VECTORS, GENETICALLY MODIFIED BACTERIA, AND METHODS OF MAKING AND USING

20200299665 ยท 2020-09-24

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided herein are a vector, a genetically modified bacterium including the vector, methods of making the bacterium, methods of using the bacterium, and kits including the bacterium. The vector includes a coding region encoding at least one antimicrobial peptide, and the antimicrobial peptide includes at least one lysin.

    Claims

    1. A vector comprising a coding region encoding a heterologous promoter operably linked to a coding region encoding an antimicrobial peptide, wherein the antimicrobial peptide comprises a sequence having at least 90% homology to at least one of the catalytic domain of Lysin 2 (Lys2), the catalytic domain of Lysin 3 (Lys3), Lys2ConCat (SEQ ID NO:3), and Lys2Con20Cat (SEQ ID NO:4).

    2. The vector of claim 1, wherein the heterologous promoter comprises a chloride-inducible promoter or a Pon promoter.

    3.-4. (canceled)

    5. The vector of claim 1, wherein the vector comprises an additional coding region that is operably linked to a second promoter, and wherein the additional coding region encodes a modulator protein that regulates the expression of the coding region encoding the antimicrobial peptide.

    6. (canceled)

    7. The vector of claim 1, wherein the antimicrobial peptide comprises Lysin 2 (Lys2), Lysin 3 (Lys3), Lys2ConCat (SEQ ID NO:3), or Lys2Con20Cat (SEQ ID NO:4), or a combination thereof.

    8. The vector of claim 1, wherein the antimicrobial peptide comprises Lys2 and Lys3.

    9.-12. (canceled)

    13. A genetically modified bacterium comprising the vector of claim 1.

    14. The genetically modified bacterium of claim 13, wherein the genetically modified bacterium comprises a probiotic bacterium.

    15. The genetically modified bacterium of claim 13, wherein the genetically modified bacterium comprises a bacterium chosen from Lactoccocus lactis NZ9000 (L. lactis), Escherichia coli Nissle 1917, Lactobacillus acidophilus, Lactobacillus reuteri, Lactobacilus bulgaricus, or Bacillus subtillis, or a combination thereof.

    16. The genetically modified bacterium of claim 13, wherein the genetically modified bacterium is a Lactococcus spp. or a Lactobacillus spp.

    17. (canceled)

    18. The genetically modified bacterium of claim 13, wherein the genetically modified bacterium secretes Lys2 or Lys3 or both.

    19. A method comprising exposing a pathogenic microbe to the genetically modified bacterium of claim 18.

    20. The method of claim 19, wherein the method further comprises administering the genetically modified bacterium to a subject having the pathogenic microbe present in its gastrointestinal tract.

    21. (canceled)

    22. The method of claim 20, wherein the subject is a member of the class Ayes.

    23.-28. (canceled)

    29. A kit comprising the vector of claim 1.

    30. A kit comprising the genetically modified bacterium of claim 13.

    31. A composition comprising a peptide, the peptide comprising a sequence having at least 90% homology to Lys2ConCat (SEQ ID NO:3) or Lys2Con20Cat (SEQ ID NO:4) or both.

    32. The composition of claim 31, the peptide comprising Lys2ConCat (SEQ ID NO:3) or Lys2Con20Cat (SEQ ID NO:4) or both.

    33. The composition of claim 31, wherein the peptide further comprises a cell wall binding domain.

    34.-54. (canceled)

    55. A vector comprising a coding region encoding a heterologous promoter operably linked to a coding region encoding an antimicrobial peptide, wherein the heterologous promoter comprises a chloride-inducible promoter, wherein the antimicrobial peptide comprises a sequence having at least 90% homology to at least one of the catalytic domain of Lysin 2 (Lys2), the catalytic domain of Lysin 3 (Lys3), Lys2ConCat (SEQ ID NO:3), and Lys2Con20Cat (SEQ ID NO:4), wherein the coding region encoding the antimicrobial peptide is operably linked to a coding region encoding a signal peptide, and wherein the vector comprises an additional coding region that is operably linked to a second promoter, and further wherein the additional coding region encodes a modulator protein that regulates the expression of the coding region encoding the antimicrobial peptide and is operably linked to the heterologous promoter.

    56. A genetically modified bacterium comprising the vector of claim 55, wherein the genetically modified bacterium comprises Lactoccocus lactis NZ9000 (L. lactis), Escherichia coli Nissle 1917, Lactobacillus acidophilus, Lactobacillus reuteri, Lactobacilus bulgaricus, and or Bacillus subtillis, or a combination thereof; and wherein the genetically modified bacterium secretes the antimicrobial peptide.

    Description

    BRIEF DESCRIPTION OF THE FIGURES

    [0048] FIG. 1 shows a schematic structure of a gram-positive peptidoglycan with the putative cleavage sites of Lysin 2 (cleavage site: L2CS), a predicted muramidase, and Lysin 3 (cleavage site: L3CS), a predicted N-acetylmuramoyl-L-alanine amidase.

    [0049] FIG. 2A shows an exemplary expression/secretion vector. In some embodiments, the vector can be used to express Lysin 2 (Lys2) and Lysin 3 (Lys3) in Lactococcus lactis. The vector drives expression of inserted genes via a chloride-inducible promoter (CIP) P.sub.gad (Geldart et al. Antimicrob Agents Chemother. 2017; 61(4):e02033-16). P.sub.gadR is a constitutive promoter controlling the production of the activator protein GadR which activates the P.sub.gad; Cm is chloramphenicol; RepA=a replication gene for E. coli plasmid replication; RepC=a replication gene for Streptococcal plasmid replication. Genes to be expressed are cloned downstream of P.sub.gad. FIG. 2B shows a schematic of exemplary Lys2 and Lys3 genes fused to the high-efficiency L. lactis signal peptide SLPmod. FIG. 2C shows an exemplary amino acid sequence of Lys2 (SEQ ID NO:1). FIG. 2D shows an exemplary amino acid sequence of Lys3 (SEQ ID NO:2).

    [0050] FIG. 3A-FIG. 3C show lytic activity of Lys2 and Lys3 from supernatants of engineered L. lactis. Filter-sterilized supernatants collected as indicated in Example 1 were introduced to CP suspensions. FIG. 3A. These enzymes hydrolyze peptidoglycan in the cell wall resulting in cell lysis and decreased optical density. FIG. 3B. Cp ATCC 12916 (CP12) was exposed to either 33% supernatant from Lys3 secreting L. lactis or a control supernatant with no antimicrobial peptide (AMP) expression. FIG. 3C. CP strains Cp ATCC 12916 (CP12), Cp ATCC 13124 (CP13), Cp WT Cp26 (CP26), and Cp WT Cp39 (CP39) were exposed to 33% supernatant from Lys2 secreting L. lactis or a control supernatant with no AMP expression. Error bars show standard errors; n=3.

    [0051] FIG. 4 shows an adaptation of a method using microfluidic co-encapsulation of antimicrobial protein producer and target pathogen (Scanlon et al. Biotechnol. Bioeng. 2014, 111:232-243) for use with L. lactis and CP. A mutagenic library is first constructed in L. lactis, 1, mixed with CP in low-gel agarose, 2, and encapsulated via a microfluidic device, 3. Droplets are solidified and incubated in-emulsion to allow AMP production, and washed with appropriate fluorescent dyes to indicate activity, 4. Droplets are sorted via fluorescent-activated cell sorting, 5, enriching for droplets with higher total activity. Secretion rate can then be decoupled from per-molecule activity via HPLC for top clones, 6.

    [0052] FIG. 5 shows exemplary thermal response of the lysins of Example 4. k.sub.i for each sample was determined and normalized for each lysin by the maximum value observed (see Table 1).

    [0053] FIG. 6 shows a multiple-sequence alignment of the catalytic domain of Lys2 (SEQ ID NO:7), Lys2ConCat (SEQ ID NO:3), and Lys2Con20Cat (SEQ ID NO:4). (*) indicates identical amino acids, (:) indicates conservation between strongly similar groups, (.) indicates conservation between weakly similar groups, ( ) indicates amino acids that are not related. Clustal Omega with standard settings was used for all multiple sequence alignments (available on the world wide web at ebi.ac.uk/Tools/msa/clustalo/).

    [0054] FIG. 7 shows a sequence alignment of cell wall binding domain (CWBDs) of Lys2 (SEQ ID NO:9) and the CWBD of Lys3 (SEQ ID NO:10). (*) indicates identical amino acids, (:) indicates conservation between strongly similar groups, (.) indicates conservation between weakly similar groups, ( ) indicates amino acids that are not related. Clustal Omega with standard settings was used for all multiple sequence alignments (available on the world wide web at ebi.ac.uk/Tools/msa/clustalo/).

    [0055] FIG. 8 shows a multiple-sequence alignment of the catalytic domain of Lys2 (SEQ ID NO:7), the catalytic domain of Lys3 (SEQ ID NO:8), the catalytic domain of Lys2Con (SEQ ID NO:3), and the catalytic domain of Lys2Con20 (SEQ ID NO:4). (*) indicates identical amino acids, (:) indicates conservation between strongly similar groups, (.) indicates conservation between weakly similar groups, ( ) indicates amino acids that are not related. Clustal Omega with standard settings was used for all multiple sequence alignments (available on the world wide web at ebi.ac.uk/Tools/msa/clustalo/).

    DETAILED DESCRIPTION

    [0056] In some aspects, this disclosure describes a vector, a genetically modified bacterium including the vector, methods of making the bacterium, methods of using the bacterium, and kits including the bacterium. In some embodiments, the vector and/or the genetically engineered bacterium are preferably suitable for the treatment and/or control of a pathogenic microbe including, for example, Clostridium perfringens (CP).

    [0057] In another aspect, this disclosure describes a lysin catalytic domain generative model and novel lysin catalytic domains and lysins generated, at least in part, using the lysin catalytic domain generative model.

    Clostridium perfringens (CP)

    [0058] Clostridium perfringens (CP) is a bacterial pathogen that exerts great pressure on poultry producers. CP is a Gram-positive, gas-producing, rod-shaped bacterium that causes necrotic enteritis (NE) in poultry, resulting in billions of dollars in lost product worldwide (McDevitt et al., Worlds. Poult. Sci. J. 2006; 62:221; Savva et al., J. Biol. Chem. 2013; 288: 3512-3522; M'Sadeq, et al., Anim. Nutr. 2015; 1:1-11; Miller et al., Avian Dis. 2010; 54(1):33-40; Glisson et al. Avian Dis. 2004; 48(3):658-62; Zhang et al., Avian Dis. 2010; 54(4):1298-300. Scallan et al., Emerg. Infect. Dis. 2011; 17:7-15; Official Publication of the Association of American Feed Control Officials (AAFCO), 2016). Different strains of CP accomplish this virulence through the production of 5 total endotoxins as well as a pore-forming toxin, NetB (Savva et al., J. Biol. Chem. 2013; 288: 3512-3522).

    [0059] CP infections increase as the use of agricultural antibiotics decrease. In addition, CP can cause illness in humans as a foodborne infection, and an estimated 900,000 cases in humans occur in the United States per year (Scallan et al., Emerg. Infect. Dis. 2011; 17:7-15). Products with high efficacy and specificity are needed to control CP outbreaks and prevent product loss.

    [0060] In some embodiments, the genetically engineered bacteria described herein may be used to reduce pathogenic CP in poultry. In some embodiments, the pathogenic CP can include at least one of the following CP strains: Cp ATCC 12916 (CP12), Cp ATCC 13124 (CP13), Cp WT Cp26 (CP26), Cp WT Cp39 (CP39), and Clostridium perfringens B str. ATCC 3626.

    Genetically Modified Bacterium

    [0061] In some embodiments, a genetically modified bacterium includes a modification that allows it to express and/or deliver an antimicrobial peptide (AMP) to the gastrointestinal (GI) tract of a subject.

    [0062] In some embodiments, the genetically modified bacterium includes a probiotic bacterium. In some embodiments, the genetically modified bacterium includes a Lactococcus spp. or a Lactobacillus spp. In some embodiments, the genetically modified bacterium includes at least one of Lactoccocus lactis NZ9000 (L. lactis), Escherichia coli Nissle 1917, Lactobacillus acidophilus, Lactobacillus reuteri, Lactobacilus bulgaricus, and Bacillus subtillis.

    [0063] Lactobacillus acidophilus, Lactobacillus bulgaricus, Lactobacillus reuteri, Enterococcus faecium, and Bacillus subtilis are considered direct-fed microbial products (DFMs) and are generally regarded as safe to consume (GRAS). DFMs are purported to contain live (viable) microorganisms. The Official Publication of the Association of American Feed Control Officials (AAFCO), under Section 36 Fermentation Products, defines animal feed ingredients derived from spent fermentation processes. For regulatory purposes, direct-fed microbial products are considered a subclass of fermentation or yeast products because they are similarly produced. A direct-fed microbial product listed by the AAFCO Official Publication and labeled with the AAFCO-approved label statement for live microorganism content, and not labeled or promoted with any therapeutic or structure/function claims, will be regulated as a food as defined in Section 201(f)(3) and may not require FDA regulatory attention.

    [0064] In some embodiments, the genetically modified bacterium preferably includes L. lactis.

    Antimicrobial Proteins (AMPs)

    [0065] In some embodiments, the genetically modified bacterium expresses an antimicrobial peptide (AMP). An AMP has antimicrobial activity that inhibits or kills a target microbe (including, for example, a pathogenic microbe such as CP). AMPs may offer a number of advantages over more traditional antibiotic counterparts.

    [0066] Traditional antibiotics are often small secondary metabolites that are stable and that exhibit broad-spectrums of activity. As a result of these qualities, traditional antibiotics are easy to administer and cheap to produce. However, their broad-spectrum of activity leads to both the clearance of commensal organisms which compose the complex microflora in areas such as the gastrointestinal (GI) tract; leading to secondary infections by opportunistic pathogens such as Enterococcus faecium and Clostridium difficile. In addition to these problems, broad-spectrum activity elicits a selective pressure across many off-target organisms, increasing the likelihood of the development of genetic clusters which provide resistance and can be subsequently transferred via horizontal gene transfer to other organisms.

    [0067] AMPs may address these concerns because they often have very narrow activity spectrums and only affect target or closely related organisms. However, AMPs are often rapidly degraded in areas such as the GI tract, a feature that has historically limited their use.

    [0068] In some embodiments, the genetically modified bacterium may be designed to secrete an AMP. As further discussed herein, in some embodiments, the AMP can be secreted within a microenvironment of interest, overcoming delivery barriers including rapid degradation that have previously limited the use of AMPs.

    [0069] In some embodiments, the AMP includes a lysin.

    [0070] A lysin (also referred to as an endolysin) is an enzymatic AMP generally having two domains. One domain provides catalytic activity and one domain provides specificity (e.g., binding to particular Gram-positive organisms); the domains are traditionally arranged N-terminally and C-terminally, respectively (Borysowski, et al., Exp. Biol. Med. 2006; 231:366-377; Pastagia et al., J. Med. Microbiol. 2013; 62:1506-1516; Schmitz et al., Appl. Microbiol. Biotechnol. 2011; 89:1783-95). The catalytic domain is a peptidoglycan hydrolase which may specifically cleave one of the bonds found within a peptidoglycan, the primary structural building block found within the cell walls of Gram-positive organisms. The domain providing specificity is sometimes referred to as a cell wall binding domain.

    [0071] Lysins can degrade the cell walls of target bacteria with high activity and specificity (Borysowski, et al., Exp. Biol. Med. 2006; 231:366-377; Pastagia et al., J. Med. Microbiol. 2013; 62:1506-1516). This degradation continues until the osmotic pressure across the membrane exceeds the limit of the degraded cell wall, resulting in cell lysis. The specificity of these proteins may be enabled by interactions with unique peptidoglycan modifications on the cell wall. These modifications enable bacteriophage, the biological origin of endolysins, to lyse only their host bacterium even in complex environments such as the GI tract. In addition to this high specificity, rate of resistance emergence towards endolysins is very low. Previous efforts with staphylococci, pneumococci, and Bacillus cereus were unable to produce mutants with endolysin-resistance in the laboratory (Pastagia et al., J. Med. Microbiol. 2013; 62:1506-1516).

    [0072] In some embodiments, the lysin includes at least one of Lys2 and Lys3. Lys2 is a muramidase, and Lys3 is a N-acetylmuramoyl-L-alanine amidase. Both lysins use a pair of SH3 binding domains that may provide specificity through binding to the peptidoglycan of Clostridium perfringens with high specificity.

    [0073] Although Lys2 and Lys3 were previously identified as putative lysins through a bioinformatic analysis of multiple CP genomes (Schmitz et al., Appl. Microbiol. Biotechnol. 2011; 89:1783-95), Lys2 and Lys3 were among many putative lysins identified, and, at the time of the invention, their function and specificity had not been experimentally verified. Moreover, not all of the previously identified putative lysins showed activity against Clostridium perfringens. For example, neither Lys1 (PlyCM (characterized in Schmitz et al., Appl. Microbiol. Biotechnol. 2011; 89:1783-95)) or Lys4 (Genbank Accession No. ZP_02630819) showed activity in an initial screen.

    [0074] In some embodiments, Lys2 includes the amino acid sequence SEQ ID NO:1. In another embodiment, Lys2 includes an amino acid sequence that is structurally similar to SEQ ID NO:1.

    [0075] In some embodiments, Lys3 includes the amino acid sequence SEQ ID NO:2. In another embodiment, Lys3 includes an amino acid sequence that is structurally similar to SEQ ID NO:2.

    [0076] In some embodiments, the AMP includes the catalytic domain of a lysin. In some embodiments, the AMP includes a sequence having at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% amino acid sequence homology to the catalytic domain of at least one of Lysin 2 (Lys2), Lysin 3 (Lys3), Lys2Con (SEQ ID NO:5) or Lys2Con20 (SEQ ID NO:6). In some embodiments, the catalytic domain of Lys2Con includes Lys2ConCat (SEQ ID NO:3). In some embodiments, the catalytic domain of Lys2Con20 includes Lys2Con20Cat (SEQ ID NO:4).

    [0077] In some embodiments, the lysin catalytic domain may be generated using a lysin catalytic domain generative model as described herein. For example, in some embodiments the lysin may include Lys2ConCat (SEQ ID NO:3) or Lys2Con20Cat (SEQ ID NO:4). In some embodiments, a lysin including the lysin catalytic domain generated using a generative model can demonstrate improved thermal stability and/or improved lytic activity relative to a wild type lysin.

    [0078] In some embodiments, the AMP may include an AMP described in U.S. Patent Publication No. 2016-0279175 including, for example, a Type IIa bacteriocin. A Class IIa bacteriocin can include, for example, Enterocin A, Hiracin JM79, and Enterocin P. In some embodiments, the AMP may include an AMP described in Table 2 of U.S. Patent Publication No. 2016-0279175.

    Lysin Catalytic Domain Generative Model

    [0079] A lysin catalytic domain generative model may be used to generate a model-generated lysin catalytic domain having a model-generated lysin catalytic domain sequence. In some embodiments, a model-generated lysin catalytic domain demonstrates improved physical properties over a wild type lysin catalytic domain and/or a lysin including the model-generated lysin catalytic domain demonstrates improved physical properties over a lysin including the wild type lysin catalytic domain. The improved physical properties can include, for example, improved thermal stability, improved lytic activity, improved chemical stability, improved stability in low pH, improved stability in environments of high bile concentrations, improved stability against proteolysis, improved solubility, and/or lower immunogenicity.

    [0080] In some embodiments, a lysin catalytic domain generative model includes generation of a guide sequence; identification of mutable sequence positions in the guide sequence; generation of a structurally-guided multiple sequence alignment; generation of a reduced multiple sequence alignment; and generation of a model-generated lysin catalytic domain. Particular implementations of this methodology can be accomplished by using any suitable computational tool or tools with the necessary characteristics or functionalities.

    [0081] In some embodiments, generation of a guide sequence and identification of mutable sequence positions in the guide sequence can include aligning two or more lysin catalytic domain sequences. In some embodiments, the lysin catalytic domain sequences to be aligned may be selected from sequences having a taxonomic label of an organism against which the lysin is to be generated. In some embodiments, the organism against which the lysin is to be generated can include a Gram-positive organism including, for example, Enterococcus faecium, Enterococcus faecalis, Clostridium difficile, Clostridium perfringens, Staphylococcus aureus, and/or Streptococcus pneumoniae. In some embodiments, the organism against which the lysin is to be generated preferably includes Clostridium perfringens.

    [0082] In some embodiments, the lysin catalytic domain sequences can be selected by identifying sequences homologous to a known lysin catalytic domain. In some embodiments, identifying sequences homologous to a known lysin catalytic domain may be identified using a sequence similarity search tool including, for example, Jackhmmer, PSI-BLAST, PSI-Search, etc.

    [0083] In some embodiments, the lysin catalytic domain sequences to be aligned may be obtained from a protein sequence database including, for example, UniProt, Swiss-Prot, Pfam, InterPro, PEDANT, PROSITE, ProDom, etc.

    [0084] In some embodiments, the lysin catalytic domain sequences may be aligned using a structurally-guided multiple sequence aligner including, for example, the PROMALS3D, T-COFFEE, MAFFT, etc.

    [0085] In some embodiments, a consensus sequence derived from the multiple sequence alignment may form a seed sequence. In some embodiments, a model-generated lysin catalytic domain sequence may include the seed sequence. For example, as described in Example 4, a model-generated lysin catalytic domain sequence can include the seed sequence Lys2ConCat (SEQ ID NO:3).

    [0086] Additionally or alternatively, a non-gapped sequence position of the seed sequence may be used to determine a mutable position or a set of mutable positions. For example, a non-gapped sequence position in a seed sequence exhibiting site diversity above some tunable threshold may be used to select a set of mutable positions.

    [0087] In some embodiments, one or more additional lysin catalytic domain sequences with either homology to the seed sequence, or homology with a curated database of lysin catalytic domain family members, may be acquired from a protein sequence database. In some embodiments, identifying sequences homologous to the seed sequence may be identified using a sequence similarity search tool including, for example, Jackhmmer, PSI-BLAST, PSI-Search, etc.

    [0088] In some embodiments, lysin catalytic domain family members may have a taxonomic label within a phylum of the organism against which the lysin is to be generated. For example, when the organism against which the lysin is to be generated includes Clostridium difficile, Clostridium perfringens, Enterococcus faecium, Enterococcus faecalis, Staphylococcus aureus, and/or Streptococcus pneumoniae, the phylum may include Firmicutes.

    [0089] Once identified, such additional sequence may be used in addition to the seed sequence to generate a second multiple sequence alignment using a structurally-guided multiple sequence aligner. In some embodiments, the sequences may be aligned using a structurally-guided multiple sequence aligner including, for example, PROMALS3D, T-COFFEE, MAFFT, etc.

    [0090] In some embodiments, the non-gapped position of the seed sequence within the second multiple sequence alignment may be identified. In some embodiments, the frequencies of amino acid occurrences at these positions can be bias-corrected. Such bias-correction can account for systemic sampling biases (e.g., particular types of bacteria which happen to be genome-sequenced more often due) or phylogenetic biases.

    [0091] In some embodiments, non-gapped positions identified by using a structurally-guided multiple sequence aligner to align the seed sequence and other lysin catalytic domain family members may be used as the basis for statistical model fitting. Statistical model fitting may include, for example, determining sitewise, pairwise, and/or higher order interaction character occurrence frequencies (e.g., amino acids, gaps, etc.) and/or energy contributions. In some embodiments, statistical model fitting may include application of a Potts model (Wu, Rev. Mod. Phys. 1982; 54:235). In some embodiments, statistical model fitting preferably includes regularization (e.g., employing penalties during optimization to avoid problems of overfitting) and statistical approximations (e.g., application of a pseudo-likelihood approximation). In some embodiments, residue interaction selection may be made based on proximity in a homology model of the guide sequence. In some embodiments, residue interaction selection may be used to reduce the fitted parameter set (including, for example, the identification of experimentally verified catalytic residues).

    [0092] In some embodiments, a statistical model incorporating parameters describing sitewise, pairwise, and/or higher order interactions may be fit to the bias-corrected character occurrence frequencies. In some embodiments, the statistical model preferably returns a statistical fitness score. In some embodiments, the inference parameters of a statistical model may be applied to describe bias-corrected, positional, amino acid frequency data within the multiple sequence alignment.

    [0093] In some embodiments, generation of a model-generated lysin catalytic domain includes generation of a set of model-generated lysin catalytic domain sequences.

    [0094] For example, an integer programming optimization scheme (e.g., a MATLAB script) may be used to generate sequences with statistical fitness scores greater than the seed sequence by allowing in silico mutations at positions of the seed sequence designated mutable positions. Additional physical properties can be applied as constraints to the optimization process to steer towards sequences with desired traits, such as net charge and/or another physical property.

    [0095] In some embodiments, a model-generated lysin catalytic domain or a set of model-generated lysin catalytic domain sequences may be selected for experimental verification. Experimental verification may be done in any appropriate context. For example, verification may include determining the effect of a model-generated lysin catalytic domain only and/or using a full-length lysin that incorporates the model-generated lysin catalytic domain. For example, a full-length lysin may include the sequence of a cell wall binding domain (either from a naturally occurring or a synthetic lysin) and a model-generated lysin catalytic domain.

    [0096] An example of a lysin catalytic domain generative model implementation, used to generate the lysin catalytic domains Lys2ConCat and Lys2Con20Cat, is described in Example 4.

    Protein Expression System (Vector)

    [0097] In another aspect, this disclosure describes a vector. In some embodiments, the vector is included in the genetically modified bacterium.

    [0098] In some embodiments, the vector can include a shuttle vector. In some embodiments, the vector can include pNZC (FIG. 2), pBF25 (Forkus et al., Sci Rep. 2017 Jan. 17; 7:40695), pMPES (Geldart et al. Pharmaceuticals (Basel) 2016; 9(4):60), or pLIKE:pveg:GFP (original vector backbone from: Toymentseva et al., Microbial Cell Factories, 2012, 11:143; with the pveg promoter and GFP cassette from Guiziou et al., Nucleic Acids Research, 2016, 44(15):7495-508).

    [0099] In some embodiments, the vector includes at least one of a heterologous promoter; an inducible promoter; a constitutive promoter (including, for example, a constitutive promoter controlling the activation of the inducible protomer); an antibiotic resistance gene, or other gene to stabilize plasmid expression in a given environment or host bacteria; and a replication gene controlling replication in a host organism. In some embodiments, the vector may further include a genetic element that destabilizes a vector outside of a particular environment.

    [0100] In some embodiments, the vector provides AMP expression. For example, in some embodiments, the vector includes a coding region encoding one or more AMPs.

    [0101] In some embodiments, as further discussed herein, a coding region of the vector may encode at least one of a signal peptide, a modulator protein, and a protein (e.g., an antibiotic) to stabilize plasmid expression in a given environment or host bacteria.

    Secretion and Signal Peptide

    [0102] In some embodiments, the coding region encoding an AMP can be operably linked to a coding region encoding a signal peptide. In some embodiments, the coding regions are operably linked such that the signal peptide and the AMP are expressed as a single protein. For example, the N-terminus of an AMP can be fused to a signal peptide. In one embodiment, the signal peptide directs the AMP to the secretory pathway.

    [0103] Examples of secretion signaling peptides useful in lactic acid bacteria, including L. lactis, Lb. acidophilus, Lb. acidophilus, Lb. bulgaricus, Lb. reuteri, and Lb. plantarum are known. For example, in some embodiments, the signal peptide can include the high-efficiency L. lactis signal peptide SLPmod as described by Fernandez et al., Appl Environ Microbiol. 2009, 75(3):869-71.

    [0104] Another example of a useful secretion signal peptide is from the protein Usp45 (Van Asseldonk et al., Gene 1990, 95, 155-160). Several variations on Usp45 have been explored and may also be employed (Ng and Sarkar, Appl. Environ. Microbiol. 2012, 79:347-356).

    [0105] Additionally, lactobacillus signal peptides including but not limited to Lp_3050 and Lp_2145 may be used in L. lactis and Lactobacilli spp.

    [0106] Other signal peptides can be selected by a person having skill in the art including, for example, from annotated databases of proteins from L. lactis or an annotated database of another target host species.

    Heterologous Promoter

    [0107] In some embodiments, expression of a coding region of the vector (including, for example, expression of a coding region encoding AMP) may be controlled by a heterologous promoter. Such heterologous promoters may confer important advantages including, for example, that cell mass can increase substantially before protein production is turned on, and that the antimicrobial protein itself does not inhibit cell growth.

    [0108] Libraries of regulatable promoters in bacteria have been previously constructed and characterized (see, e.g., Schmitz et al., Appl. Microbiol. Biotechnol. 2011; 89:1783-95; Forkus et al., Sci Rep. 2017 2017; 7:40695; Geldart et al. Pharmaceuticals (Basel) 2016; 9(4):60; Geldart et al., Antimicrob. Agents Chemother. 2017; 61(4):e02033-16; Geldart et al., Appl. Environ. Microbiol. 2015; 81(11):3889-97; Borrero et al. ACS Synth Biol. 2015; 4(3):299-306). For example, at least three expression systems have been used in probiotics: I) a chloride-inducible promoter P.sub.gad (Geldart et al. Antimicrob Agents Chemother. 2017; 61(4):e02033-16), II) a ProTeOn+system (Forkus et al., Sci Rep. 2017 2017; 7:40695; Volzing et al., ACS Synth Biol. 2013; 2(11):643-50), and III) constitutive promoters. (See, e.g., U.S. Patent Publication Nos. 2015/0265660, 2016/0279175).

    [0109] In some embodiments, the heterologous promoter is a chloride-inducible promoter. A chloride-inducible promoter can include, for example, P.sub.gad. P.sub.gad has been found to turn on protein expression when chloride concentration reaches 0.1Ma similar chloride concentration as that found in the stomach of animals (Geldart et al. Antimicrob Agents Chemother. 2017; 61(4):e02033-16).

    [0110] In some embodiments, the heterologous promoter includes a ProTeOn+system. Prokaryotic-TetOn (ProTeOn) and prokaryotic-TetOn (ProTeOff) are described in Volzing et al., ACS Chem. Biol., 2011; 6:1107-1116. These proteins are designed to work with a heterologous promoter that optimizes interactions between domains in ProTeOn and ProTeOff to result in high levels of expression of operably linked transcription units. The ProTeOn protein contains an inducible binding domain (the reverse tetracycline repressor rTetR), which binds to a tetracycline operator sequence in the presence of an inducer such as tetracycline, doxycycline, or anhydrous tetracycline (aTc). ProTeOff includes the tetracycline repressor, TetR, instead of rTetR. rTetR and TetR undergo conformational changes upon binding to an inducer, which cause them to sensitively dissociate and associate from the tetracycline operator site, respectively. Thus, the TetR of ProTeOff is designed to strongly bind to DNA in the absence of aTc and drive expression, and the aTetR of ProTeOn is designed to strongly bind to DNA in the presence of aTc and drive expression.

    [0111] An additional positive feedback effect is observed with the use of ProTeOn+with the activator protein (ProTeOn) activating its own expression by binding to the engineered DNA promoter site (Pon) that includes tetracycline and LuxR operator binding regions and is operably linked to a coding region encoding ProTeOnstrongly increasing the expression of AMPs (Forkus et al., Sci Rep. 2017 2017; 7:40695; Volzing et al., ACS Synth Biol. 2013; 2(11):643-50). Compared to commercially available strong DNA promoters, a ProTeOn+system demonstrates extraordinarily strong promoter activity in E. coli without the use of an inducer. For example, ProTeOn+ was found to be double the strength of oxb20, one of the strongest commercially available promoters for E. coli.

    Additional Coding Regions

    [0112] The vector may optionally include an additional coding region (that is, a coding region in addition to the coding region encoding an AMP) that is operably linked to a second promoter, where the additional coding region encodes a modulator protein that regulates the expression of the heterologous promoter controlling AMP expression. A modulator protein is a protein that modulates expression of a transcription unit operably linked to a heterologous promoter. In one embodiment, a modulator protein binds to a promoter or to other nucleotides around the promoter and modulates expression of a coding region operably linked to that promoter. In one embodiment, the modulator protein may either induce or prevent expression of the operably linked coding region in the presence of a modulating agent. An example of a modulator protein that controls expression of a chloride-inducible promoter is the activator protein GadR. An example of a sequence of a GadR protein is provided by Genbank Accession No. ADJ60177.

    [0113] Examples of modulator proteins that bind to a tetracycline-inducible promoter are known in the art and include tetracycline repressor proteins, and reverse tetracycline repressor proteins. In one embodiment, a modulator protein can include ProTeOn or ProTeOff.

    [0114] The proteins described herein, including the proteins expressed by coding regions of the vector (for example, an antimicrobial protein and/or a modulator protein) may include conservative amino acid substitutions. In one embodiment, a protein described herein can include at least one, at least two, at least three, at least four, or at least five conservative substitutions. In some embodiments, a protein described herein is structurally similar to a reference protein, such as a modulatory protein or an antimicrobial peptide.

    [0115] Without wishing to be bound by theory, it is believed that the combination of using two lysins; operably linking a coding region encoding an AMP to a coding region encoding a signal peptide; and using a heterologous promoter provides a vector with improved properties. For example, previous attempts to engineer Lactobacillus johnsonii to secrete an anti-Clostridium perfringens lysin (Gervasi et al. Letters in Applied Microbiology 2014; 59(4):355-361) had inconsistent results but used a single enzymatic class of lysin, used a nisin-inducible promoter for expression, and included no engineering of secretion.

    Construction and Introduction of the Vector

    [0116] Construction of vectors described herein may employ standard ligation techniques known in the art. See, for example, Sambrook et al., 1989. Molecular cloning: a laboratory manual, 2nd ed. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. Selection of a vector depends upon a variety of desired characteristics in the resulting construct, such as a selection marker, vector replication rate, and the like. Vectors can be introduced into a host cell using methods that are known and used routinely by the skilled person. The vector may replicate separately from the chromosome present in the microbe, or the polynucleotide may be integrated into a chromosome of the microbe. A vector introduced into a host cell optionally includes one or more marker sequences, which typically encode a molecule that inactivates or otherwise detects or is detected by a compound in the growth medium. For example, the inclusion of a marker sequence may render the transformed cell resistant to an antibiotic, or it may confer compound-specific metabolism on the transformed cell. Examples of a marker sequence include, but are not limited to, sequences that confer resistance to kanamycin, ampicillin, chloramphenicol, tetracycline, streptomycin, neomycin, and erythromycin. Generally, introduction of a vector into a host cell, origin of replication, ribosomal sites, marker sequences, and other aspects of vectors may vary depending on whether the host cell is a Gram-positive or a Gram-negative microbe; however, these aspects of vector biology and heterologous gene expression are known to the skilled person and are routine.

    Methods of Using the Vectors and Bacteria

    [0117] Also provided are methods of using the vectors and genetically modified bacterium disclosed herein. The genetically modified bacterium may be present in a composition, such as a pharmaceutically acceptable formulation. In one embodiment, a formulation may be a fluid composition. Fluid compositions include, but are not limited to, solutions, suspensions, dispersions, and the like. Fluid compositions may be incorporated in the water supply of a host. In one embodiment, a formulation may be a solid composition. Solid compositions include, but are not limited to, powder, granule, compressed tablet, pill, capsule, chewing gum, wafer, and the like. Solid compositions may be incorporated in the food supply of hosts. Those formulations may include a pharmaceutically acceptable carrier to render the composition appropriate for administration to a subject. As used herein pharmaceutically acceptable carrier includes pharmacologically inactive compounds compatible with pharmaceutical administration. The compositions may be formulated to be compatible with its intended route of administration. A composition may be administered by any method suitable for depositing in the GI tract of a subject. Examples of routes of administration include rectal administration (for example, by suppository, enema, upper endoscopy, upper push enteroscopy, or colonoscopy), intubation through the nose or the mouth (for example, by nasogastric tube, nasoenteric tube, or nasal jejunal tube), or oral administration (for example, by a solid such as a pill, tablet, or capsule, or by liquid).

    [0118] For therapeutic use, a composition may be conveniently administered in a form containing one or more pharmaceutically acceptable carriers. Suitable carriers are well known in the art and vary with the desired form and mode of administration of the composition. For example, they may include diluents or excipients such as fillers, binders, wetting agents, disintegrators, surface-active agents, glidants, lubricants, and the like. Typically, the carrier may be a solid (including powder), liquid, or combinations thereof. Each carrier is preferably acceptable in the sense of being compatible with the other ingredients in the composition and not injurious to the subject. The carrier is preferably biologically acceptable and inert, i.e., it permits the composition to maintain viability of the biological material until delivered to the appropriate site.

    [0119] Oral compositions may include an inert diluent or an edible carrier. For the purpose of oral therapeutic administration, the active compound (e.g., the genetically modified bacterium) can be incorporated with excipients and used in the form of tablets, troches, or capsules, for example, gelatin capsules. Oral compositions can also be prepared by combining a composition of the present disclosure with a food. In one embodiment, a food used for administration is chilled. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.

    [0120] The active compounds can also be prepared in the form of suppositories (for example, with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.

    [0121] The active compounds may be prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Such formulations can be prepared using standard techniques. Liposomal suspensions can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art.

    [0122] In one embodiment, a composition may be encapsulated. For instance, when the composition is to be administered orally, the dosage form is formulated so the composition is not exposed to conditions prevalent in the GI tract before the desired site, for example, high acidity and digestive enzymes present in the stomach and/or upper intestine. The encapsulation of compositions for therapeutic use is routine in the art. Encapsulation may include hard-shelled capsules, which may be used for dry, powdered ingredients, or soft-shelled capsules. Capsules may be made from aqueous solutions of gelling agents such as animal protein (for example, gelatin), plant polysaccharides or derivatives like carrageenans and modified forms of starch and cellulose. Other ingredients may be added to a gelling agent solution such as plasticizers (for example, glycerin and or sorbitol), coloring agents, preservatives, disintegrants, lubricants and surface treatment.

    [0123] In one embodiment, the method includes administering an effective amount of a bacterium to a subject in need of such a genetically modified bacterium. The subject may be, for instance, human, avian (including, for instance, chickens or turkeys), bovine (including, for instance, cattle), caprine (including, for instance, goats), ovine (including, for instance, sheep), porcine (including, for instance, swine), equine (including, for instance, horses), canine (including, for instance, dogs), or feline (including, for instance, cats). The subject may be of any age. In some embodiments, the animal is preferably a domesticated bird such as a chicken or a turkey. A subject can have a gastrointestinal microflora that requires modification, such as elimination or reduction of one or more microbes. For instance, a subject may have a microbial pathogen, such as a nosocomial pathogen, present in its GI tract.

    [0124] In one embodiment, the method may further include administering to the subject a modulating agent. In one embodiment, such a modulating agent will interact with the modulator protein, for example, a tet-repressor, and result in expression of the coding region encoding the antimicrobial peptide. The modulating agent may be administered to the subject before, with, or after the administration of the genetically modified bacterium, or a combination thereof.

    [0125] In one embodiment, it is not necessary to administer a modulating agent to the subject. When the genetically modified bacterium includes a vector that includes a promoter such as a chloride-inducible promoter, the microbe will begin to express the AMP when it is in a suitable environment, such as the GI tract.

    [0126] In one embodiment, a method includes reducing the number of pathogenic microbes. The method can include exposing a pathogenic microbe to a genetically modified bacterium described herein that expresses at least one, at least two, or at least three antimicrobial peptides. The exposure of the pathogenic microbe to multiple antimicrobial peptides increases activity and efficacy and results in a greater reduction of the pathogenic microbe than exposure to just one antimicrobial peptide. The reduction can be at least 10-fold, at least 100-fold, or at least 1000-fold. The pathogenic microbe can be in vivo (for example, inside or on the body of a subject) or in vitro (for example, not in or on the body of a subject).

    [0127] In one embodiment, a method includes reducing development of resistance to antimicrobial peptides. Microbes can develop resistance to an antibiotic such as an antimicrobial peptide. For example, a population of microbes can include individuals that are resistant to an antibiotic. The use of at least two antimicrobial peptides reduces the development of resistance and the resulting regrowth of the pathogenic microbe after exposure to the antimicrobial peptides. Thus, a method can include exposing a pathogenic microbe to a genetically modified microbe described herein that expresses at least two antimicrobial peptides. Exposure of the pathogenic microbe to at least two three antimicrobial peptides results an increase in the amount of time needed for regrowth of the pathogenic microbe, a measurement of development of resistance compared to the pathogenic microbe that is exposed to only one of the antimicrobial peptides. The increase in the amount of time needed for regrowth of the pathogenic microbe can be at least 12 hours, at least 24 hours, or at least 48 hours. The pathogenic microbe can be in vivo (for example, inside or on the body of a subject) or in vitro (for example, not in or on the body of a subject).

    [0128] In some embodiments, a method includes administering a genetically modified bacterium to a subject having a pathogenic microbe present in its GI tract. In one embodiment, a method includes treating a subject having a pathogenic microbe present in its GI tract. In another embodiment, the present disclosure is directed to methods for treating certain conditions in a subject that may be caused by, or associated with, a microbe. Such conditions include, for instance, Gram-negative microbial infections and Gram-positive microbial infections of the GI tract. Examples of conditions that may be caused by the presence of certain microbes in a subject's GI tract include, but are not limited to, necrotic enteritis, diarrhea, gastroenteritis, hemolytic-uremic syndrome, inflammatory bowel disease, irritable bowel disease, and Crohn's Disease.

    [0129] Treating a subject, such as a subject having a pathogenic microbe or a subject having a condition, can be prophylactic or, alternatively, can be initiated after the need for treatment arises. Treatment that is prophylactic, for instance, initiated before a subject manifests symptoms of a condition caused by a pathogenic microbe, such as a member of the genus Salmonella, Staphylococcus, Streptococcus, Clostridia, Klebsiella, or Enterococcus, is referred to herein as treatment of a subject that is at risk of developing the condition. Typically, a subject at risk of developing a condition is a subject likely to be exposed to a pathogenic microbe, such as a member of the genus Salmonella, Staphylococcus, Streptococcus Clostridia, Klebsiella, or Enterococcus, causing the condition. For instance, the subject is present in an area where the condition has been diagnosed in at least one other subject (for example, a hospital in the case of a nosocomial infection or a farm where an infection has been detected in another animal). Accordingly, administration of a composition can be performed before, during, or after the occurrence of a condition caused by a pathogenic microbe. Treatment initiated after the development of a condition may result in decreasing the severity of the symptoms of one of the conditions, or completely removing the symptoms. In this aspect of the invention, an effective amount is an amount effective to prevent the manifestation of symptoms of a condition, decrease the severity of the symptoms of a condition, and/or completely remove the symptoms. The potency of a composition described herein can be tested according to routine methods (see, for instance, Stanfield et al., Microb Pathog. 1987, 3:155-165, Fox et al., Am. J. Vet. Res. 1987, 48:85-90, Ruiz-Palacios, Infect. Immun. 1981, 34:250-255, and Humphrey et al., J. Infect. Dis. 1985, 151:485-493). Methods for determining whether a subject has a condition caused by a pathogenic microbe and symptoms associated with the conditions are routine and known to the art.

    [0130] The method may further include determining whether at least one symptom associated with a condition cause by a target microbe is reduced, and/or determining whether the shedding of the target microbe by the subject is reduced. Methods for determining whether a subject has a reduction in a symptom associated with a condition are routine and known in the art. Methods for measuring shedding of a microbe are likewise routine and known in the art.

    Kits

    [0131] In another aspect, this disclosure describes a kit. In some embodiments, the kit may include a genetically modified bacterium as described herein. In some embodiments, the kit may include a vector as described herein. In some embodiments, each of the essential materials and reagents required for treating a subject having a pathogenic microbe present in its GI tract may be assembled together in a kit. The components of the kit may be provided in an aqueous form or a dried or lyophilized form. The kit may include an instruction sheet defining administration of the genetically modified bacterium and/or the vector.

    [0132] The present invention is illustrated by the following examples. It is to be understood that the particular examples, materials, amounts, and procedures are to be interpreted broadly in accordance with the scope and spirit of the invention as set forth herein.

    EXAMPLES

    Example 1

    Materials and Methods

    Bacterial Transformation and Molecular Cloning

    [0133] Backbone vector pNZC (Geldart et al. Appl Environ Microbiol. 2015; 81(11):3889-97) was used for all expression and subcloning. Genes encoding for mature Lys2 and Lys3 were optimized for expression with Codon Optimization Tool (Integrated DNA Technologies, Coralville, Iowa) with target organism Lactococcus lactis. To the N-terminus DNA encoding for the SLPmod secretion tag was appended (Fernandez et al., Appl Environ Microbiol. 2009, 75(3):869-71), to the C-terminus DNA encoding for a 6HIS tag (GSHHHHHH) was appended for downstream purification. These two constructs were synthesized by Integrated DNA Technologies (Coralville, Iowa) using their gBlocks platform and Gibson-assembled into the NcoI-SpeI target site of the backbone vector.

    [0134] The resultant plasmids were first transformed via electroporation into MC1061 F-Escherichia coli (Lucigen Corporation, Middleton, Wis.), following the manufacturer's protocol and then transformed via electroporation into L. lactis following published protocols (Geldart et al., Appl. Environ. Microbiol. 2015; 81(11):3889-97; Borrero et al. ACS Synth Biol. 2015; 4(3):299-306).

    Supernatant Production and Sterilization from Lactococcus lactis

    [0135] L. lactis, engineered or control, was grown overnight without agitation at 32 C. from a fresh colony grown on BHI (Brain-heart-infusion) agar with 5 g/mL chloramphenicol (cm). The following day, cells were washed and resuspended at an optical density (OD) of 1.0 at wavelength 600 nm in 4 mL BHI and incubated at 32 C. for 4 hours. Cells were then pelleted by centrifugation and supernatant was filter-sterilized and aliquoted for immediate use.

    Lytic Activity Assays

    [0136] Clostridium perfringens (CP) strains were grown in fresh BYC (BHI+5 g/L yeast extract+0.5 g/L L-cysteine free base) that was sealed immediately following autoclaving to reduce dissolved oxygen content. Cells were grown at 37 C., sealed and without shaking. After 6 hours, this liquid suspension was used as follows. The suspension was added to a 96-well polystyrene plate such that the final concentration of added supernatant tested was equal to the amounts indicated at a total volume of 200 L per well in a sterilized 96 well plate.

    Results

    [0137] Using sterilized supernatant, systems producing Lys2 and Lys3 (FIG. 2) were found to have lytic activity against several CP strains (including CP12, CP13, CP26, and CP39). This activity was demonstrated through the reduction of optical density of culture, which correlates to the number of intact bacterial cells which scatter light at wavelength 600 nm (FIG. 3).

    [0138] The extent of the lysin specificity was demonstrated by the activity response of Lys2 against the panel of CP strains (FIG. 3C). Supernatant from Lys2-secreting (FIG. 3C) or Lys3-secreting (FIG. 3B) L. lactis was tested. Filter-sterilized supernatant from Lys2-secreting L. lactis was not observed to elicit a response from CP strain CP26, demonstrating strain-level specificity towards targets of interest.

    Example 2

    [0139] A method of using microfluidic co-encapsulation of antimicrobial protein producer and target pathogen (Scanlon et al. Biotechnol. Bioeng. 2014, 111:232-243) adapted for use with L. lactis and CP will be used. A mutagenic library is first constructed in LL, 1, mixed with CP in low-gel agarose 2, and encapsulated via a microfluidic device, 3. Droplets are solidified and incubated in-emulsion to allow AMP production, and washed with appropriate fluorescent dyes to indicate activity, 4. Droplets are sorted via fluorescent-activated cell sorting, 5, enriching for droplets with higher total activity. Secretion rate can then be decoupled from per-molecule activity via HPLC for top clones, 6.

    [0140] A schematic representation of this method is shown in FIG. 4.

    Example 3

    [0141] This Example describes a process for generating lysin catalytic domains. [0142] 1. Generation of guide sequence and mutable sequence positions. [0143] a. Lysin catalytic domain sequences are gathered from a protein sequence database having taxonomic label of an organism against which the lysin is to be generated. [0144] b. Lysin catalytic domain sequences from (1a) are aligned to generate a multiple sequence alignment using a structurally-guided multiple sequence aligner. [0145] c. The consensus sequence derived from the multiple sequence alignment of (1b) is acquired and utilized in the following as a seed sequence. [0146] d. The non-gapped sequence positions of the seed sequence of (1c) with site diversity above some tunable threshold form the set of mutable positions for the following. [0147] 2. Generation of a structurally-guided multiple sequence alignment of lysin catalytic domain class [0148] a. Lysin catalytic domain sequences with either homology to the seed sequence of (1c), or homology with a curated database of lysin catalytic domain family members, are acquired from a protein sequence database having taxonomic label within a phylum of the organism against which the lysin is to be generated. [0149] b. Lysin catalytic domain sequences from (2a), in addition to the seed sequence of (1c) are aligned to generate a multiple sequence alignment using a structurally-guided multiple sequence aligner. [0150] c. Non-gapped positions of the seed sequence of (1c) within the multiple sequence alignment of (2b) are used as the basis for statistical model fitting. [0151] 3. Generation of a generative model describing reduced multiple sequence alignment of (2c) [0152] a. Sitewise and pairwise character occurrence frequencies (amino acids, gaps, etc.) corresponding to the reduced multiple sequence alignment of (2c) are computed with phylogenetic bias corrected by one or more of a number of methods. [0153] b. A statistical model incorporating parameters describing sitewise and pairwise interactions is fit to the bias-corrected character occurrence frequencies of (3a). This statistical model returns a statistical fitness score given a test sequence. [0154] 4. Generation of a set of lysin catalytic domain sequences with improved physical properties [0155] a. An integer programming optimization scheme is utilized to generate sequences with statistical fitness scores greater than the seed sequence of (1c) by allowing in silico mutations at positions of the seed sequence of (1c) as selected in (1d). Additional physical properties can be applied as constraints to the optimization process to steer towards sequences with desired traits, such as net charge. [0156] b. From the set of sequences generated in (4a) some subsets are selected for experimental verification. Experimental verification may be done in any appropriate context, including catalytic-domain only, and/or using a full-length lysin through the genetic fusion of the generated lysin catalytic domain sequence to the sequence of a cell wall binding domain either from a naturally occurring or a synthetic lysin.

    Example 4

    [0157] This Example describes an exemplary implementation of Example 3, used to generate the lysin catalytic domains Lys2ConCat and Lys2Con20Cat (the sequences of which are provided in Table 2). This Example further describes cloning and expression of these lysin catalytic domains; characterization of thermal stability of Lys2, Lys2Con (a lysin including the Lys2ConCat catalytic domain as well as the cell wall binding domain of Lys2), and Lys2Con20 (a lysin including the Lys2Con20Cat catalytic domain as the cell wall binding domain of Lys2) against CP12; and comparison of Lys2ConCat and Lys2Con20Cat to naturally occurring sequences. [0158] 1. Generation of Lys2ConCat and identification of mutable positions [0159] a. The catalytic domain of Lys2 was utilized as the seed sequence to search for homologous sequences using the Jackhmmer webserver (Finn et al. HMNIER web server: 2015 Update. Nucleic Acids Res. 43, W30-W38 (2015)). [0160] b. The following settings yielded 13 sequences: [0161] i. Iterations: 5 [0162] ii. Sequence Database: UniprotKB [0163] iii. Taxonomy restriction: Clostridium perfringens (taxid: 1502) [0164] iv. Cut-offs significance E-values [0165] 1. Sequence: 1e-20 [0166] 2. Hit: 1e-20 [0167] c. Protein sequences from (1a) were aligned using the PROMALS3D server (Pei et al. Nucleic Acids Res. 2008; 36:2295-2300) with standard settings. [0168] d. The consensus sequence of the cluster with sequences closest to Lys2 was computed, yielding Lys2ConCat. [0169] e. Positions of Lys2ConCat with Shannon entropy >0 were designated as mutable positions for later optimization. [0170] 2. Acquisition and multiple sequence alignment of Firmicute phylum with sequences homologous to Lys2ConCat. [0171] a. The sequence of Lys2ConCat was utilized as the seed sequence to search for homologous sequences using the Jackhmmer webserver (Finn et al. Nucleic Acids Res. 2015; 43:W30-W38). The following settings yielded 4919 sequences: [0172] i. Iterations: 5 [0173] ii. Sequence Database: UniprotKB [0174] iii. Taxonomy restriction: Firmicutes (TAXID: 1239) [0175] iv. Cut-offs significance E-values [0176] 1. Sequence: 1e-20 [0177] 2. Hit: 1e-20 [0178] b. Protein sequences from (2a), in addition to Lys2ConCat, were aligned using the PROMALS3D server with standard settings. [0179] c. Non-gapped positions, with respect to Lys2ConCat, of the multiple sequence alignment from (2b) were used for statistical modeling. [0180] 3. Parameter determination of a Boltzmann distribution with sequence energy defined by the Potts model [0181] a. A Potts model (Wu, Rev. Mod. Phys. 1982; 54:235) is the simplest model incorporating sitewise and pairwise energy contributions from a character sequence. It is defined as:

    [00001] E ( ) = .Math. i .Math. h i ( i ) + .Math. i < j .Math. J i , j ( i , j ) [0182] Where is the character sequence, h is the set of sitewise energy character contributions, and J is the set of pairwise energy character contributions. The parameter set of this function were fitted to the data assuming that character sequence observations follow a Boltzmann distribution:

    [00002] P ( ) = 1 Z .Math. exp ( E ( ) ) [0183] Where P() is the probability of randomly observing character sequence , and Z is the partition function (the sum of the exponentials of the energies of all possible character sequences). The software package PLMC (Hopf et al. Nat. Biotechnol. 2017, 35(2):128-135) was used to determine the parameters of this model. The following settings were utilized, the algorithm was run to convergence: [0184] i. l.sub.2 regularization parameters [0185] 1. .sub.n: 0.01 [0186] 2. .sub.e: 40.4 [0187] ii. g (fit only non-gapped positions of Lys2ConCat, which is set at position 1 of the multiple sequence alignment) [0188] 4. Generation of sequences starting from Lys2ConCat with increased statistical energy [0189] a. A MATLAB script was written to compute the statistical energy of all single mutations of Lys2ConCat at all positions determined in (1d). The mutation which yielded the highest statistical energy was recorded as a new starting sequence. This process was repeated a total of 20 times to yield sequences Lys2Con1Cat through Lys2Con20Cat.

    [0190] The sequence with the greatest statistical energy, Lys2Con20Cat was selected for characterization. The sequences of Lys2ConCat and Lys2Con20Cat were genetically fused to the cell wall binding domain of Lys2 to yield the lysins Lys2Con and Lys2Con20, respectively.

    Cloning, Expression, and Characterization of Thermal Stability of Lys2, Lys2Con, and Lys2Con20 Against CP12

    [0191] The full-length amino acid sequences for Lys2 (SEQ ID NO:1), Lys2Con (SEQ ID NO:5), and Lys2Con20 (SEQ ID NO:6) were codon optimized using the Integrated DNA Technologies, Inc. (IDT) Codon Optimization Tool for Escherichia coli (available on the world wide web at idtdna.com/CodonOpt) and ordered as a gBlock (Integrated DNA Technologies, Inc., Coralville, Iowa). These genes were Gibson assembled (NEBUILDER Hifi DNA Assembly Kit, New England Biolabs, Inc., Ipswich, Mass.) into a linearized pET expression vector between restriction enzyme sites NdeI and BamHI. This location incorporates a C-terminal GSHHHHHH purification tag in the coding sequence of each lysin.

    [0192] Assembled plasmids were transformed into NEB T7 Express LysY/Iq cells (New England Biolabs, Inc., Ipswich, Mass.) following the published protocols and plated on lysogeny broth (LB) plates supplemented with 50 g/mL kanamycin (+kan) and grown at 37 C. overnight.

    [0193] Fresh colonies were inoculated into 100 mL of LB+kan liquid media and grown, shaking at 250 rpm at 37 C., to an optical density at 600 nm (OD600) of 0.5. Isopropyl -D-1-thiogalactopyranoside (IPTG) was added to a final concentration of 0.5 mM to induce lysin expression. Induction was carried out shaking at 250 rpm at 37 C. for 2 hours.

    [0194] Following induction, cultures were placed on ice for 10 minutes. Cells were then pelleted at 3000 g for 10 minutes at 4 C. Culture media was removed and pellets washed 3 with 1 mL ice-cold PBS (137 mM NaCl, 2.7 mM KCl, 10 mM Na.sub.2HPO.sub.4, 1.8 mM KH.sub.2PO.sub.4, pH 7.4), centrifuged each time at 3000 g for 3 minutes. Cell pellets were then resuspended in lysis buffer (PBS, +3.1 g/L CHAPS, +10 mM imidazole, +1 EDTA-free protease inhibitor cocktail pellet/50 mL) and freeze-thawed for 4 cycles (thaw: 30 C., freeze: 20 C.). Suspensions were then centrifuged at 12000 g for 10 minutes and supernatant removed. Supernatant was filter-sterilized for protein purification.

    [0195] Protein purification was done using a gravity-driven column loaded with 2 mL of HisPur Cobalt Resin (Thermo Fisher Scientific, Waltham, Mass.). Briefly, resin was washed with 41 mL of wash buffer (PBS+10 mM imidazole), filter-sterilized lysate was applied, the column was washed with 61 mL of wash buffer, and finally the lysins were eluted by 41 mL of elution buffer (PBS+150 mM imidazole). Single milliliter fractions were collected at all stages of purification. Lysin elution fraction was determined via lytic activity testing at 37 C.

    [0196] Fractions containing highest lytic activity for each lysin were applied to Zeba spin desalting column (Thermo Fisher Scientific, Waltham, Mass.) following the manufacturer's protocol with PBS as the equilibration buffer. These solutions were then used for characterization.

    [0197] For thermal stability testing, 50 L aliquots of each lysin were distributed into PCR Strip Tubes (Thermo Fisher Scientific, Waltham, Mass.). A C1000 TOUCH Thermocyler (Bio-Rad, Hercules, Calif.) was used to heat shock each sample. Samples were heated to designated temperature for 30 minutes and then 4 C. for 10 minutes. These heat-shocked samples were then used in lytic activity tests.

    [0198] For lytic activity testing, Clostrium perfringens strain ATCC 12916 was grown to an OD600 of 0.5 in fresh BYC (BHI+5 g/L yeast extract+0.5 g/L L-cysteine free base) anaerobically. 180 L of this culture was applied to 20 L of heat-shocked protein sample in a sterile, transparent, 96-well polystyrene plate. Plates were then incubated with continuous orbital shaking at 37 C. in a SYNERGY H1 Microplate Reader (BioTek, Winooski, Vt.). OD600 readings were recorded every 2 minutes for 1 hour.

    [0199] Data for each sampled were fitted to the function:

    [00003] OD .Math. .Math. 600 = { OD .Math. .Math. 600 0 , i t < t 0 , i OD .Math. .Math. 600 0 , i * exp ( - k i ( t - t 0 , i ) ) t 0 , i t }

    This function captures the lytic activity of each lysin and enables comparison of the specific activities, k.sub.i. Results are shown in FIG. 5 and Table 1 Table 1 demonstrates the improved stabilities of Lys2Con, and Lys2Con20 relative to Lys2.

    TABLE-US-00001 TABLE 1 Thermal stabilities of lysins Lys2, Lys2Con, and Lys2Con20. Curves of k.sub.i were fitted to determine the temperature at which lysins lost 50% of their maximum activity (T.sub.50). Construct T.sub.50 (C.) Lys2 44.9 Lys2Con 48.4 Lys2Con20 53.0

    Comparison of Lys2ConCat and Lys2Con20Cat to Naturally Occurring Sequences

    [0200] Naturally occurring sequences with homology to Lys2ConCat and Lys2Con20Cat were gathered using the Jackhmmer webserver (Finn et al. Nucleic Acids Res. 2015; 43:W30-W38). The closest sequence for each was B1R4A5, the catalytic domain for a lysin from Clostridium perfringens B str. ATCC 3626. Lys2ConCat and Lys2Con20Cat had sequence identities of 94.1% and 87.1%, respectively, to the catalytic domain of B1R4A5.

    [0201] With respect to Lys2's catalytic domain, Lys2ConCat and Lys2Con20Cat are 46.2% and 50.8% identical, respectively

    TABLE-US-00002 TABLE2 SEQIDNO:3 MEGRNNNNLKGIDVSNWQGNINFKSVKNDGIEVV (Lys2ConCat) YIKATEGDYFKDSYAKQNYERAKAEGLKVGFYHF FRPNKNAKDQANYFIDYLNEIGATDYDCKLALDI ETTEGRGAYDLTTMCIEFLEEVRRITNREVVVYT YTSFANNNLDNRLGVYPLWIAHYGVKAPKDNNIW SSWIGFQYSDKGNVAGVSGNCDMNEFKEEIFD SEQIDNO:4 MQSRNNNNLKGIDVSNWQGNINFKSVKNDGIEVV (Lys2Con20Cat) YIKATEGDYFKDSYAKQNYEGAKANGLKVGFYHF FRPNKNAKEQANYFISYLNGIGAKDYDCKLALDI ETTEGLGAYELTTMCIEFLEEVKRLTGKEVVVYT YTSFANNNLDSRLGVYPLWIAHYGVKTPKDNNIW SSWIGFQYSDKGSVAGVSGNCDMNEFTEEILI SEQIDNO:5 MEGRNNNNLKGIDVSNWQGNINFKSVKNDGIEVV (Lys2Con) YIKATEGDYFKDSYAKQNYERAKAEGLKVGFYHF FRPNKNAKDQANYFIDYLNEIGATDYDCKLALDI ETTEGRGAYDLTTMCIEFLEEVRRITNREVVVYT YTSFANNNLDNRLGVYPLWIAHYGVKAPKDNNIW SSWIGFQYSDKGNVAGVSGNCDMNEFKEEIFDIN KESSKVTENKLFSTNARALVALDPRDNPSDNYND LGEIYEGERIQVLAEVCDKEDYLPVKYWKDSEGR ESGKVWIRSKQDYMMIDTYHRVFNVITQLDARYE PSSDSATMGYVKNGERLYVHRTEGNYSLCTYFAG NGYKTAWFTAKYLERI SEQIDNO:6 MQSRNNNNLKGIDVSNWQGNINFKSVKNDGIEVV (Lys2Con20) YIKATEGDYFKDSYAKQNYEGAKANGLKVGFYHF FRPNKNAKEQANYFISYLNGIGAKDYDCKLALDI ETTEGLGAYELTTMCIEFLEEVKRLTGKEVVVYT YTSFANNNLDSRLGVYPLWIAHYGVKTPKDNNIW SSWIGFQYSDKGSVAGVSGNCDMNEFTEEILIIN KESSKVTENKLFSTNARALVALDPRDNPSDNYND LGEIYEGERIQVLAEVCDKEDYLPVKYWKDSEGR ESGKVWIRSKQDYMMIDTYHRVFNVITQLDARYE PSSDSATMGYVKNGERLYVHRTEGNYSLCTYFAG NGYKTAWFTAKYLERI

    [0202] The complete disclosure of all patents, patent applications, and publications, and electronically available material (including, for instance, nucleotide sequence submissions in, for example, GenBank and RefSeq, and amino acid sequence submissions in, for example, SwissProt, PIR, PRF, PDB, and translations from annotated coding regions in GenBank and RefSeq) cited herein are incorporated by reference. In the event that any inconsistency exists between the disclosure of the present application and the disclosure(s) of any document incorporated herein by reference, the disclosure of the present application shall govern. The foregoing detailed description and examples have been given for clarity of understanding only. No unnecessary limitations are to be understood therefrom. The invention is not limited to the exact details shown and described, for variations obvious to one skilled in the art will be included within the invention defined by the claims.