV with a 4K by 4K Gatan Ultrascan CCD camera, and the specimen was loaded in a rotation sample holder manufactured by Fischione Instruments (Model 2040). SerialEM was used for automatic tilt series acquisition to acquire all the micrographs at different specimen orientation. The 8-tilt data collection scheme is shown in FIG. 3B, where the specimen orientation is displayed for each tilt series and the order for which the tilt series is acquired is shown in numerical order in the middle panel. For each tilt series, adjustments are made to stage/sample height to ensure identical eucentric height, and magnification for all tilt series. The sequence of tilt series following the multilevel access scheme, which minimizes errors associated with sample shrinkage evenly across all tilt series. For each tilt series, images were acquired by rotating the sample holder from 60 to +60 with 1 increments.

[0123] It will be apparent that the precise details of the methods or compositions described may be varied or modified without departing from the spirit of the described embodiments. We claim all such modifications and variations that fall within the scope and spirit of the claims below.