MULTIPLE CYCLOADDITION REACTIONS FOR LABELING OF MOLECULES
20200231539 ยท 2020-07-23
Assignee
Inventors
- Edward Lemke (Mannheim, DE)
- Carsten Schultz (Heidelberg, DE)
- Tilman Plass (Heidelberg, DE)
- Ivana Nikic (Heidelberg, DE)
- Jan-Erik Hoffmann (Heidelberg, DE)
- Iker Valle Aramburu (Heidelberg, DE)
Cpc classification
C07C271/22
CHEMISTRY; METALLURGY
International classification
C07C271/22
CHEMISTRY; METALLURGY
C07C271/34
CHEMISTRY; METALLURGY
Abstract
The present invention relates to methods for linking tetrazines with dienophiles to establish at least two linkages by sequentially performing at least two cycloaddition reactions. The methods in particular allow establishing multi-labeling strategies. In particular, the invention relates to methods for forming linkages by cycloaddition reactions, wherein the method comprises reacting a first alkyl-substituted tetrazine with a first dienophile comprising a irans-cyclooctenyl group followed by reacting a second tetrazine with a second dienophile comprising a cyclooctynyl group, wherein the reaction of the first tetrazine with the first dienophile proceeds in the presence of the second dienophile.
Claims
1. A method for forming linkages by cycloaddition reactions, wherein the method comprises reacting a first tetrazine with a first dienophile followed by reacting a second tetrazine with a second dienophile, wherein the reaction of the first tetrazine with the first dienophile proceeds in the presence of the second dienophile, wherein (i) the first tetrazine comprises a group of the formula: ##STR00152## wherein R.sup.3 is C.sub.1-C.sub.3-alkyl; (ii) the first dienophile comprises a trans-cyclooctenyl group of the formula: ##STR00153## wherein R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; (iii) the second tetrazine comprises a group of the formula: ##STR00154## (iv) the second dienophile comprises a cyclooctynyl group of the formula: ##STR00155## wherein R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl.
2. The method of claim 1, wherein the first tetrazine preferentially reacts with the first dienophile in the presence of the second dienophile.
3. The method of claim 1, wherein the rate constant k of the first tetrazine with the first dienophile is usually at least 10.sup.2-times higher than the rate constant k of the reaction of the first tetrazine with the second dienophile.
4. The method of claim 1, wherein the rate constant k of the first tetrazine with the first dienophile is allowed to proceed for 30 minutes or less at a temperature of about 37 C.
5. The method of claim 1, wherein the method comprises contacting a target molecule or a target molecule composition with (i) a first labeling agent comprising a group of the formula: ##STR00156## wherein R.sup.3 is C.sub.1-C.sub.3-alkyl; followed by (ii) a second labeling agent comprising a group of the formula: ##STR00157## wherein the target molecule comprises (i) a trans-cyclooctenyl group of the formula: ##STR00158## wherein R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; and (ii) a cyclooctynyl group of the formula: ##STR00159## wherein R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl, wherein the target molecule composition comprises (i) a first target molecule comprising a trans-cyclooctenyl group of the formula: ##STR00160## wherein R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; and (ii) a second target molecule comprising a cyclooctynyl group of the formula: ##STR00161## wherein R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl.
6. The method of claim 1, wherein the trans-cyclooctenyl group has the formula: ##STR00162## wherein R.sup.1 is hydrogen; the first tetrazine or labeling agent comprises a group of the formula: ##STR00163## wherein R.sup.3 is methyl; the cyclooctynyl group has the formula: ##STR00164## wherein R.sup.2 is hydrogen; and the second tetrazine or labeling agent comprises a group of the formula: ##STR00165##
7. The method of claim 1, wherein the first dienophile or the target molecule or target molecule composition is reacted with the first tetrazine or labeling agent under conditions that allow for substantially all trans-cyclooctenyl groups to react prior to reacting the second dienophile or the target molecule or target molecule composition with the second tetrazine or labeling agent.
8. A cell comprising (i) a trans-cyclooctenyl group of the formula: ##STR00166## wherein R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; and (ii) a cyclooctynyl group of the formula: ##STR00167## wherein R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl.
9. The cell of claim 8, wherein the cyclooctynyl group is attached to a first polypeptide and the trans-cyclooctenyl group is attached to a second polypeptide, the first and the second polypeptide being different polypeptides.
10. A method for preparing the cell of claim 8, which comprises a) providing a cell comprising: (i) a first aminoacyl tRNA synthetase, or a polynucleotide encoding it; and optionally a second aminoacyl tRNA synthetase, or a polynucleotide encoding it; (ii) a first tRNA having an anticodon to a first selector codon, or a polynucleotide encoding said tRNA; and optionally a second tRNA having an anticodon to a second selector codon, or a polynucleotide encoding said tRNA; and (iii) a polynucleotide encoding a target polypeptide and comprising one or more than one first and second selector codon(s); or a first polynucleotide encoding a first target polypeptide and comprising one or more than one first selector codon(s) and a second polynucleotide encoding a second target polypeptide and comprising one or more than one second selector codon(s), wherein said first aminoacyl tRNA synthetase (i) is capable of acylating the first tRNA (ii) with a first unnatural amino acid or an analogue thereof comprising a trans-cyclooctenyl group of the formula: ##STR00168## wherein R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl, and with a second unnatural amino acid or an analogue thereof comprising a cyclooctynyl group of the formula: ##STR00169## wherein R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sup.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; or wherein said first aminoacyl tRNA synthetase (i) is capable of acylating the first tRNA (ii) with a first unnatural amino acid or an analogue thereof comprising a trans-cyclooctenyl group of the formula: ##STR00170## wherein R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl, and said second aminoacyl tRNA synthetase (i) is capable of acylating the second tRNA (ii) with a second unnatural amino acid or an analogue thereof comprising a cyclooctynyl group of the formula: ##STR00171## wherein R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; b) contacting the cell with the first and the second unnatural amino acid or an analogue thereof; and c) allowing translation of the polynucleotide(s) (iii) thereby incorporating the first and the second unnatural amino acids or the analogues thereof into the target polypeptide(s) at the position(s) encoded by the selector codon(s).
11. The method of claim 10, wherein the first unnatural amino acid or the analogue thereof is a compound of the formula: ##STR00172## wherein: X.sup.1 has the formula: ##STR00173## R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; X.sup.2 is CH.sub.2, O, S, NH, C(O), OC(O), C(O)O, NHC(O) or C(O)NH; X.sup.3 is C.sub.1-C.sub.6-alkylene, (CH.sub.2CH.sub.2O).sub.m, (CH.sub.2O).sub.p or a single bond; X.sup.4 is NH, C(O)NH, NHC(O), NHCH(NH.sub.2), CH(NH.sub.2)NH, NHC(NH)NH, C(O)NHCH(NH.sub.2), C(O)NHC(NH)NH, NHCH(NH.sub.2)C(O) or NHC(NH)NHC(O); X.sup.5 is (CH.sub.2).sub.n or phenylene-CH.sub.2; X.sup.6 is hydrogen, C.sub.1-C.sub.6-alkyl, C.sub.1-C.sub.6-alkoxy-C.sub.1-C.sub.2-alkyl, C.sub.2-C.sub.7-alkanoyloxy-C.sub.1-C.sub.2-alkyl or C.sub.2-C.sub.7-alkanoylsulfanyl-C.sub.1-C.sub.2-alkyl; R.sup.4 is OH or NH.sub.2; n is an integer from 1 to 4; m is an integer from 1 to 6; and p is an integer from 1 to 6, or an acid or base addition salt thereof, and wherein the second unnatural amino acid or the analogue thereof is a compound of the formula: ##STR00174## wherein: X.sup.1 has the formula: ##STR00175## R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; X.sup.2 is CH.sub.2, O, S, NH, C(O), OC(O), C(O)O, NHC(O) or C(O)NH; X.sup.3 is C.sub.1-C.sub.6-alkylene, (CH.sub.2CH.sub.2O).sub.m, (CH.sub.2O).sub.p or a single bond; X.sup.4 is NH, C(O)NH, NHC(O), NHCH(NH.sub.2), CH(NH.sub.2)NH, NHC(NH)NH, C(O)NHCH(NH.sub.2), C(O)NHC(NH)NH, NHCH(NH.sub.2)C(O) or NHC(NH)NHC(O); X.sup.5 is (CH.sub.2).sub.n or phenylene-CH.sub.2; X.sup.6 is hydrogen, C.sub.1-C.sub.6-alkyl, C.sub.1-C.sub.6-alkoxy-C.sub.1-C.sub.2-alkyl, C.sub.2-C.sub.7-alkanoyloxy-C.sub.1-C.sub.2-alkyl or C.sub.2-C.sub.7-alkanoylsulfanyl-C.sub.1-C.sub.2-alkyl; R.sup.4 is OH or NH.sub.2; n is an integer from 1 to 4; m is an integer from 1 to 6; and p is an integer from 1 to 6, or an acid or base addition salt thereof.
12. A polypeptide comprising (i) a trans-cyclooctenyl group of the formula: ##STR00176## wherein R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; and (ii) a cyclooctynyl group of the formula: ##STR00177## wherein R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl.
13. The polypeptide of claim 12, comprising a first residue of the formula: ##STR00178## wherein: X.sup.1 has the formula ##STR00179## R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; X.sup.2 is CH.sub.2, O, S, NH, C(O), OC(O), C(O)O, NHC(O) or C(O)NH; X.sup.3 is C.sub.1-C.sub.6-alkylene, (CH.sub.2CH.sub.2O).sub.m, (CH.sub.2O).sub.p or a single bond; X.sup.4 is NH, C(O)NH, NHC(O), NHCH(NH.sub.2), CH(NH.sub.2)NH, NHC(NH)NH, C(O)NHCH(NH.sub.2), C(O)NHC(NH)NH, NHCH(NH.sub.2)C(O) or NHC(NH)NHC(O); X.sup.5 is (CH.sub.2).sub.n or phenylene-CH.sub.2; Z.sup.1 is O or NH; n is an integer from 1 to 4; m is an integer from 1 to 6; and p is an integer from 1 to 6, and a second residue of the formula: ##STR00180## wherein: X.sup.1 has the formula: ##STR00181## R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; X.sup.2 is CH.sub.2, O, S, NH, C(O), OC(O), C(O)O, NHC(O) or C(O)NH; X.sup.3 is C.sub.1-C.sub.6-alkylene, (CH.sub.2CH.sub.2O).sub.m, (CH.sub.2O).sub.p or a single bond; X.sup.4 is NH, C(O)NH, NHC(O), NHCH(NH.sub.2), CH(NH.sub.2)NH, NHC(NH)NH, C(O)NHCH(NH.sub.2), C(O)NHC(NH)NH, NHCH(NH.sub.2)C(O) or NHC(NH)NHC(O); X.sup.5 is (CH.sub.2).sub.n or phenylene-CH.sub.2; Z.sup.1 is O or NH; n is an integer from 1 to 4; m is an integer from 1 to 6; and p is an integer from 1 to 6.
14. An unnatural amino acid comprising a trans-cyclooctenyl group of the formula: ##STR00182## wherein R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl, or an analogue of the unnatural amino acid.
15. The unnatural amino acid of claim 14, having the formula: ##STR00183## wherein X.sup.1 is a trans-cyclooctenyl group of the formula: ##STR00184## R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl. X.sup.2 is CH.sub.2, O, S, NH, C(O), OC(O), C(O)O, NHC(O) or C(O)NH; X.sup.3 is C.sub.1-C.sub.6-alkylene, (CH.sub.2CH.sub.2O).sub.m, (CH.sub.2O).sub.p, or a single bond; X.sup.4 is NH, C(O)NH, NHC(O), NHCH(NH.sub.2), CH(NH.sub.2)NH, NHC(NH)NH, C(O)NHCH(NH.sub.2), C(O)NHC(NH)NH, NHCH(NH.sub.2)C(O) or NHC(NH)NHC(O); X.sup.5 is (CH.sub.2).sub.n or phenylene-CH.sub.2; X.sup.6 is hydrogen, C.sub.1-C.sub.6-alkyl, C.sub.1-C.sub.6-alkoxy-C.sub.1-C.sub.2-alkyl, C.sub.2-C.sub.7-alkanoyloxy-C.sub.1-C.sub.2-alkyl or C.sub.2-C.sub.7-alkanoylsulfanyl-C.sub.1-C.sub.2-alkyl; R.sup.4 is OH or NH.sub.2; n is an integer from 0 to 4; m is an integer from 1 to 6; and p is an integer from 1 to 6, or an acid or base addition salt thereof.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0291]
[0292]
[0293]
[0294]
[0295]
[0296]
[0297]
[0298]
[0299]
[0300]
[0301]
[0302]
[0303]
[0304]
[0305]
DETAILED DESCRIPTION OF THE INVENTION
[0306] The invention is based inter alia on the finding that alkyl-substituted tetrazines preferentially react with strained dienophiles comprising a trans-cyclooctenyl group as compared to strained dienophiles comprising a cyclooctynyl group. Thus, in a competitive situation where trans-cyclooctenyl and cyclooctynyl groups are present, the alkyl-substituted tetrazines will preferentially react with the trans-cyclooctenyl groups. In this context, the term preferentially reacts refers to a ratio of rate constants k, which ratio is 100 or higher, 200 or higher, 500 or higher, or 1000 or higher, if the rate constant k.sub.1 for the reaction of the alkyl-substituted tetrazines with the strained dienophiles comprising a trans-cyclooctenyl group is compared to the rate constant k.sub.2 for the reaction of the alkyl-substituted tetrazines with the strained dienophiles comprising a cyclooctynyl group (i.e., the ratio is k.sub.1/k.sub.2). Accordingly, the reaction of the alkyl-substituted tetrazine with the strained dienophile comprising a trans-cyclooctenyl group can proceed to a point where substantially all trans-cyclooctenyl groups have reacted with the alkyl-substituted tetrazine while substantially no cyclooctynyl group has yet reacted with the alkyl-substituted tetrazine.
[0307] According to certain embodiments of the invention, alkyl-substituted tetrazines specifically react with the strained dienophiles comprising a trans-cyclooctenyl group. Thus, in a competitive situation where trans-cyclooctenyl and cyclooctynyl groups are present, the alkyl-substituted tetrazines will preferentially react with the trans-cyclooctenyl groups. In this context, the term specifically reacts refers to a ratio of rate constants k, which ratio is 2000 or higher, 5000 or higher, or 10000 or higher, if the rate constant k.sub.1 for the reaction of the alkyl-substituted tetrazines with the strained dienophiles comprising a trans-cyclooctenyl group is compared to the rate constant k.sub.2 for the reaction of the alkyl-substituted tetrazines with the strained dienophiles comprising a cyclooctynyl group (i.e., the ratio is k.sub.1/k.sub.2). Accordingly, the reaction of the alkyl-substituted tetrazines with the strained dienophile comprising a trans-cyclooctenyl group can proceed to a point where all trans-cyclooctenyl groups have reacted with the alkyl-substituted tetrazine while substantially no cyclooctynyl group has yet reacted with the alkyl-substituted tetrazine.
[0308] The reactions of the invention can be performed in vitro or in vivo, depending on the appropriate reaction conditions. Because only the first and second dienophile groups (e.g. the unnatural amino acids comprising said groups present on the target polypeptides) participate in the ligation reaction, the methods of the invention can be reliably used to produce homogenous populations of well-defined conjugates (e.g., target polypeptide-label conjugates comprising defined stoichiometries and defined ligation sites) with high efficiency and specificity. Because any of a variety of reactive first and second modifying agents (e.g. unnatural amino acids) comprising the first and second dienophile groups can be incorporated into a variety of molecules (e.g. target polypeptides), the production of conjugates (e.g. target polypeptide conjugates) is not limited to specific molecules (e.g. polypeptides). Furthermore, existing technologies beneficially permit the incorporation of unnatural amino acids into any amino acid position in a polypeptide. Thus, placement of the first and second chemically reactive unnatural amino acids in the target polypeptides, can optionally be chosen based on, e.g., whether placement in that location would change, e.g., the conformations, biological activities, pharmacological activities, stabilities, bioavailabilities, or other properties, of the target polypeptide, or of the resulting target polypeptide-label conjugates.
[0309] The term unnatural amino acid refers to an amino acid that is not one of the 20 canonical amino acids or selenocysteine or pyrrolysine. The term also refers to amino acid analogues, e.g. wherein the -amino group is replaced by a hydroxyl group; or wherein the carboxylic acid function forms an ester. Actually, when unnatural amino acids of the invention or salts thereof, wherein X.sup.6 is other than hydrogen, are used for preparation of polypeptides in a translation system, it is believed that X.sup.6 is removed in situ, for example enzymatically within the chosen translation system, prior of being incorporated in the polypeptide. Accordingly, X.sup.6 is expediently chosen so as to be compatible with a translation system's ability to convert unnatural amino acids of the invention or salts thereof into a form that is recognized and processed by the aminoacyl tRNA synthetase.
[0310] The compounds or salts of the invention possess centers of asymmetry and may exist in different spatial arrangements or as different tautomers. For preparation of polypeptides with trans-cyclooctenyl or cyclooctynyl groups, enantiomeric mixtures, in particular racemates, diastereomeric mixtures and tautomeric mixtures may be used. Alternatively, the respective essentially pure enantiomers, diastereomers and tautomers of the compounds or salts of the invention may be used for such purpose.
[0311] More specifically, the trans-cyclooctenyl group of the formula:
##STR00058##
is meant to encompass two isomeric forms which differ from one another by the absolute configuration at the carbon atom where the trans-cyclooctene ring is attached to the remainder of the molecule. Accordingly, one can distinguish the two enantiomers having an S or R configuration, e.g. the enantiomers of the formulae
##STR00059##
[0312] Due to atropisomerism, trans-cylooctenyl groups exist in four different stereoisomeric forms. With regard to the carbon atom where the trans-cylooctene ring is attached, one differentiates axial isomers and equatorial isomers (i.e. the remainder of the molecule is attached in axial or equatorial position relative to the trans-cyclooctene ring). For each of said axial and for each of said equatorial isomeric form there are two enantiomers. Accordingly, the stereoisomers of the trans-cyclooctenyl group can be depicted by the formulae
##STR00060##
[0313] Unless indicated otherwise, the term axial isomer refers to a mixture of both enantiomers (in particular a racemate) of the axial isomeric form, and the term equatorial isomer refers to a mixture of both enantiomers (in particular a racemate) of the equatorial isomeric form.
[0314] The organic moieties mentioned in the above definitions of the variables arelike the term alkylcollective terms for individual listings of the individual group members. The prefix C.sub.n-m indicates in each case the possible number of carbon atoms in the group.
[0315] The term halogen denotes in each case a fluorine, bromine, chlorine or iodine radical, in particular a fluorine radical.
[0316] Alkyl is a straight-chain or branched alkyl group having from 1 to 6, in particular 1 to 4 or 1 to 3 carbon atoms. Examples include methyl, C.sub.2-C.sub.4-alkyl such as ethyl, n-propyl, iso-propyl, n-butyl, 2-butyl, iso-butyl or tent-butyl, and also pentyl, 1-methylbutyl, 2-methylbutyl, 3-methylbutyl, 2,2-dimethylpropyl, 1-ethylpropyl, hexyl, 1,1-dimethylpropyl, 1,2-dimethylpropyl, 1-methylpentyl, 2-methylpentyl, 3-methylpentyl, 4-methylpentyl, 1,1-dimethylbutyl, 1,2-dimethylbutyl, 1,3-dimethylbutyl, 2,2-dimethylbutyl, 2,3-dimethylbutyl, 3,3-dimethylbutyl, 1-ethylbutyl, 2-ethylbutyl, 1,1,2-trimethylpropyl, 1,2,2-trimethylpropyl, 1-ethyl-1-methylpropyl and 1-ethyl-2-methylpropyl.
[0317] Alkenyl is a singly unsaturated hydrocarbon radical having 2, 3, 4, 5 or 6 carbon atoms, e.g. vinyl, allyl (2-propen-1-yl), 1-propen-1-yl, 2-propen-2-yl, methallyl (2-methylprop-2-en-1-yl) and the like. C.sub.3-C.sub.5-Alkenyl is, in particular, allyl, 1-methylprop-2-en-1-yl, 2-buten-1-yl, 3-buten-1-yl, methallyl, 2-penten-1-yl, 3-penten-1-yl, 4-penten-1-yl, 1-methylbut-2-en-1-yl, 2-ethylprop-2-en-1-yl, 2-hexen-1-yl and the like.
[0318] Alkylene is straight-chain or branched alkylene group having from 1 to 6, in particular 1 to 4 carbon atoms. Examples include methylene, ethylene, 1,2-ethylene, 1,3-propylene, isopropylene, 1-4-butylene, 1-5-pentylene and the like.
[0319] Alkoxy is a radical of the formula RO, wherein R is a straight-chain or branched alkyl group having from 1 to 6, in particular 1 to 4 or 1 to 3 carbon atoms as defined herein.
[0320] Alkenoxy is a radical of the formula RO, wherein R is a straight-chain or branched alkenyl group having from 1 to 6, in particular 1 to 4 or 1 to 3 carbon atoms as defined herein.
[0321] Alkanoyloxy is a radical of the formula R(CO)O, wherein R is a straight-chain or branched alkyl group having from 1 to 6, in particular 1 to 4 or 1 to 3 carbon atoms as defined herein.
[0322] Alkylaminocarbonyloxy is a radical of the formula RNH(CO)O, wherein R is a straight-chain or branched alkyl group having from 1 to 6, in particular 1 to 4 or 1 to 3 carbon atoms as defined herein.
[0323] Alkylthio is a radical of the formula RS, wherein R is an alkyl radical having from 1 to 4, preferably from 1 to 3 carbon atoms as defined herein.
[0324] Alkanoylsulfanyl is a radical of the formula R(CO)S, wherein R is a straight-chain or branched alkyl group having from 1 to 6, in particular 1 to 4 or 1 to 3 carbon atoms as defined herein.
[0325] Alkylamino is a radical of the formula RNH wherein R is an alkyl radical having from 1 to 6, in particular from 1 to 4 carbon atoms as defined herein. Examples include methylamino, ethylamino, n-propylamino, iso-propylamino, n-butylamino, 2-butylamino, iso-butylamino, tert-butylamino and the like.
[0326] Dialkylamino is a radical of the formula RRN wherein R and R are independently of each other an alkyl radical having from 1 to 6, in particular from 1 to 4 carbon atoms as defined herein. Examples include dimethylamino, diethylamino, N-methyl-N-ethylamino and the like.
[0327] Alkenylamino is a radical of the formula RNH wherein R is an alkenyl radical having from 2 to 6, in particular from 2 to 4 carbon atoms as defined herein. Examples include vinylamino, allylamino (2-propen-1-yl-amino), 1-propen-1-yl-amino, 2-propen-2-yl-amino, methallylamino (2-methylprop-2-en-1-yl-amino) and the like.
[0328] N-Alkyl-N-alkenylamino is a radical of the formula RRN wherein R is an alkyl radical having from 1 to 6, in particular from 1 to 4 carbon atoms as defined herein and R an alkenyl radical having from 2 to 6, in particular from 2 to 4 carbon atoms as defined herein. Examples include N-methyl-N-vinylamino, N-methyl-N-allylamino (N-methyl-N-2-propen-1-yl-amino), N-methyl-N-1-propen-1-yl-amino, N-methyl-N-2-propen-2-yl-amino, N-methyl-N-methallylamino (N-methyl-N-2-methylprop-2-en-1-yl-amino) and the like.
[0329] Dialkenylamino is a radical of the formula RRN wherein R and R are independently of each other an alkyl radical having from 2 to 6, in particular from 2 to 4 carbon atoms as defined herein. Examples include divinylamino, diallylamino (di-(2-propen-1-yl)-amino), N-vinyl-N-allyl-amino and the like.
[0330] Unless indicated otherwise, the term substituted means that a radical is substituted with 1, 2 or 3, especially 1 or 2, substituent(s) which are in particular selected from the group consisting of halogen, C.sub.1-C.sub.4-alkyl, CN, CF.sub.3, hydroxyl, OCF.sub.3, C.sub.1-C.sub.4-alkoxy, C.sub.2-C.sub.4-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy and C.sub.1-C.sub.4-alkylthio.
[0331] The acid or base addition salts of the compounds of the invention are especially addition salts with physiologically tolerated acids or bases. Physiologically tolerated acid addition salts can be formed by treatment of the base form of a compound of the invention with appropriate organic or inorganic acids. Compounds of the invention containing an acidic proton may be converted into their non-toxic metal or amine addition salt forms by treatment with appropriate organic and inorganic bases. The compounds and salts of the invention also comprise the hydrates and solvent addition forms thereof, e.g. hydrates, alcoholates and the like.
[0332] Physiologically tolerated acids or bases are in particular those which are tolerated by the system used for the incorporation of the first and second dienophiles (e.g. a biological system such as a translation system used for preparation of polypeptides with trans-cyclooctenyl or cyclooctynyl groups), e.g. which are substantially non-toxic to living cells.
[0333] The compounds and salts of the invention (e.g. the dienophiles ad tetrazines of the invention) can be prepared by analogy to methods which are well known in the art. Suitable methods for the preparation of compounds of formula (I) are found in the various publications cited herein, all of which are incorporated herein by reference in their entireties. Some methods are outlined herein.
[0334] The compounds and salts of the invention can be used for preparation of polypeptides comprising one or more than one cyclooctynyl or trans-cyclooctenyl analog group. The invention provides processes for preparing such polypeptides, in vivo or in vitro. In particular, the compounds or salts of the invention can be translationally incorporated in a polypeptide that is encoded by a polynucleotide comprising one or more than one selector codon(s). A polypeptide is any oligomer of amino acid residues (natural or unnatural, or a combination thereof), of any length, typically but not exclusively joined by covalent peptide bonds. A polypeptide can be from any source, e.g., a naturally occurring polypeptide, a polypeptide produced by recombinant molecular genetic techniques, a polypeptide from a cell or translation system, or a polypeptide produced by cell-free synthetic means. A polypeptide is characterized by its amino acid sequence, e.g., the primary structure of its component amino acid residues. As used herein, the amino acid sequence of a polypeptide is not limited to full-length sequences, but can be partial or complete sequences. Furthermore, it is not intended that a polypeptide be limited by possessing or not possessing any particular biological activity. As used herein, the term protein is synonymous with polypeptide. The term peptide refers to a small polypeptide, for example but not limited to, from 2-25 amino acids in length. As used herein, to incorporate an unnatural amino acid, e.g., into a target polypeptide, refers to the direct addition of an unnatural amino acid to a growing polypeptide chain during primary construction of the target polypeptide, e.g., via translation or chemical synthesis.
[0335] First and second unnatural amino acids can be directly incorporated into target polypeptides using any of a number of methods known in the art. While many embodiments utilize orthogonal translation systems as the route of direct incorporation of the unnatural amino acids, other direct incorporation methods (e.g., in vitro translation systems, solid-phase synthesis, etc.) can be used alternatively. It will be appreciated that in typical embodiments herein, an unnatural amino acid is preferably incorporated into target polypeptide, i.e., during construction of the polypeptide, and is not added via post-translational chemical derivatization.
[0336] In certain embodiments described herein, the unnatural amino acids can be site-specifically incorporated into a target polypeptide with high efficiency and high fidelity using orthogonal tRNA/aminoacyl-tRNA synthetase pairs. Methylotrophic yeast are attractive candidates for use as recombinant expression systems for heterologous, therapeutically useful proteins. The eukaryotic subcellular organization of methylotrophic yeast enables them to carry out many of the posttranslational folding, processing and modification events required to synthesize biologically active carrier polypeptides and/or target polypeptides derived from mammals. Unlike proteins expressed in S. cerevisiae, proteins produced by methylotrophic yeast such as P. pastoris, P. methanolica, P. angusta (also known as Hansenula polymorpha), Candida boidinii, and Torulopsis spp., are less likely to contain high-mannose glycan structures that can hamper downstream processing of heterologously expressed glycoproteins. In addition, target polypeptides synthesized in methylotrophic yeast are advantageously free of pyrogenic and antigenic compounds often characteristic of proteins expressed in E. coli. Most significantly, methylotrophic yeast expression systems are particularly useful for large-scale synthesis. For example, orthogonal translation systems in methylotrophic yeast can permit the expression of target polypeptides comprising unnatural amino acids at levels 10- to 100-fold higher than in S. cerevisiae, bacterial, insect, or mammalian systems. In addition, methylotrophic yeast can be easily cultured in a simple, defined salt medium, eliminating the need for the expensive media supplements and equipment that are required for baculovirus expression systems. The term translation system refers to the components necessary to incorporate an amino acid in a growing polypeptide chain (protein). Components of a translation system can include, e.g., ribosomes, tRNAs, synthetases, mRNA and the like.
[0337] The translation system may be an in vivo or an in vitro translation system.
[0338] An in vitro translation system may be a cell-free translation system. A cell-free translation system is a system for synthesizing a desired protein by obtaining protein factors required for mRNA translation, e.g., in form of a cell extract, followed by reconstituting this reaction in vitro. Such cell-free systems and their use for protein synthesis are known in the art. Examples include extracts of E. coli, wheat germ extract, or rabbit reticulocyte lysate (Spirin and Swartz, Cell-free Protein Synthesis, Wiley VCH Verlag, Weinheim, Germany, 2008).
[0339] Preferably, the translation system used in the process of the invention is an in vivo translation system. An in vivo translation system can be a cell, e.g. a prokaryotic or eukaryotic cell. The cell can be a bacterial cell, e.g. E. coli; a fungal cell such as a yeast cell, e.g. S. cerevisiae or a methylotrophic yeast; a plant cell, or an animal cell such as an insect cell or a mammalian cell, e.g. a HEK cell or a HeLa cell. Eukaryotic cells used for polypeptide expression may be single cells or parts of a multicellular organism.
[0340] According to a particular embodiment, the translation system is an E. coli cell.
[0341] According to a further particular embodiment, the translation system is a mammalian cell, e.g. a HEK or HeLa cell.
[0342] A translation system useful for preparation of polypeptides of the invention comprises, in particular, an aminoacyl tRNA synthetase, or a polynucleotide encoding it; a tRNA having an anticodon to a selector codon, or a polynucleotide encoding said tRNA; and a polynucleotide encoding the target polypeptide and comprising one or more than one selector codon(s).
[0343] For example, polynucleotides encoding the aminoacyl tRNA synthetase, the tRNA and the polypeptide of the invention may be introduced into a cell by transfection/transformation known in the art.
[0344] An aminoacyl tRNA synthetase (RS) is an enzyme capable of acylating a tRNA with an amino acid or amino acid analog. Expediently, the RS used in the methods of the invention is capable of acylating a tRNA with an unnatural amino acid of the invention.
[0345] The methods of the invention expediently utilize a tRNA aminoacyl tRNA synthetase (tRNA/RS) pair. Preferably, the tRNA/RS pair used in the processes of the invention is orthogonal to the translation system.
[0346] The term orthogonal as used herein refers to a molecule (e.g., an orthogonal tRNA (O-tRNA) and/or an orthogonal aminoacyl tRNA synthetase (O-RS)) that is used with reduced efficiency by a translation system of interest (e.g., a cell). Orthogonal refers to the inability or reduced efficiency, e.g., less than 20% efficient, less than 10% efficient, less than 5% efficient, or e.g., less than 1% efficient, of an orthogonal tRNA or an orthogonal aminoacyl tRNA synthetase to function with the endogenous aminoacyl tRNA synthetases or endogenous tRNAs of the translation system of interest.
[0347] For example, an orthogonal tRNA in a translation system of interest is acylated by any endogenous aminoacyl tRNA synthetase of a translation system of interest with reduced or even zero efficiency, when compared to acylation of an endogenous tRNA by the endogenous aminoacyl tRNA synthetase. In another example, an orthogonal aminoacyl tRNA synthetase acylates any endogenous tRNA in the translation system of interest with reduced or even zero efficiency, as compared to acylation of the endogenous tRNA by an endogenous aminoacyl tRNA synthetase.
[0348] Orthogonal tRNA/RS pairs used in processes of the invention preferably have following properties: the O-tRNA is preferentially acylated with the unnatural amino acid of the invention by the O-RS. In addition, the orthogonal pair functions in the translation system of interest, e.g., the translation system uses the unnatural amino acid acylated O-tRNA to incorporate the unnatural amino acid of the invention in a polypeptide chain. Incorporation occurs in a site specific manner, e.g., the O-tRNA recognizes a selector codon, e.g., an amber stop codon, in the mRNA coding for the polypeptide.
[0349] In some aspects, the translation system comprises a second orthogonal pair, e.g., a second O-RS and a second O-tRNA that utilize the second unnatural amino acid, so that the system is now able to incorporate at least two different unnatural amino acids at different selected sites in a polypeptide. In this embodiment, the second O-RS preferentially aminoacylates the second O-tRNA with the second unnatural amino acid that is different from the first unnatural amino acid, and the second O-tRNA recognizes a selector codon that is different from the selector codon recognized by the first O-tRNA. Suitable translation systems comprising two orthogonal tRNA/RS pairs are known in the art. See, for instance, Han Xiao, et al., Angew Chem Int Ed Engl 2013, 52, 14080-14083.
[0350] In some embodiments, the translation system comprises a cell, e.g., a mammalian, an insect, a yeast, a bacterial, or an E. coli cell. The type of cell used is not particularly limited, as long as the O-RS and O-tRNA retain their orthogonality in the cell's environment.
[0351] The term preferentially acylates refers to an efficiency of, e.g., about 50% efficient, about 70% efficient, about 75% efficient, about 85% efficient, about 90% efficient, about 95% efficient, or about 99% or more efficient, at which an O-RS acylates an O-tRNA with an unnatural amino acid compared to an endogenous tRNA or amino acid of a translation system of interest. The unnatural amino acid is then incorporated in a growing polypeptide chain with high fidelity, e.g., at greater than about 75% efficiency for a given selector codon, at greater than about 80% efficiency for a given selector codon, at greater than about 90% efficiency for a given selector codon, at greater than about 95% efficiency for a given selector codon, or at greater than about 99% or more efficiency for a given selector codon.
[0352] The term selector codon refers to codons recognized by the O-tRNA in the translation process and not recognized by an endogenous tRNA. The O-tRNA anticodon loop recognizes the selector codon on the mRNA and incorporates its amino acid, e.g., an unnatural amino acid, at this site in the polypeptide. Selector codons can include, e.g., nonsense codons, such as stop codons, e.g., amber, ochre, and opal codons; four or more base codons; codons derived from natural or unnatural base pairs and the like. For a given system, a selector codon can also include one of the natural three base codons (i.e. natural triplets), wherein the endogenous system does not use said natural triplet, e.g., a system that is lacking a tRNA that recognizes the natural triplet or a system wherein the natural triplet is a rare codon.
[0353] An anticodon has the reverse complement sequence of the corresponding codon.
[0354] An O-tRNA/O-RS pair is composed of an O-tRNA, e.g., a suppressor tRNA, or the like, and an O-RS.
[0355] A suppressor tRNA is a tRNA that alters the reading of a messenger RNA (mRNA) in a given translation system. A suppressor tRNA can read through, e.g., a stop codon, a four base codon, or a rare codon.
[0356] The O-tRNA is not acylated by endogenous synthetases and is capable of decoding a selector codon, as described herein. The O-RS recognizes the O-tRNA, e.g., with an extended anticodon loop, and preferentially acylates the O-tRNA with an unnatural amino acid.
[0357] The tRNA and the RS used in the processes of the invention can be naturally occurring or can be derived by mutation of a naturally occurring tRNA and/or RS from a variety of organisms. In various embodiments, the tRNA and RS are derived from at least one organism. In another embodiment, the tRNA is derived from a naturally occurring or mutated naturally occurring tRNA from a first organism and the RS is derived from naturally occurring or mutated naturally occurring RS from a second organism.
[0358] A suitable tRNA/RS pair may be selected from libraries of mutant tRNA and RS, e.g. based on the results of a library screening. Alternatively, a suitable tRNA/RS pair may be a heterologous tRNA/synthetase pair that is imported from a source species into the translation system. Preferably, the cell used as translation system is different from said source species.
[0359] For example a suitable orthogonal O-tRNA can be derived from an archaebacterium, such as Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium such as Haloferax volcanii and Halobacterium species NRC-I, Archaeoglobus fulgidus, Pyrococcus furiosus, Pyrococcus horikoshii, Aeuropyrum pernix, Methanococcus maripaludis, Methanopyrus kandleri, Methanosarcina mazei (Mm), Pyrobaculum aerophilum, Pyrococcus abyssi, Sulfolobus solfataricus (Ss), Sulfolobus tokodaii, Thermoplasma acidophilum, Thermoplasma volcanium, or the like, or a eubacterium, such as Escherichia coli, Thermus thermophilus, Bacillus subtilis, Bacillus stearothermphilus, or the like, while the orthogonal O-RS can be derived from an organism or combination of organisms, e.g., an archaebacterium, such as Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium such as Haloferax volcanii and Halobacterium species NRC-J, Archaeoglobus fulgidus, Pyrococcus furiosus, Pyrococcus horikoshii, Aeuropyrum pernix, Methanococcus maripaludis, Methanopyrus kandleri, Methanosarcina mazei, Methanosarcina bakeri; Methanosarcina hafniense; Pyrobaculum aerophilum, Pyrococcus abyssi, Sulfolobus solfataricus, Sulfolobus tokodaii, Thermoplasma acidophilum, Thermoplasma volcanium, or the like, or a eubacterium, such as Escherichia coli, Thermus thermophilus, Bacillus subtilis, Bacillus stearothermphilus, or the like. In one embodiment, eukaryotic sources, e.g., plants, algae, protists, fungi, yeasts, animals, e.g., mammals, insects, arthropods, or the like can also be used as sources of O-tRNAs and O-RSs
[0360] Methods for evolving tRNA/RS pairs are described, e.g., in WO 02/085923 and WO 02/06075.
[0361] Preferably, the RS is a pyrrolysyl tRNA synthetase (pyIRS) capable of acylating a tRNA with the unnatural amino acid of the invention.
[0362] The pyrrolysyl tRNA synthetase used in methods of the invention may be a wildtype or a genetically engineered pyIRS. Examples for wildtype pyIRS include, but are not limited to pyIRS from archaebacteria and eubacteria such as Methanosarcina mazei, Methanosarcina barkeri, Methanococcoides burtonii, Methanosarcina acetivorans, Methanosarcina thermophila, and Desulfitobacterium hafniense.
[0363] Genetically engineered pyIRS have been described, for example, by Neumann et al. (Nat Chem Biol 4:232, 2008), by Yanagisawa et al. (Chem Biol 2008, 15:1187), and in EP2192185A1).
[0364] According to a particular embodiment, the pyrrolysyl tRNA synthetase used for preparation of polypeptides of the invention is wildtype pyrrolysyl tRNA synthetase from M. mazei.
[0365] According to a particular embodiment, the pyrrolysyl tRNA synthetase comprises the amino acid sequence of wildtype M. mazei pyrrolysyl tRNA synthetase set forth in SEQ ID NO:1, or a functional fragment thereof.
TABLE-US-00001 SEQIDNO:1: MDKKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNNSRSSRTARAL 60 RHHKYRKTCKRCRVSDEDLNKFLTKANEDQTSVKVKVVSAPTRTKKAMPKSVARAPKPLE 120 NTEAAQAQPSGSKFSPAIPVSTQESVSVPASVSTSISSISTGATASALVKGNTNPITSMS 180 APVQASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERE 240 NYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPM 300 LAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLE 360 SIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGA 420 GFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 454
[0366] According to another particular embodiment, the pyrrolysyl tRNA synthetase is pyrrolysyl tRNA synthetase from M. mazei comprising one or more than one amino acid alteration, preferably selected from amino acid substitutions Y306A and Y384F.
[0367] According to a particular embodiment, the pyrrolysyl tRNA synthetase comprises the amino acid sequence of mutant M. mazei pyrrolysyl tRNA synthetase set forth in SEQ ID NO:2, or a functional fragment thereof.
TABLE-US-00002 SEQIDNO:2: MDKKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNNSRSSRTARAL 60 RHHKYRKTCKRCRVSDEDLNKFLTKANEDQTSVKVKVVSAPTRTKKAMPKSVARAPKPLE 120 NTEAAQAQPSGSKFSPAIPVSTQESVSVPASVSTSISSISTGATASALVKGNTNPITSMS 180 APVQASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERE 240 NYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPM 300 LAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLE 360 SIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGA 420 GFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 454
[0368] Any aminoacyl tRNA synthetase described herein may be used for acylation of a tRNA with the unnatural amino acids of the invention.
[0369] According to one aspect of the invention, wildtype M. mazei pyrrolysyl tRNA synthetase is used for acylation of a tRNA with a compound of formula
##STR00061##
or a salt thereof.
[0370] According to a further aspect of the invention, wildtype M. mazei pyrrolysyl tRNA synthetase is used for acylation of a tRNA with a compound of formula
##STR00062##
or a salt thereof.
[0371] According to another aspect of the invention, a mutant M. mazei pyrrolysyl tRNA synthetase comprising amino acid substitutions Y306A and Y384F is used for acylation of a tRNA with a compound of formula
##STR00063##
or a salt thereof.
[0372] According to another aspect of the invention, a mutant M. mazei pyrrolysyl tRNA synthetase comprising amino acid substitutions Y306A and Y384F is used for acylation of a tRNA with a compound of formula
##STR00064##
or a salt thereof.
[0373] The tRNA which is used in combination with the pyIRS (tRNA.sup.pyl) May be a Wildtype or a Genetically engineered tRNA. Examples for wildtype tRNA.sup.pyl include, but are not limited to, tRNAs from archaebacteria and eubacteria, such as mentioned above, which facilitate translational incorporation of pyrrolysyl residues.
[0374] In a similar manner, suitable tRNA.sup.tyr/TyrRS and tRNA.sup.Leu/leucyl-tRNA synthetase pairs can be provided and used.
[0375] Selector codons utilized in methods of the present invention expand the genetic codon framework of the protein biosynthetic machinery of the translation system used. For example, a selector codon includes, e.g., a unique three base codon, a nonsense codon, such as a stop codon, e.g., an amber codon, or an opal codon, an unnatural codon, at least a four base codon or the like. A number of selector codons can be introduced into a polynucleotide encoding a desired polypeptide (target polypeptide), e.g., one or more, two or more, more than three, etc.
[0376] The 64 genetic codons code for 20 amino acids and three stop codons. Because only one stop codon is needed for translational termination, the other two can in principle be used to encode nonproteinogenic amino acids. The amber stop codon, UAG, has been successfully used in in vitro biosynthetic system and in Xenopus oocytes to direct the incorporation of unnatural amino acids. Among the three stop codons, UAG is the least used stop codon in E. coli. Some E. coli strains contain natural suppressor tRNAs, which recognize UAG and insert a natural amino acid. In addition, these amber suppressor tRNAs have been used in conventional protein mutagenesis. In mammalian cells (HEK cells), the ochre (TAA) codon and the amber (TAG) codon have been used to incorporate two different unnatural amino acids into distinct sites of the same polypeptide. See, for instance, Han Xiao, et al., Angew Chem Int Ed Engl 2013, 52, 14080-14083.
[0377] In one embodiment, the methods of the invention involve the use of a selector codon that is a stop codon for the incorporation of a compound of the invention. For example, an O-tRNA is generated that recognizes the stop codon, preferably the amber stop codon, and is acylated by an ORS with a compound of the invention. This O-tRNA is not recognized by the naturally occurring aminoacyl-tRNA synthetases. Conventional site-directed mutagenesis can be used to introduce the stop codon, e.g., the amber stop codon, at the site of interest into the polynucleotide sequence encoding the target polypeptide. When the O-RS, O-tRNA and the mutant gene are combined in a translation system, the unnatural amino acid is incorporated in response to the amber stop codon to give a polypeptide containing the unnatural amino acid analog, i.e. the compound of the invention, at the specified position(s).
[0378] The incorporation of the compounds of the invention in vivo can be done without significant perturbation of the host, e.g., an E. coli or HEK or HeLa cell. For example, because the suppression efficiency for the amber stop codon depends upon the competition between the O-tRNA, e.g., the amber suppressor tRNA, and the release factor 1 (RF1) (which binds to the amber stop codon and initiates release of the growing peptide from the ribosome), the suppression efficiency can be modulated by, e.g., either increasing the expression level of O-tRNA, e.g., the suppressor tRNA, or by using an RF1 deficient strain.
[0379] According to particular embodiment, the tRNA.sup.pyl used in processes of the invention comprises the CUA anticodon to the amber stop codon.
[0380] Other selector codons useful for encoding compounds of the invention are rare codons. For example, when the arginine concentration in an in vitro protein synthesis reaction is reduced, the rare arginine codon, AGG, has proven to be efficient for insertion of Ala by a synthetic tRNA acylated with alanine. In this case, the synthetic tRNA competes with the naturally occurring tRNA.sup.Arg, which exists as a minor species in E. coli. Some organisms do not use all triplet codons. For example, an unassigned codon AGA in Micrococcus luteus has been utilized for insertion of amino acids in an in vitro transcription/translation extract. Accordingly, any triplet codon not used by the translation system applied in the processes of the invention can serve as selector codon.
[0381] A further alternative for incorporating UAAs according to the present invention into polypeptides is using a quadruplet (four-base) codon as a selector codon and a corresponding O-tRNA/RS pair.
[0382] The translation system is kept for a suitable time at conditions which allow formation of the polypeptide of the invention by a ribosome. mRNA that encodes the target polypeptide and comprises one or more than one selector codon is bound by the ribosome. Then, the polypeptide is formed by stepwise attachment of amino acids at positions encoded by codons which are bound the respective aminoacyl tRNAs. Thus, the compound of the invention is incorporated in the target polypeptide at the position(s) encoded by the selector codon(s).
[0383] Translation of the target polypeptide by a translation system may be effected by procedures well known in the art. To facilitate efficient translation, the components of the translation system may be mixed. Cells used as translation system are expediently cultured and kept in a suitable expression medium under conditions and for a time suitable to produce the target polypeptide. It may be required to induce expression by addition of a compound, such as arabinose, isopropyl/3-D-thiogalactoside (IPTG) or tetracycline that allows transcription of the target polypeptide gene.
[0384] Optionally, after translation the polypeptide of the invention may be recovered from the translation system. For this purpose, the polypeptides of the invention can be recovered and purified, either partially or substantially to homogeneity, according to procedures known to and used by those of skill in the art. Standard procedures well known in the art include, e.g., ammonium sulfate or ethanol precipitation, acid or base extraction, column chromatography, affinity column chromatography, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, hydroxylapatite chromatography, lectin chromatography, gel electrophoresis and the like. Protein refolding steps can be used, as desired, in making correctly folded mature proteins. High performance liquid chromatography (HPLC), affinity chromatography or other suitable methods can be employed in final purification steps where high purity is desired. Antibodies made against the unnatural amino acid or the polypeptides of the invention can be used as purification reagents, i.e. for affinity-based purification of the polypeptides.
[0385] A variety of purification/protein folding methods are well known in the art, including, e.g., those set forth in Scopes, Protein Purification, Springer, Berlin (1993); and Deutscher, Methods in Enzymology Vol. 182: Guide to Protein Purification, Academic Press (1990); and the references cited therein.
[0386] As noted, those of skill in the art will recognize that, after synthesis, expression and/or purification, polypeptides can possess a conformation different from the desired conformations of the relevant polypeptides. For example, polypeptides produced by prokaryotic systems often are optimized by exposure to chaotropic agents to achieve proper folding. During purification from, e.g., lysates derived from E. coli, the expressed polypeptide is optionally denatured and then renatured. This is accomplished, e.g., by solubilizing the proteins in a chaotropic agent such as guanidine HCl. In general, it is occasionally desirable to denature and reduce expressed polypeptides and then to cause the polypeptides to re-fold into the preferred conformation. For example, guanidine, urea, DTT, DTE, and/or a chaperonin can be added to a translation product of interest. Methods of reducing, denaturing and renaturing proteins are well known to those of skill in the art. Polypeptides can be refolded in a redox buffer containing, e.g., oxidized glutathione and
[0387] It will be appreciated that while particular methods of constructing target polypeptide of the invention that comprise chemically reactive unnatural amino acids are detailed herein, e.g., using orthogonal translation systems, they should not necessarily be taken as limiting. Furthermore, other, e.g., non-orthogonal, methods of constructing target polypeptides having unnatural amino acids are also included herein in the many embodiments. Such methods are described in further detail herein.
[0388] In different embodiments of the invention, target polypeptides of the invention can be constructed via direct incorporation methods such as an orthogonal translation system. This represents a preferred embodiment, due to the ability of orthogonal systems to produce high yields of correctly folded and post-translationally modified polypeptides with site-specifically incorporated unnatural amino acids. Alternatively or additionally, however, other strategies for the direct incorporation of unnatural amino acids into a polypeptide chain can be employed to introduce first and second unnatural amino acids into the target polypeptides. For example, one general in vitro biosynthetic method for incorporating unnatural amino acids into, e.g., target polypeptides, during primary construction uses nonsense or frameshift suppressor tRNAs that have been chemically acylated with the desired unnatural amino acid and then added to an extract capable of supporting protein biosynthesis and which includes a gene containing a desired amber nonsense mutation. This strategy has been used to site-specifically incorporate over 100 unnatural amino acids into a variety of proteins of virtually any size and can be used herein to create target polypeptides that comprise unnatural amino acids. In other embodiments, unnatural amino acids can be directly incorporated into smaller target polypeptides (ranging from 60-100 amino acids) via chemical synthesis. Solid phase peptide synthesis is a method that is widely used to chemically synthesize peptides and small proteins that comprise unnatural amino acids (see, e.g., Merrifield (1963) Solid Phase Peptide synthesis. I. The synthesis of a tetrapeptide. JACS 85: 2149-2154) and can be adapted to produce target polypeptides of the invention. This technique typically comprises two stages: The first stage solid phase peptide synthesis (SPPS) includes the assembly of a peptide chain using protected amino acid derivatives on a polymeric support via repeated cycles of coupling-deprotection. The free N-terminal amine of a solid-phase attached peptide can then be coupled to a single N-protected amino acid unit, e.g., an unnatural amino acid. This unit is then deprotected, revealing a new N-terminal amine to which a further amino acid may be attached. While the peptide is being synthesized usually by stepwise methods, all soluble reagents can be removed from the peptide-solid support matrix by filtration and washed away at the end of each coupling step. In the second stage of SPPS, the peptide is cleaved from the support and side-chain protecting groups are removed to produce the peptide, e.g., a target polypeptide comprising one or more unnatural amino acids. There are two major used forms of solid phase peptide synthesis: Fmoc (Carpino et al. (1972) 9-Fluorenylmethoxycarbonyl amino-protecting group. J Org Chem 37: 3404-3409), in which a base labile alpha-amino protecting group is used, and t-Boc, in which an acid labile protecting group is used. Each method involves different resins and amino acid side-chain protection and consequent cleavage/deprotection steps.
[0389] By means of the methods of the invention it is furthermore possible to introduce multiple labels into oligonucleotides obtained by synthesis. The amidites comprising the dienophiles of the invention required for this can be easily prepared. The oligonucleotide may have any length between 3 and 10000 nucleotides, preferably between 4 and 5000 nucleotides, more preferably between 5 and 1000 nucleotides or between 10 and 500 nucleotides, most preferably between 10 and 200 nucleotides. In a particular embodiment of the invention the oligonucleotide to be modified by the method of the present invention may have more than 50, preferably more than 100 nucleotides. The oligonucleotide according to the invention may by single-stranded or double-stranded DNA or RNA as well as nucleic acid analogs (e.g. PNA, LNA) or chimera of these with DNA and/or RNA.
[0390] Unnatural sugars comprising the dienophiles of the invention can be metabolically incorporated into glycans. For instance, neuraminic acid or N-acetyl mannosamine can be modified to comprise a dienophil of the invention and thus the methods of the invention allow multiple labeling of glycans into which the unnatural sugars comprising the dienophiles of the invention have been incorporated.
[0391] In a further application, the dienophiles of the invention can be functionalized to carry groups (e.g. trimethoxysilyl groups) which can be used for the synthesis of reactive solid phases. As a result, solid phases become accessible which carry both the first and the second dienophile. The applications following therefrom range from the chip technology for oligonucleotides, polypeptides or glycans to catalytic surfaces and solid phase reagents.
[0392] Quantum dots are understood to mean nanoparticles which are composed of compounds such as CdS or CdSe and have special optical properties. Excited by lasers they fluoresce very strongly as a function of their size and therefore are more and more widely used in the diagnostic field especially since they enable the detection of individual molecules. However, a precondition for this is their doping with functional groups, which proceeds via SH groups and permits a subsequent interaction with the molecules to be detected.
[0393] Moreover, gold nanoparticles are considered for electron microscopic investigations of biomolecules on account of their special properties. The anchorage of molecules on the surface is accomplished via SH groups, too.
[0394] The methods of the invention can be used to link molecules to their surface. To this end, SH group-containing dienophile can be produced. Usually, the corresponding disulfides are produced and then the mercapto compound can be prepared therefrom by reduction with dithiothreitol. The disulfides as such can be anchored to gold surfaces. Thus, the dienophiles can be attached to the surface of quantum dots or other metals. For example, antibodies, saccharides or therapeutic agents can be anchored on the surface of the quantum dots for diagnostic or therapeutic purposes.
[0395] Kits of the invention may in particular be used for preparing polypeptides of the invention. To this end, the kits may comprise one or more means for preparing a polypeptide. Such means include, but are not limited to [0396] i) an aminoacyl tRNA synthetase, or a polynucleotide encoding it; [0397] ii) a tRNA as described herein, or a polynucleotide encoding it.
[0398] Both the aminoacyl tRNA synthetase and the tRNA may, for example, be provided in the form of one or more than one expression vector for said aminoacyl tRNA synthetase and corresponding tRNA.
[0399] Such kit may also comprise a polynucleotide encoding a reporter protein, for example an expression vector for, e.g., GFP, wherein the polynucleotide sequence coding for said reporter protein comprises an amber stop codon. Such reporter protein encoding polynucleotide may serve as a positive control to confirm expression of a polypeptide with cyclooctynyl or trans-cyclooctenyl analog group(s).
[0400] Further, such kit may comprise further means for translation of a polynucleotide encoding said polypeptide, for example a translation system, such as E. coli cells, HeLa cells, E. coli extract, wheat germ extract, or rabbit reticulocyte lysate, and instructions for use.
[0401] It will be appreciated by those skilled in the art that the reactions of the invention need to be carried out in reverse order if the reaction of the first tetrazine with the first dienophile is to proceed in the presence of the second tetrazine. Thus, the present invention further relates to methods for forming linkages by cycloaddition reactions, wherein the method comprises reacting a first tetrazine with a first dienophile followed by reacting a second tetrazine with a second dienophile, wherein the reaction of the first tetrazine with the first dienophile proceeds in the presence of the second tetrazine, wherein [0402] (i) the first tetrazine comprises a group of the formula:
##STR00065## [0403] (ii) the first dienophile comprises a cyclooctynyl group of the formula:
##STR00066## [0404] wherein [0405] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sub.bO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0406] R.sup.b, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl [0407] (iii) the second tetrazine comprises a group of the formula:
##STR00067## [0408] wherein [0409] R.sup.3 is C.sub.1-C.sub.3-alkyl; and [0410] (iv) the second dienophile comprises a trans-cyclooctenyl group of the formula:
##STR00068## [0411] wherein [0412] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0413] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl.
[0414] Specific aspects and embodiments for this method can be directly derived from the disclosure herein which can be applied in an analogous manner to this reverse order method. It is noted that the methods of the invention which comprise the reactions in reverse order may be particularly suitable for applications where it is preferred to have the first and the second tetrazine in place prior to reacting them with the dienophiles. This may be the case for certain applications in non-biological systems, e.g. the labeling of surfaces, where there is more freedom to appropriately choose conditions so as to take the properties of the tetrazines into account.
[0415] In summary, the present invention relates in particular to the following embodiments E1 to E110: [0416] E1. A method for forming linkages by cycloaddition reactions, wherein the method comprises reacting a first tetrazine with a first dienophile followed by reacting a second tetrazine with a second dienophile, wherein the reaction of the first tetrazine with the first dienophile proceeds in the presence of the second dienophile, wherein [0417] (i) the first tetrazine comprises a group of the formula:
##STR00069## [0418] wherein [0419] R.sup.3 is C.sub.1-C.sub.3-alkyl; [0420] (ii) the first dienophile comprises a trans-cyclooctenyl group of the formula:
##STR00070## [0421] wherein [0422] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0423] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl, [0424] (iii) the second tetrazine comprises a group of the formula:
##STR00071## and [0425] (iv) the second dienophile comprises a cyclooctynyl group of the formula:
##STR00072## [0426] wherein [0427] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0428] R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl. [0429] E2. The method of embodiment E1, wherein the first tetrazine preferentially reacts with the first dienophile in the presence of the second dienophile. [0430] E3. The method of embodiment E1 or E2, wherein the rate constant k of the first tetrazine with the first dienophile is usually at least 10.sup.2-times higher than the rate constant k of the reaction of the first tetrazine with the second dienophile. [0431] E4. The method of any one of embodiments E1-E3, wherein the rate constant k of the first tetrazine with the first dienophile is allowed to proceed for 30 minutes or less at a temperature of about 37 C. [0432] E5. The method of any one of embodiments E1-E4, wherein the method comprises contacting a target molecule or a target molecule composition with [0433] (i) a first labeling agent comprising a group of the formula:
##STR00073## [0434] wherein [0435] R.sup.3 is C.sub.1-C.sub.3-alkyl; followed by [0436] (ii) a second labeling agent comprising a group of the formula:
##STR00074## [0437] wherein the target molecule comprises [0438] (i) a trans-cyclooctenyl group of the formula:
##STR00075## [0439] wherein [0440] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sub.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0441] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; and [0442] (ii) a cyclooctynyl group of the formula:
##STR00076## [0443] wherein [0444] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sub.bO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.3-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0445] R.sup.b, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl, [0446] wherein the target molecule composition comprises [0447] (i) a first target molecule comprising a trans-cyclooctenyl group of the formula:
##STR00077## [0448] wherein [0449] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0450] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; and [0451] (ii) a second target molecule comprising a cyclooctynyl group of the formula:
##STR00078## [0452] wherein [0453] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0454] R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl. [0455] E6. The method of any one of embodiments E1-E5, wherein the first tetrazine or labeling agent comprises a group of the formula:
##STR00079## [0456] wherein R.sup.3 is C.sub.1-C.sub.3-alkyl and A is 1,4-phenylene or C.sub.1-C.sub.6-alkylene. [0457] E7. The method of any one of embodiments E1-E6, wherein the first tetrazine or labeling agent comprises a group of the formula:
##STR00080## [0458] wherein R.sup.3 is C.sub.1-C.sub.3-alkyl. [0459] E8. The method of any one of embodiments E1-E7, wherein R.sup.3 is methyl. [0460] E9. The method of any one of embodiments E1-E8, wherein the second tetrazine or labeling agent comprises a group of the formula:
##STR00081## [0461] wherein A is 1,4-phenylene or C.sub.1-C.sub.6-alkylene. [0462] E10. The method of any one of embodiments E1-E9, wherein the second tetrazine or labeling agent comprises a group of the formula:
##STR00082## [0463] E11. The method of any one of embodiments E1-E10, wherein the labeling agent comprises a label selected from the group consisting of dyes, radiolabels, MRI-sensitive spin labels, affinity tags, pegylation groups and bioactive compounds. [0464] E12. The method of embodiment E11, wherein the dyes are selected from the group consisting of fluorescent, luminescent, and phosphorescent dyes. [0465] E13. The method of embodiment E11, wherein the dyes are selected from the group consisting of dansyl, coumarin, fluorescein, acridine, rhodamine, silicon-rhodamine, BODIPY, and cyanine dyes. [0466] E14. The method of embodiment E11, wherein the affinity tags are selected from the group consisting of biotin, His-tag, Flag-tag, strep-tag, sugars, lipids, sterols, PEG-linkers, benzylguanines, benzylcytosines, and co-factors. [0467] E15. The method of embodiment E11, wherein the radiolabels are selected from the group consisting of radioactive forms of hydrogen, fluorine, carbon, phosphorous, sulphur, and iodine, including tritium, fluorine-18, carbon-11, carbon-14, phosphorous-32, phosphorous-33, sulphur-33, sulphur-35, iodine-123, and iodine-125. [0468] E16. The method of embodiment E11, wherein the bioactive compounds are selected from cytotoxic compounds; antiviral compounds; biological response modifiers; microtubule affecting agents; hormone modulators; steroidal compounds. [0469] E17. The method of any one of embodiments E1-E16, wherein the trans-cyclooctenyl group is a group of the formula:
##STR00083## [0470] wherein [0471] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0472] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl. [0473] E18. The method of any one of embodiments E17, wherein R.sup.1 is hydrogen. [0474] E19. The method of any one of embodiments E1-E18, wherein the trans-cyclooctenyl group is linked to an amino acid residue. [0475] E20. The method of any one of embodiments E1-E19, wherein the cyclooctynyl group is a group of the formula:
##STR00084## [0476] wherein [0477] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0478] R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl. [0479] E21. The method of any one of embodiments E1-E20, wherein R.sup.2 is hydrogen. [0480] E22. The method of any one of embodiments E1-E21, wherein the cyclooctynyl group is linked to an amino acid residue. [0481] E23. The method of any one of embodiments E1-E22, wherein the trans-cyclooctenyl group has the formula:
##STR00085## [0482] wherein [0483] R.sup.1 is hydrogen; and [0484] the first tetrazine or labeling agent comprises a group of the formula:
##STR00086## [0485] wherein [0486] R.sup.3 is methyl. [0487] E24. The method of any one of embodiments E1-E23, wherein the cyclooctynyl group has the formula:
##STR00087## [0488] wherein [0489] R.sup.2 is hydrogen; and [0490] the second tetrazine or labeling agent comprises a group of the formula:
##STR00088## [0491] E25. The method of any one of embodiments E1-E24, wherein the first tetrazine or labeling agent reacts with the trans-cyclooctenyl groups. [0492] E26. The method of any one of embodiments E1-E25, wherein the first tetrazine or labeling agent is reacted with the first dienophile or the target molecule or target molecule composition under conditions that do not allow the first labeling agent to substantially react with the cyclooctynyl groups. [0493] E27. The method of any one of embodiments E1-E26, wherein the first dienophile or the target molecule or target molecule composition is reacted with the first tetrazine or labeling agent under conditions that allow for substantially all trans-cyclooctenyl groups to react prior to reacting the second dienophile or the target molecule or target molecule composition with the second tetrazine or labeling agent. [0494] E28. The method of any one of embodiments E1-E27, wherein the first dienophile or the target molecule or target molecule composition is reacted with a molar excess of the first tetrazine or labeling agent based on the trans-cyclooctenyl groups. [0495] E29. The method of any one of embodiments E1-E28, wherein unreacted first tetrazine or labeling agent is removed prior to reacting the second dienophile or the target molecule or target molecule composition with the second tetrazine or labeling agent. [0496] E30. The method of any one of embodiments E1-E29, wherein unreacted trans-cyclooctenyl groups are reacted with a quencher prior to reacting the second dienophile or the target molecule or target molecule composition with the second tetrazine or labeling agent. [0497] E31. The method of embodiment E30, wherein the quencher is a compound of the formula:
##STR00089## [0498] or an acid addition salt thereof, wherein [0499] R.sup.3 is C.sub.1-C.sub.3-alkyl; and [0500] R.sup.4 is an organic radical. [0501] E32. The method of embodiment E31, wherein the quencher is (4-(6-methyl-1,2,4,5-tetrazine-3-yl)phenyl)methanamine or an acid addition salt thereof. [0502] E33. The method of any one of embodiments E30-E32, wherein unreacted quencher is removed from the composition prior to reacting the second dienophile or the target molecule or target molecule composition with the second tetrazine or labeling agent. [0503] E34. The method of any one of embodiments E1-E33, wherein the composition is a biological system. [0504] E35. The method of embodiment E34, wherein the biological system is an organism or a biological sample. [0505] E36. The method of embodiment E34 or E35, wherein the biological sample comprises a cell. [0506] E37. The method of any one of embodiments E1-E36, wherein the target molecule is selected from the group consisting of polypeptides, oligonucleotides, glycans, and lipids. [0507] E38. The method of any one of embodiments E1-E37, wherein the trans-cyclooctenyl group is an axial isomer of the group of the formula:
##STR00090## [0508] wherein R.sup.1 is as defined in any one of embodiments E1-E37. [0509] E39. A kit comprising [0510] (i) a first tetrazine comprising a group of the formula:
##STR00091## [0511] wherein [0512] R.sup.3 is C.sub.1-C.sub.3-alkyl; and [0513] (ii) a second tetrazine comprising a group of the formula:
##STR00092## [0514] E40. A kit comprising [0515] (i) a first modifying agent comprising a trans-cyclooctenyl group of the formula:
##STR00093## [0516] wherein [0517] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0518] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; and [0519] (ii) a second modifying agent comprising a cyclooctynyl group of the formula:
##STR00094## [0520] wherein [0521] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0522] R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl. [0523] E41. The kit of embodiment E40, wherein the first modifying agent is an unnatural amino acid or an analogue thereof. [0524] E42. The kit of embodiment E40 or E41, wherein the second modifying agent is an unnatural amino acid or an analogue thereof. [0525] E43. The kit of embodiment E40, wherein the first modifying agent is an unnatural nucleotide or an analogue thereof. [0526] E44. The kit of embodiment E40 or E43, wherein the second modifying agent is an unnatural nucleotide or an analogue thereof. [0527] E45. The kit of embodiment E40, wherein the first modifying agent is an unnatural glycan or an analogue thereof. [0528] E46. The kit of embodiment E40 or E45, wherein the second modifying agent is an unnatural glycan or an analogue thereof. [0529] E47. The kit of any one of embodiments E40-E46, wherein the trans-cyclooctenyl group is an axial isomer of the group of the formula:
##STR00095## [0530] wherein R1 is as defined in any one of embodiments E40-E46. [0531] E48. A cell comprising [0532] (i) a trans-cyclooctenyl group of the formula:
##STR00096## [0533] wherein [0534] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0535] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; [0536] and [0537] (ii) a cyclooctynyl group of the formula:
##STR00097## [0538] wherein [0539] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0540] R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl. [0541] E49. The cell of embodiment E48, which is a mammalian cell. [0542] E50. The cell of embodiment E48 or E49, wherein the trans-cyclooctenyl group is attached to a polypeptide. [0543] E51. The cell of any one of embodiments E48-E50, wherein the cyclooctynyl group is attached to a polypeptide. [0544] E52. The cell of any one of embodiments E48-E51, wherein the cyclooctynyl group and the trans-cyclooctenyl group are attached to the same polypeptide. [0545] E53. The cell of any one of embodiments E48-E51, wherein the cyclooctynyl group is attached to a first polypeptide and the trans-cyclooctenyl group is attached to a second polypeptide, the first and the second polypeptide being different polypeptides. [0546] E54. The cell of any one of embodiments E48-E53, wherein the trans-cyclooctenyl group is an axial isomer of the group of the formula:
##STR00098## [0547] wherein R.sup.1 is as defined in any one of embodiments E48-E53. [0548] E55. A method for preparing the cell of any one of embodiments E48-E53, which comprises [0549] a) providing a cell comprising: [0550] (i) a first aminoacyl tRNA synthetase, or a polynucleotide encoding it; and optionally a second aminoacyl tRNA synthetase, or a polynucleotide encoding it; [0551] (ii) a first tRNA having an anticodon to a first selector codon, or a polynucleotide encoding said tRNA; and optionally a second tRNA having an anticodon to a second selector codon, or a polynucleotide encoding said tRNA; and [0552] (iii) a polynucleotide encoding a target polypeptide and comprising one or more than one first and second selector codon(s); or a first polynucleotide encoding a first target polypeptide and comprising one or more than one first selector codon(s) and a second polynucleotide encoding a second target polypeptide and comprising one or more than one second selector codon(s), [0553] wherein said first aminoacyl tRNA synthetase (i) is capable of acylating the first tRNA (ii) with a first unnatural amino acid or an analogue thereof comprising a trans-cyclooctenyl group of the formula:
##STR00099## [0554] wherein [0555] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sub.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0556] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl, [0557] and with a second unnatural amino acid or an analogue thereof comprising a cyclooctynyl group of the formula:
##STR00100## [0558] wherein [0559] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0560] R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; [0561] or [0562] wherein said first aminoacyl tRNA synthetase (i) is capable of acylating the first tRNA (ii) with a first unnatural amino acid or an analogue thereof comprising a trans-cyclooctenyl group of the formula:
##STR00101## [0563] wherein [0564] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0565] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl, and [0566] said second aminoacyl tRNA synthetase (i) is capable of acylating the second tRNA (ii) with a second unnatural amino acid or an analogue thereof comprising a cyclooctynyl group of the formula:
##STR00102## [0567] wherein [0568] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0569] R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; [0570] b) contacting the cell with the first and the second unnatural amino acid or an analogue thereof; and [0571] c) allowing translation of the polynucleotide(s) (iii) thereby incorporating the first and the second unnatural amino acids or the analogues thereof into the target polypeptide(s) at the position(s) encoded by the selector codon(s). [0572] E56. The method of embodiment E55, wherein the cell is contacted with the first and the second unnatural amino acids or the analogues thereof sequentially. [0573] E57. The method of embodiment E53, which comprises [0574] a) contacting the cell with the first unnatural amino acid or the analogue thereof; and [0575] b) allowing translation of the polynucleotide (iii) thereby incorporating the first unnatural amino acid or the analogue thereof into the target polypeptide at the position(s) encoded by the selector codon(s); [0576] c) contacting the cell with the second unnatural amino acid or the analogue thereof; and [0577] d) allowing translation of the polynucleotide (iii) thereby incorporating the second unnatural amino acid or the analogue thereof into the target polypeptide at the position(s) encoded by the selector codon(s). [0578] E58. The method of any one of embodiments E55-E57, wherein the first unnatural amino acid or the analogue thereof is a compound of the formula:
##STR00103## [0579] wherein: [0580] X.sup.1 has the formula:
##STR00104## [0581] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.6-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0582] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; [0583] X.sup.2 is CH.sub.2, O, S, NH, C(O), OC(O), C(O)O, NHC(O) or C(O)NH; [0584] X.sup.3 is C.sub.1-C.sub.6-alkylene, (CH.sub.2CH.sub.2O).sub.m, (CH.sub.2O).sub.p or a single bond; [0585] X.sup.4 is NH, C(O)NH, NHC(O), NHCH(NH.sub.2), CH(NH.sub.2)NH, NHC(NH)NH, C(O)NHCH(NH.sub.2), C(O)NHC(NH)NH, NHCH(NH.sub.2)C(O) or NHC(NH)NHC(O); [0586] X.sup.5 is (CH.sub.2).sub.n or phenylene-CH.sub.2; [0587] X.sup.6 is hydrogen, C.sub.1-C.sub.6-alkyl, C.sub.1-C.sub.6-alkoxy-C.sub.1-C.sub.2-alkyl, C.sub.2-C.sub.7-alkanoyloxy-C.sub.1-C.sub.2-alkyl or C.sub.2-C.sub.7-alkanoylsulfanyl-C.sub.1-C.sub.2-alkyl; [0588] R.sup.4 is OH or NH.sub.2; [0589] n is an integer from 1 to 4; [0590] m is an integer from 1 to 6; and [0591] p is an integer from 1 to 6, [0592] or an acid or base addition salt thereof. [0593] E59. The method of any one of embodiments E55-E58, wherein the second unnatural amino acid or the analogue thereof is a compound of the formula:
##STR00105## [0594] wherein: [0595] X.sup.1 has the formula:
##STR00106## [0596] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0597] R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; [0598] X.sup.2 is CH.sub.2, O, S, NH, C(O), OC(O), C(O)O, NHC(O) or C(O)NH; [0599] X.sup.3 is C.sub.1-C.sub.6-alkylene, (CH.sub.2CH.sub.2O).sub.m, (CH.sub.2O).sub.p or a single bond; [0600] X.sup.4 is NH, C(O)NH, NHC(O), NHCH(NH.sub.2), CH(NH.sub.2)NH, NHC(NH)NH, C(O)NHCH(NH.sub.2), C(O)NHC(NH)NH, NHCH(NH.sub.2)C(O) or NHC(NH)NHC(O); [0601] X.sup.5 is (CH.sub.2).sub.n or phenylene-CH.sub.2; [0602] X.sup.6 is hydrogen, C.sub.1-C.sub.6-alkyl, C.sub.1-C.sub.6-alkoxy-C.sub.1-C.sub.2-alkyl, C.sub.2-C.sub.7-alkanoyloxy-C.sub.1-C.sub.2-alkyl or C.sub.2-C.sub.7-alkanoylsulfanyl-C.sub.1-C.sub.2-alkyl; [0603] R.sup.4 is OH or NH.sub.2; [0604] n is an integer from 1 to 4; [0605] m is an integer from 1 to 6; and [0606] p is an integer from 1 to 6, [0607] or an acid or base addition salt thereof. [0608] E60. The method of embodiment E58 or E59, wherein X.sup.2 is O. [0609] E61. The method of any one of embodiments E58-E60, wherein X.sup.3 is CH.sub.2CH.sub.2O or a single bond. [0610] E62. The method of any one of embodiments E58-E61, wherein the structural element X.sup.2X.sup.3-comprises from 1 to 6 atoms in the main chain. [0611] E63. The method of any one of embodiments E58-E62, wherein X.sup.4 is NH, C(O)NH, NHCH(NH.sub.2), NHC(NH)NH, C(O)NHCH(NH.sub.2) or C(O)NHC(NH)NH. [0612] E64. The method of any one of embodiments E58-E63, wherein X.sup.4 is C(O)NH. [0613] E65. The method of any one of embodiments E55-E64, wherein n is 3 or 4. [0614] E66. The method of any one of embodiments E58-E65, wherein the structural element X.sup.2X.sup.3X.sup.4(CH.sub.2).sub.n comprises from 5 to 12 atoms in the main chain, such as 6, 7, 8, 9, 10 or 11 atoms in the main chain. [0615] E67. The method of any one of embodiments E58-E66, wherein X.sup.6 is hydrogen, C.sub.1-C.sub.6-alkoxymethyl, C.sub.1-C.sub.6-alkoxyeth-1-yl, C.sub.2-C.sub.7-alkanoyloxymethyl or C.sub.2-C.sub.7-alkanoylsulfanylethyl. [0616] E68. The method of any one of embodiments E58-E66, wherein X.sup.6 is hydrogen. [0617] E69. The method of any one of embodiments E58-E68, wherein the compound has S-configuration with regard to the asymmetric carbon atom carrying R.sup.4. [0618] E70. The method of any one of embodiments E58-E69, wherein X.sup.5CHR.sup.4C(O)OX.sup.6 has formula:
##STR00107## [0619] wherein R.sup.4 and X.sup.6 are as defined in any one of embodiments E58-E69. [0620] E71. The method of any one of embodiments E58-E69, wherein X.sup.5CHR.sup.4C(O)OX.sup.6 has formula:
##STR00108## [0621] wherein R.sup.4 and X.sup.6 are as defined in any one of embodiments E58-E69. [0622] E72. The method of any one of embodiments E58-E69, wherein X.sup.5CHR.sup.4C(O)OX.sup.6 has formula:
##STR00109## [0623] wherein R.sup.4 and X.sup.6 are as defined in any one of embodiments E58-E69. [0624] E73. The method of any one of embodiments E55-E57, wherein the first unnatural amino acid is compound of the formula:
##STR00110## [0625] or an acid or base addition salt thereof. [0626] E74. The method of embodiment E73, wherein the first unnatural amino acid is an axial isomer with respect to its trans-cyclooctenyl group. [0627] E75. The method of any one of embodiments E55-E57, E73 and E74, wherein the second unnatural amino acid is compound of the formula:
##STR00111## [0628] or an acid or base addition salt thereof. [0629] E76. The method of any one of embodiments E55-E75, wherein said translation system is a cell expressing said aminoacyl tRNA synthetase(s). [0630] E77. The method of embodiment E76, wherein said aminoacyl tRNA synthetase is a pyrrolysyl tRNA synthetase. [0631] E78. The method of embodiment E77, wherein said pyrrolysyl tRNA synthetase comprises the amino acid sequence set forth in SEQ ID NO:1 or 2. [0632] E79. The method of any one of embodiments E55-E72 and E75-E78, wherein the trans-cyclooctenyl group is an axial isomer of the group of the formula:
##STR00112## [0633] wherein R.sup.1 is as defined in any one of embodiments E55-E72 and E75-E78. [0634] E80. A polypeptide comprising [0635] (i) a trans-cyclooctenyl group of the formula:
##STR00113## [0636] wherein [0637] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0638] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; [0639] and [0640] (ii) a cyclooctynyl group of the formula:
##STR00114## [0641] wherein [0642] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sub.bO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0643] R.sup.b, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl. [0644] E81. The polypeptide of embodiment E80, comprising a residue of the formula:
##STR00115## [0645] wherein: [0646] X.sup.1 has the formula
##STR00116## [0647] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sub.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0648] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; [0649] X.sup.2 is CH.sub.2, O, S, NH, C(O), OC(O), C(O)O, NHC(O) or C(O)NH; [0650] X.sup.3 is C.sub.1-C.sub.6-alkylene, (CH.sub.2CH.sub.2O).sub.m, (CH.sub.2O).sub.p or a single bond; [0651] X.sup.4 is NH, C(O)NH, NHC(O), NHCH(NH.sub.2), CH(NH.sub.2)NH, NHC(NH)NH, C(O)NHCH(NH.sub.2), C(O)NHC(NH)NH, NHCH(NH.sub.2)C(O) or NHC(NH)NHC(O); [0652] X.sup.5 is (CH.sub.2).sub.n or phenylene-CH.sub.2; [0653] Z.sup.1 is O or NH; [0654] n is an integer from 1 to 4; [0655] m is an integer from 1 to 6; and [0656] p is an integer from 1 to 6, [0657] and a residue of the formula:
##STR00117## [0658] wherein: [0659] X.sup.1 has the formula:
##STR00118## [0660] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.cO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; [0661] R.sup.c, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; [0662] X.sup.2 is CH.sub.2, O, S, NH, C(O), OC(O), C(O)O, NHC(O) or C(O)NH; [0663] X.sup.3 is C.sub.1-C.sub.6-alkylene, (CH.sub.2CH.sub.2O).sub.m, (CH.sub.2O).sub.p or a single bond; [0664] X.sup.4 is NH, C(O)NH, NHC(O), NHCH(NH.sub.2), CH(NH.sub.2)NH, NHC(NH)NH, C(O)NHCH(NH.sub.2), C(O)NHC(NH)NH, NHCH(NH.sub.2)C(O) or NHC(NH)NHC(O); [0665] X.sup.5 is (CH.sub.2).sub.n or phenylene-CH.sub.2; [0666] Z.sup.1 is O or NH; [0667] n is an integer from 1 to 4; [0668] m is an integer from 1 to 6; and [0669] p is an integer from 1 to 6. [0670] E82. The polypeptide of embodiment E81, wherein X.sup.2 is O. [0671] E83. The polypeptide of embodiment E81 or E82, wherein X.sup.3 is CH.sub.2CH.sub.2O or a single bond. [0672] E84. The polypeptide of any one of embodiments E81-E83, wherein the structural element X.sup.2X.sup.3 comprises from 1 to 6 atoms in the main chain. [0673] E85. The polypeptide of any one of embodiments E81-E84, wherein X.sup.4 is NH, C(O)NH, NHCH(NH.sub.2), NHC(NH)NH, C(O)NHCH(NH.sub.2) or C(O)NHC(NH)NH. [0674] E86. The polypeptide of any one of embodiments E81-E84, wherein X.sup.4 is C(O)NH. [0675] E87. The polypeptide of any one of embodiments E81-E86, wherein n is 3 or 4. [0676] E88. The polypeptide of any one of embodiments E81-E87, wherein the structural element X.sup.2X.sup.3X.sup.4(CH.sub.2).sub.n comprises from 5 to 12 atoms in the main chain, such as 6, 7, 8, 9, 10 or 11 atoms in the main chain. [0677] E89. The polypeptide of any one of embodiments E81-E88, wherein the compound has S-configuration with regard to the asymmetric carbon atom carrying Z.sup.1. [0678] E90. The polypeptide of any one of embodiments E80-E89, wherein the trans-cyclooctenyl group is an axial isomer of the group of the formula:
##STR00119## [0679] wherein R.sup.1 is as defined in any one of embodiments E80-E89. [0680] E91. A method for preparing the polypeptide of any one of embodiments E80-E89, the method comprising: [0681] a) providing a translation system comprising: [0682] (i) a first aminoacyl tRNA synthetase, or a polynucleotide encoding it; and optionally a second aminoacyl tRNA synthetase, or a polynucleotide encoding it; [0683] (ii) a first and a second unnatural amino acid or an analogue thereof; [0684] (iii) a first tRNA having an anticodon to a first selector codon, or a polynucleotide encoding said tRNA; and optionally a second tRNA having an anticodon to a second selector codon, or a polynucleotide encoding said tRNA; and [0685] (iv) a polynucleotide encoding a target polypeptide and comprising one or more than one first and second selector codon(s), [0686] wherein said first aminoacyl tRNA synthetase (i) is capable of acylating the first tRNA (iii) with the first unnatural amino acid or the analogue thereof (ii) comprising a trans-cyclooctenyl group of the formula:
##STR00120## [0687] wherein [0688] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0689] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl, and [0690] said second aminoacyl tRNA synthetase (i) is capable of acylating the second tRNA (iii) with the second unnatural amino acid or the analogue thereof (ii) comprising a cyclooctynyl group of the formula:
##STR00121## [0691] wherein [0692] R.sup.2 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sub.bO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sup.dO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0693] R.sup.b, R.sup.d independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl; [0694] b) allowing translation of the polynucleotide (iv) thereby incorporating the first and the second unnatural amino acids or the analogues thereof into the polypeptide at the position(s) encoded by the selector codon(s). [0695] E92. The method of embodiment E91, wherein said translation system is a cell expressing said aminoacyl tRNA synthetase(s). [0696] E93. The method of embodiment E92, wherein said aminoacyl tRNA synthetase is a pyrrolysyl tRNA synthetase. [0697] E94. The method of embodiment E93, wherein said pyrrolysyl tRNA synthetase comprises the amino acid sequence set forth in SEQ ID NO:1 or 2. [0698] E95. The method of any one of embodiments E91-E94, wherein the trans-cyclooctenyl group is an axial isomer of the group of the formula:
##STR00122## [0699] wherein R.sup.1 is as defined in any one of embodiments E91-E94. [0700] E96. An unnatural amino acid comprising a trans-cyclooctenyl group of the formula:
##STR00123## [0701] wherein [0702] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sub.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, Di-(C.sub.1-C.sub.4-alkyl)amino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0703] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl, [0704] or an analogue of the unnatural amino acid. [0705] E97. The unnatural amino acid of embodiment E96, having the formula:
##STR00124## [0706] wherein [0707] X.sup.1 is a trans-cyclooctenyl group of the formula:
##STR00125## [0708] R.sup.1 is hydrogen, halogen, C.sub.1-C.sub.4-alkyl, (R.sup.aO).sub.2P(O)OC.sub.1-C.sub.4-alkyl, (R.sub.bO).sub.2P(O)C.sub.1-C.sub.4-alkyl, CF.sub.3, CN, hydroxyl, C.sub.1-C.sub.4-alkoxy, OCF.sub.3, C.sub.2-C.sub.5-alkenoxy, C.sub.2-C.sub.5-alkanoyloxy, C.sub.1-C.sub.4-alkylaminocarbonyloxy or C.sub.1-C.sub.4-alkylthio, C.sub.1-C.sub.4-alkylamino, C.sub.2-C.sub.5-alkenylamino, C.sub.2-C.sub.5-alkenyl-C.sub.1-C.sub.4-alkyl-amino or Di-(C.sub.2-C.sub.5-alkenyl)amino; and [0709] R.sup.a, R.sup.b independently are hydrogen or C.sub.2-C.sub.5-alkanoyloxymethyl. [0710] X.sup.2 is CH.sub.2, O, S, NH, C(O), OC(O), C(O)O, NHC(O) or C(O)NH; [0711] X.sup.3 is C.sub.1-C.sub.6-alkylene, (CH.sub.2CH.sub.2O).sub.m, (CH.sub.2O).sub.p, or a single bond; [0712] X.sup.4 is NH, C(O)NH, NHC(O), NHCH(NH.sub.2), CH(NH.sub.2)NH, NHC(NH)NH, C(O)NHCH(NH.sub.2), C(O)NHC(NH)NH, NHCH(NH.sub.2)C(O) or NHC(NH)NHC(O); [0713] X.sup.5 is (CH.sub.2).sub.n or phenylene-CH.sub.2; [0714] X.sup.6 is hydrogen, C.sub.1-C.sub.6-alkyl, C.sub.1-C.sub.6-alkoxy-C.sub.1-C.sub.2-alkyl, C.sub.2-C.sub.7-alkanoyloxy-C.sub.1-C.sub.2-alkyl or C.sub.2-C.sub.7-alkanoylsulfanyl-C.sub.1-C.sub.2-alkyl; R.sup.4 is OH or NH.sub.2; [0715] n is an integer from 0 to 4; [0716] m is an integer from 1 to 6; and [0717] p is an integer from 1 to 6, [0718] or an acid or base addition salt thereof. [0719] E98. The unnatural amino acid or salt of embodiment E96 or E97, wherein R.sup.2 is hydrogen. [0720] E99. The unnatural amino acid or salt of any one of embodiments E96-E98, wherein X.sup.2 is O. [0721] E100. The unnatural amino acid or salt of any one of embodiments E96-E99, wherein X.sup.3 is CH.sub.2CH.sub.2O or a single bond. [0722] E101. The unnatural amino acid or salt of any one of embodiments E96-E100, wherein the structural element X.sup.2X.sup.3 comprises from 1 to 6 atoms in the main chain. [0723] E102. The unnatural amino acid or salt of any one of embodiments E96-E101, wherein X.sup.4 is NH, C(O)NH, NHCH(NH.sub.2), NHC(NH)NH, C(O)NHCH(NH.sub.2) or C(O)NHC(NH)NH. [0724] E103. The unnatural amino acid or salt of any one of embodiments E96-E102, wherein X.sup.4 is C(O)NH. [0725] E104. The unnatural amino acid or salt of any one of embodiments E96-E103, wherein X.sup.5 is (CH.sub.2).sub.n wherein n is defined as in any one of embodiments E96-E103. [0726] E105. The compound or salt of any one of embodiments E96-E104, wherein n is 3 or 4. [0727] E106. The unnatural amino acid or salt of any one of embodiments E96-E105, wherein the structural element X.sup.2X.sup.3X.sup.4(CH.sub.2).sub.n comprises from 5 to 12 atoms in the main chain, such as 6, 7, 8, 9, 10 or 11 atoms in the main chain. [0728] E107. The unnatural amino acid or salt of any one of embodiments E96-E106, wherein X.sup.6 is hydrogen, C.sub.1-C.sub.6-alkoxymethyl, C.sub.1-C.sub.6-alkoxyeth-1-yl, C.sub.2-C.sub.7-alkanoyloxymethyl or C.sub.2-C.sub.7-alkanoylsulfanylethyl. [0729] E108. The unnatural amino acid or salt any one of embodiments E96-E106, wherein X.sup.6 is hydrogen. [0730] E109. The unnatural amino acid or salt of any one of embodiments E96-E108 having S-configuration with regard to the asymmetric carbon atom carrying R.sup.4. [0731] E110. The unnatural amino acid or salt of any one of embodiments E96-E109, wherein X.sup.5CHR.sup.4C(O)OX.sup.6 has the formula:
##STR00126## [0732] wherein R.sup.4 and X.sup.6 are as defined in any one of embodiments E96-E109. [0733] E111. The unnatural amino acid or salt of any one of embodiments E96-E109, wherein X.sup.5CHR.sup.4C(O)OX.sup.6 has the formula:
##STR00127## [0734] wherein R.sup.4 and X.sup.6 are as defined in any one of embodiments E96-E109. [0735] E112. The unnatural amino acid or salt of any one of embodiments E96-E109, wherein X.sup.5CHR.sup.4C(O)OX.sup.6 has the formula:
##STR00128## [0736] wherein R.sup.4 and X.sup.6 are as defined in any one of embodiments E96-E109. [0737] E113. The method of any one of embodiments E96-E112, wherein the trans-cyclooctenyl group is an axial isomer of the group of the formula:
##STR00129## [0738] wherein R.sup.1 is as defined in any one of embodiments E96-E112. [0739] E114. The unnatural amino acid or salt of embodiment E96 that is a compound of the formula:
##STR00130## [0740] or an acid or base addition salt thereof. [0741] E115. The unnatural amino acid or base addition salt thereof according to embodiment E114 that is an axial isomer with respect to its trans-cyclooctenyl group. [0742] E116. A method for preparing a polypeptide comprising a trans-cyclooctenyl group, the method comprising: [0743] a) providing a translation system comprising: [0744] (i) an aminoacyl tRNA synthetase, or a polynucleotide encoding it; [0745] (ii) an unnatural amino acid or salt of any one of embodiments E96-E115; [0746] (iii) a tRNA having an anticodon to a selector codon, or a polynucleotide encoding said tRNA; and [0747] (iv) a polynucleotide encoding the target polypeptide and comprising one or more than one selector codon(s), [0748] wherein the aminoacyl tRNA synthetase (i) is capable of acylating the tRNA (iii) with the compound or salt (ii); [0749] b) allowing translation of the polynucleotide (iv) thereby incorporating the compound (ii) into the target polypeptide at the position(s) encoded by the selector codon(s). [0750] E117. The method of embodiment E116, wherein said translation system is a cell expressing said aminoacyl tRNA synthetase. [0751] E118. The method of embodiment E117, wherein said aminoacyl tRNA synthetase is a pyrrolysyl tRNA synthetase. [0752] E119. The method of embodiment E118, wherein said pyrrolysyl tRNA synthetase comprises the amino acid sequence set forth in SEQ ID NO:1 or 2.
EXAMPLES
Preparation Examples
[0753] General Materials and Methods
[0754] Unless otherwise noted, materials for chemical synthesis were obtained from commercial suppliers (Acros, Alfa Aesar, Fox-Chemicals, GL Biochem, Sigma-Aldrich) in the highest purity available and used without further purification. Dry solvents were purchased from Sigma-Aldrich and Acros, stored over molecular sieves, and used as supplied. Solvents used for extraction and chromatography were purchased from Acros, Fisher Scientific, and BDH Prolabo (VWR). Tetrazines and azides of fluorophores were purchased from Life Technologies (Darmstadt, Germany), ATTO-TEC (Siegen, Deutschland), or Jena Bioscience (Jena, Germany). Deuterated solvents were obtained from Deutero GmbH (Kastellaun, Germany). Flash chromatography was carried out using Macherey-Nagel silica gel 60 (0.04-0.063 mm, 230-400 mesh) and solvent systems as described as follows. Thin layer chromatography (TLC) was performed on aluminium-backed, precoated silica gel plates (Merck TLC silica gel 60 F.sub.254) with mixtures (in percent by volume) of C.sub.6H.sub.12/EtOAc, CH.sub.2C.sub.12/MeOH(/AcOH), or acetone/MeOH/H.sub.2O as eluents. Spots were detected by a UV hand lamp at =254 nm or =366 nm or staining with either a) anisaldehyde staining solution (85 ml EtOH, 10 ml AcOH, 5 ml concentrated H.sub.2SO.sub.4, 0.5 ml anisaldehyde), b) KMnO.sub.4 staining solution (3.0 g KMnO.sub.4, 20 g K.sub.2CO.sub.3 in 300 ml 5% aqueous NaOH), or c) ninhydrin staining solution (250 ml EtOH, 1.5 ml AcOH, 5.0 g ninhydrin) and subsequent heat treatment. Reversed phase (RP) C.sub.18 HPLC was performed on a Waters system (Waters 2487 Dual A Absorbance Detector, Waters 1525 Binary HPLC pump) using a gradient of increasing concentration of solvent B (acetonitrile with 0.1% TFA) starting from 100% solvent A (water with 0.1% TFA). NMR spectra were recorded at 25 C. using a Bruker UltraShield Advance 400 (400 MHz, .sup.1H; 100 MHz, .sup.13C) spectrometer. Chemical shifts are referenced to residual protonated solvent signals as internal standard (e.g. CDCl.sub.3: =7.26 (.sup.1H), 77.16 (.sup.13C) ppm).sup.[11]. Assignments of .sup.1H and .sup.13C signals are based on APT and two-dimensional correlation spectroscopy (H,H-COSY) data. Signal multiplicities .sup.3J(H,H) are abbreviated as s (singlet), br (broad singlet), d (doublet), dd (doublet of doublet), dq (doublet of quadruplet), t (triplet), q (quadruplet), dt (doublet of triplet), or m (multiplet). High-resolution (HR) mass spectra were recorded at the University of Heidelberg using electrospray ionization (ESI) mass spectrometry (MS) on a Bruker ApexQe hybrid 9.4 T FT-ICR or using fast atom bombardment (FAB) and electron ionization (EI, electron impact), respectively, on a JEOL JMS-700 magnetic sector mass spectrometer. Products were characterized by NMR .sup.13C) and/or MS/HR MS.
Examples 1: N--((1R,8S,9S)-bicyclo[6.1.0]non-4-yn-9-methyloxy)carbonyl)-
[0755] ##STR00131##
[0756] Unnatural lysine-based amino acid 1 was purchased from Sirius Fine Chemicals SiChem (Bremen, Germany). Compound 1 was used as a mixture of the endoand exo-isomer. Compound 1 is also referred to as BCN.
Example 2: N--((trans-Cyclooct-4-en-1-yloxy)carbonyl)-
[0757] ##STR00132##
[0758] Compound 2 was synthesized as described in WO 2012/051885 and T. Plass, S. Milles, C. Koehler, J. Szymanski, R. Mueller, M. Wiessler, C. Schultz, E. A. Lemke, Angew Chem Int Ed Engl 2012, 51, 4166-4170. Compound 2 is also referred to as TCO.
Example 3: N--((trans-Cyclooct-2-en-1-yloxy)carbonyl)-
[0759] Scheme 51 shows the synthesis of trans-cyclooct-2-ene-functionalized lysine derivative 3 (also termed as TCO*).
##STR00133## ##STR00134##
##STR00135##
[0760] Literature-known 8,8-dibromobicyclo[5.1.0]octane 11 was synthesized starting from commercially available cis-cycloheptene as reported earlier (A. B. Neef, C. Schultz, Angewandte Chemie 2009, 48, 1498-1500) and used without chromatographic purification.
[0761] .sup.1H-NMR (CDCl.sub.3) =2.32-2.21 (m, 2H), 1.94-1.78 (m, 3H), 1.77-1.66 (m, 2H), 1.45-1.30 (m, 2H), 1.27-1.10 (m, 3H) ppm.
##STR00136##
[0762] 2-bromocyclooct-2-en-1-ol 12 known from literature was synthesized according to previously described protocols (a) C. B. Reese, A. Shaw, J Chem Soc Perk T 1 1975, 2422-2434; b) H. J. J. Loozen, J. W. Dehaan, H. M. Buck, Journal of Organic Chemistry 1977, 42, 418-422). Briefly, to a stirred solution of 8,8-dibromobicyclo[5.1.0]octane 11 (1.0 eq.) in acetone (0.5 M) and water (15.0 eq.). AgClO.sub.4 (2.0 eq.) was added in small portions at rt over 30 min and stirred for additional 60 min. 1 M HCl was added until the formation of white precipitate stopped. The mixture was filtered and the residue washed with EtOAc. The filtrate was separated and the aqueous layer extracted with EtOAc (3). The combined organic fractions were washed with brine, dried over Na.sub.2SO.sub.4, filtered over silica gel, and concentrated. The crude product was purified by flash chromatography (20% EtOAc in C.sub.6H.sub.12) to yield 12 as a pale yellow liquid.
[0763] R.sub.f (20% EtOAc in C.sub.6H.sub.12)=0.4.
[0764] .sup.1H-NMR (CDCl.sub.3) =6.12 (dd, .sup.3J(H,H)=11.7, 4.2 Hz, 1H), 4.19 (dd, .sup.3J(H,H)=10.4, 5.3 Hz, 1H), 2.68 (dq, .sup.3J(H,H)=11.9, 5.5 Hz, 1H), 2.36-2.29 (m, 1H), 2.23-2.10 (m, 2H), 2.08-2.00 (m, 2H), 1.94-1.67 (m, 4H), 1.56-1.44 (m, 1H), 1.31-1.22 (m, 1H) ppm.
##STR00137##
[0765] To a solution of the 2-bromocyclooct-2-en-1-ol 12 (1.0 eq., 10.24 g, 49.7 mmol) in dry Et.sub.2O (0.7 M, 71 ml) at 78 C. .sup.tBuLi (3.2 eq., 159 mmol, 99.4 ml of a 1.6 M solution of .sup.tBuLi in pentane) was added dropwise under Ar over 1 h. After complete addition the mixture was stirred at 78 C. for another 10 min and was then allowed to warm to 20 C. over 3 h. The solution was quenched by addition of sat. aq. NaHCO.sub.3 solution and stirred for 1 h at rt. The layers were separated and the organic layer was extracted with EtOAc (3). Next, the combined organic fractions were washed with brine, dried over Na.sub.2SO.sub.4, and concentrated. The crude product was purified by FC (20% EtOAc in C.sub.6H.sub.12) to yield compound 13 (4.37 g, 34.6 mmol, 70% yield) as a colorless liquid.
[0766] R.sub.f (20% EtOAc in C.sub.6H.sub.12)=0.4.
[0767] .sup.1H-NMR (CDCl.sub.3) =5.71-5.50 (m, 2H), 4.70-4.60 (m, 0.3H), 4.32-4.22 (m, 0.7H), 2.45-2.35 (m, 0.7H), 2.20-2.04 (m, 1.3H), 2.02-1.34 (m, 6H), 1.10-1.03 (m, 0.6H), 0.94-0.84 (m, 0.7H), 0.81-0.70 (m, 0.7H) ppm (two isomers). .sup.13C-NMR (CDCl.sub.3) =135.6, 134.9, 132.0, 128.7, 76.9, 69.5, 44.3, 38.9, 35.4, 29.1, 29.1, 27.7, 26.3, 25.9, 23.7 ppm (two isomers).
[0768] HR MS (E1 pos.) m/z: calcd for C.sub.8H.sub.14O [M+e.sup.].sup.+: 126.1045, meas.: 126.1040.
##STR00138##
[0769] Compound 14 was prepared starting from its cis-precursor 13 according to a previously described procedure (a) N. K. Devaraj, R. Upadhyay, J. B. Haun, S. A. Hilderbrand, R. Weissleder, Angewandte Chemie 2009, 48, 7013-7016; b) M. Royzen, G. P. Yap, J. M. Fox, Journal of the American Chemical Society 2008, 130, 3760-3761). Photoisomerization with active removal of the trans-isomer was carried out in a Rayonet RPR-100 UV reactor (Southern New England Ultraviolet Company, Branford, Conn., USA) for 8 h at rt (temperature inside the reactor was about 30 C.). Briefly, the UV reactor was charged with 13 (1.0 eq., 1.89 g, 14.9 mmol), methyl benzoate (1.5 eq., 3.51 g, 2.80 ml, 22.4 mmol), and solvent (20% C.sub.6H.sub.12 in Et.sub.2O, 1000 ml). After work-up, a yellow oil (0.94 g, 7.42 mmol, 50%) was obtained that was used in the next step without further purification. NMR analysis proofed the presence of two isomers in the ratio of 1.0:1.1.
[0770] R.sub.f (20% EtOAc in C.sub.6H.sub.12)=0.4.
[0771] .sup.1H-NMR (CDCl.sub.3) =6.00-5.91 (m, 0.5H), 5.71-5.62 (m, 0.5H), 5.61-5.51 (m, 1H), 4.62 (br, 0.5H), 4.27 (dt, .sup.3J(H,H)=9.5, 5.5 Hz, 0.5H), 2.52-2.45 (m, 0.5H), 2.43-2.36 (m, 0.5H), 2.20-2.12 (m, 0.5H), 2.08-1.92 (m, 2H), 1.90-1.79 (m, 1H), 1.77-1.66 (m, 2H), 1.64-1.37 (m, 2.5H), 1.16-1.06 (m, 0.5H), 0.94-0.84 (m, 0.5), 0.82-0.71 (m, 1H) ppm.
[0772] .sup.13C-NMR (CDCl.sub.3) =135.5, 135.1, 132.0, 130.5, 76.8, 71.2, 44.3, 43.2, 36.1, 35.8, 35.8, 35.4, 29.2, 29.0, 27.6, 23.1 ppm.
[0773] HR MS (E1 pos.) m/z: calcd for C.sub.8H.sub.14O [M+e.sup.].sup.+: 126.1045, meas.: 126.1044.
##STR00139##
[0774] To a stirred solution of compound 14 (1.0 eq., 0.94 g, 7.42 mmol) in CH.sub.2Cl.sub.2 (20 ml) was added pyridine (2.5 eq., 1.50 ml, 18.6 mmol) under Ar. A solution of 4-nitrophenyl chloroformate (1.1 eq., 1.65 g, 8.17 mmol) in CH.sub.2Cl.sub.2 (20 ml) was added at rt and the resulting reaction mixture stirred for 2 h. A sat. aq. solution of NH.sub.4C.sub.1 (50 ml) was used to stop the reaction. After phase separation, the aqueous layer was extracted with CH.sub.2Cl.sub.2 (2). The combined organic layers were washed with a sat. aq. NaCl solution, dried over Na.sub.2SO.sub.4, and concentrated. The crude product was purified by FC (5% EtOAc in C.sub.6H.sub.12) to yield compound 15 (1.63 g, 5.59 mmol, 75%) as a pale yellow wax (T.sub.m=74.6-76.8 C.).
[0775] R.sub.f (10% EtOAc in C.sub.6H.sub.12)=0.4.
[0776] .sup.1H-NMR (CDCl.sub.3) =8.31-8.25 (m, 2H), 7.43-7.37 (m, 2H), 6.03-5.94 (m, 0.5H), 5.90-5.80 (m, 0.5H), 5.66 (dd, .sup.3J(H,H)=16.2, 9.5 Hz, 0.5H), 5.56 (dd, .sup.3J(H,H)=16.5, 2.2 Hz, 0.5H), 5.44 (br, 0.5H), 5.17 (dt, .sup.3J(H,H)=10.1, 5.6 Hz, 0.5H), 2.56-2.44 (m, 1H), 2.38-2.30 (m, 0.5H), 2.26-2.18 (m, 0.5H), 2.12-1.85 (m, 3H), 1.82-1.65 (m, 1.5H), 1.61-1.39 (m, 1.5H), 1.23-1.12 (m, 0.5H), 0.98-0.78 (m, 1.5H) ppm.
[0777] .sup.13C-NMR (CDCl.sub.3) =155.6, 151.9, 151.7, 145.3, 134.8, 133.2, 130.1, 129.3, 125.3, 125.3, 121.8, 83.3, 78.8, 40.5, 40.4, 36.0, 35.9, 35.6, 35.5, 28.9, 28.8, 27.3, 24.0 ppm.
[0778] HR MS (FAB pos.) m/z: calcd for C.sub.15H.sub.17NO.sub.5 [M+e.sup.].sup.+: 291.1107, meas.: 291.1116.
##STR00140##
[0779] Fmoc-Lys-OH*HCl (2.0 eq., 4.45 g, 11.0 mmol) was dissolved in DIEA (3.0 eq., 2.87 ml, 16.5 mmol) and anhydrous DMSO (0.2 M, 27 ml) under Ar. Next, a clear solution of compound 15 (1.0 eq., 1.60 g, 5.49 mmol) in anhydrous DMSO (0.2 M, 27 ml) was added dropwise at rt and under Ar over a period of 2 h. The reaction mixture was stirred o/n at rt. H.sub.2O (50 ml) and EtOAc (150 ml) were added and the pH of the aqueous layer was adjusted to 1-3 with conc. HCl. The phases were separated and the aqueous layer was extracted with EtOAc (3). The combined organic layers were washed with brine (2) and dried over Na.sub.2SO.sub.4. All volatile components were evaporated under reduced pressure and the crude product was purified by FC (10% MeOH in CH.sub.2C.sub.12) to yield compound 16 (1.45 g, 2.79 mmol, 51%) as a white foam.
[0780] R.sub.f (8% MeOH and 2% AcOH in CH.sub.2C.sub.12)=0.5.
[0781] .sup.1H-NMR (MeOD) =7.79 (d, .sup.3J(H,H)=7.5 Hz, 2H), 7.67 (t, .sup.3J(H,H)=7.2 Hz, 2H), 7.39 (t, .sup.3J(H,H)=7.5 Hz, 2H), 7.31 (t, .sup.3J(H,H)=7.3 Hz, 2H), 5.88-5.64 (m, 1H), 5.58-5.43 (m, 1H), 5.22 (br, 0.5H), (4.98 (dt, .sup.3J(H,H)=9.9, 5.2 Hz, 0.5H), 4.37-4.32 (m, 2H), 4.22 (t, .sup.3J(H,H)=6.7 Hz, 1H), 4.13-4.04 (m, 1H), 3.09 (q, .sup.3J(H,H)=5.4 Hz, 2H), 2.45-2.34 (m, 1H), 2.16-2.08 (m, 0.5H), 2.05-1.34 (m, 10.5H), 1.19-1.07 (m, 0.5H), 0.92-0.75 (m, 1.5H) ppm.
[0782] .sup.13C-NMR (MeOD) =157.2, 144.0, 143.8, 143.8, 141.2, 132.4, 131.8, 131.5, 131.2, 127.4, 126.8, 124.9, 119.5, 78.5, 73.7, 66.5, 54.7, 47.1, 40.8, 40.3, 40.1, 40.0, 35.6, 35.4, 35.2, 34.9, 31.3, 29.1, 28.7, 28.6, 27.0, 23.8, 27.8, 27.7 ppm.
[0783] HR MS (ESI neg.) m/z: calcd for C.sub.30H.sub.35N.sub.2O.sub.6 [MH].sup.: 519.25006, meas.: 519.25127.
##STR00141##
[0784] Compound 16 (1.0 eq., 1.43 g, 2.75 mmol) was dissolved in 20% piperidine in CH.sub.2Cl.sub.2 (40 ml v/v) and stirred for 30 min at rt. After addition of H.sub.2O (50 ml), all volatile components were removed under reduced pressure and high vacuum. The crude product was purified via FC (acetone:MeOH:H.sub.2O 85:10:5 v/v/v to wash off all impurities followed by 65:25:10 v/v/v to elute the product) on silica gel to yield compound 3 (0.81 g, 2.70 mmol, 98%) as a white powder. Purified 2 decomposed under heating (starting at 180 C.). Compound 3 is also referred to as TCO* in this publication. Compound 3 was a mix of axial isomers of TCO* (herein referred to as compound 3a or TCO*.sup.a) and equatorial isomers of TCO* (herein referred to as compound 3b or TCO*.sup.e).
[0785] R.sub.f (acetone:MeOH:H.sub.2O 65:25:10 v/v/v)=0.6.
[0786] .sup.1H-NMR (DMSO-d.sub.6) =5.77-5.64 (m, 1H), 5.58-5.44 (m, 1H), 5.15 (br, 0.5H), 4.95 (dt, .sup.3J(H,H)=9.5, 5.5 Hz, 0.5H), 3.51 (t, .sup.3J(H,H)=5.7 Hz, 1H), 2.94 (q, .sup.3J(H,H)=5.4 Hz, 2H), 2.41-2.29 (m, 1H), 2.13-2.04 (m, 0.5H), 1.97-1.84 (m, 2.5H), 1.79-1.24 (m, 8H), 1.05-0.94 (m, 0.5H), 0.88-0.71 (m, 1.5H) ppm.
[0787] .sup.13C-NMR (DMSO-d.sub.6) =171.6, 155.9, 132.9, 132.7, 131.1, 77.9, 73.0, 53.3, 43.9, 41.4, 40.5, 36.1, 35.7, 35.3, 30.6, 29.5, 28.9, 27.3, 24.2, 22.6, 22.4, 22.2 ppm.
[0788] HR MS (ESI neg.) m/z: calcd for C.sub.16H.sub.26N.sub.2O.sub.4 [MH].sup.: 297.18198, meas.: 297.18285.
Example 3a: Preparation of Axial and of Equatorial N--((trans-Cyclooct-2-en-1-yloxy)carbonyl)-
[0789] After UV irradiation (cf. step d in scheme 51 above) the axial and the equatorial isomers of compound 14 (trans-cyclooct-2-en-1-ol) were separated by flash chromatography on silica (eluent: EtOAc/cyclohexane at a ratio of 1:4; Rf TCO*.sup.a=0.38, Rf TCO*.sup.e=0.27), and then separately coupled to lysine (as described for compound 14 in Example 3 above) so as to provide the axial isomer 3a and the equatorial isomer 3b of compound 3.
Example 4: N--((trans-Cyclooct-3-en-1-yloxy)carbonyl)-
[0790] Scheme S2 shows the synthesis of trans-cyclooct-2-ene-functionalized lysine derivative 4 (also termed as TCO.sup.#).
##STR00142## ##STR00143##
##STR00144##
[0791] Literature-known compound 17 was synthesized starting from commercially available 1,3-cyclooctadiene according to a previously described protocol (K. Zhang, M. A. Lackey, J. Cui, G. N. Tew, Journal of the American Chemical Society 2011, 133, 4140-4148). Briefly, a solution of 3-chloroperbenzoic acid (70-77%, 0.8 eq., 86.75 g, 327 mmol) in CHCl.sub.3 (1100 ml) was added dropwise over 2 h to 1,3-cyclooctadiene (1.0 eq., 50.63 g, 468 mmol) with stirring. The reaction mixture was stirred at rt for 15 h. After filtration to remove 3-chlorobenzoic acid, the filtrate was successively washed with solutions of sodium bisulfite (10% in H.sub.2O), NaHCO.sub.3 (10% in H.sub.2O), and brine. Next, the organic layer was dried over Na.sub.2SO.sub.4 and concentrated. FC (5% EtOAc in C.sub.6H.sub.12) yielded 17 (48.28 g, 389 mmol, 83%) as a clear liquid.
[0792] R.sub.f (10% EtOAc in C.sub.6H.sub.12)=0.3.
[0793] .sup.1H-NMR (CDCl.sub.3) =5.81-5.74 (m, 1H), 5.62-5.56 (m, 1H), 3.48-3.44 (m, 1H), 3.15-3.09 (m, 1H), 2.37-2.26 (m, 1H), 2.14-1.97 (m, 2H), 1.83-1.60 (m, 3H), 1.53-1.37 (m, 2H) ppm.
##STR00145##
[0794] A solution of LiAlH.sub.4 (0.5 eq., 81.5 ml of a 1.0 M solution in THF, 81.5 mmol) was added dropwise at 0 C. and under Ar to a stirred solution of 17 (1.0 eq., 20.23 g, 163 mmol) in THF (1.0
[0795] R.sub.f (20% EtOAc in C.sub.6H.sub.12)=0.4.
[0796] .sup.1H-NMR (CDCl.sub.3) =5.76-5.60 (m, 2H), 3.84-3.77 (m, 1H), 2.36 (dd, .sup.3J(H,H)=7.5, 6.3 Hz, 2H), 2.28-2.18 (m, 1H), 2.14-2.05 (m, 1H), 1.87-1.78 (m, 1H), 1.73-1.63 (m, 1H), 1.61-1.43 (m, 4H), 1.40-1.30 (m, 1H) ppm.
[0797] .sup.13C-NMR (CDCl.sub.3) =132.4, 125.0, 72.2, 35.1, 34.0, 28.3, 25.7, 21.2 ppm.
##STR00146##
[0798] Compound 19 was prepared starting from its cis-precursor 18 according to a previously described procedure (a) N. K. Devaraj, R. Upadhyay, J. B. Haun, S. A. Hilderbrand, R. Weissleder, Angewandte Chemie 2009, 48, 7013-7016; b) M. Royzen, G. P. Yap, J. M. Fox, Journal of the American Chemical Society 2008, 130, 3760-3761). Photoisomerization with active removal of the trans-isomer was carried out in a Rayonet RPR-100 UV reactor (Southern New England Ultraviolet Company, Branford, Conn., USA) for 10 h at rt (temperature inside the reactor was around 30 C.). Briefly, the UV reactor was charged with 19 (1.0 eq., 6.17 g, 48.9 mmol), methyl benzoate (1.5 eq., 9.20 ml, 73.3 mmol), and solvent (30% C.sub.6H.sub.12 in Et.sub.2O, 1000 ml). After work-up and FC (20% EtOAc in C.sub.6H.sub.12) a clear oil (4.25 g, 33.7 mmol, 69%) was obtained. NMR analysis showed the presence of two isomers in the ratio of 1.0:1.2.
[0799] R.sub.f (20% EtOAc in C.sub.6H.sub.12)=0.4.
[0800] .sup.1H-NMR (CDCl.sub.3) =5.85-5.76 (m, 0.45H), 5.61-5.44 (m, 1H), 5.32-5.23 (m, 0.55H), 4.44-4.38 (m, 0.45H), 3.74-3.65 (m, 0.55H), 2.87-2.79 (m, 0.55H), 2.48-2.34 (m, 1.45H), 2.21-2.12 (m, 0.45H), 2.10-1.78 (m, 3.56H), 1.56-1.29 (m, 2.9H), 1.24-1.06 (m, 1.55H), 0.81-0.71 (m, 0.55H) ppm.
##STR00147##
[0801] To a stirred solution of compound 19 (1.0 eq., 4.25 g, 33.7 mmol) in CH.sub.2C.sub.12 (44 ml) pyridine (2.5 eq., 6.81 ml, 84.2 mmol) was added under Ar. A solution of 4-nitrophenyl chloroformate (1.1 eq., 7.47 g, 37.1 mmol) in CH.sub.2Cl.sub.2 (30 ml) was added at rt and the resulting reaction mixture stirred for 2 h. A sat. aq. solution of NH.sub.4Cl was used to stop the reaction. After phase separation, the aqueous layer was extracted with CH.sub.2Cl.sub.2 (2). The combined organic layers were washed with brine, dried over Na.sub.2SO.sub.4, and concentrated. The crude product was purified by FC (5% EtOAc in C.sub.6H.sub.12) to yield compound 20 (8.51 g, 29.2 mol, 87%) as a pale yellow wax (T.sub.m=75.3-78.7 C.).
[0802] R.sub.f (5% EtOAc in C.sub.6H.sub.12)=0.2.
[0803] .sup.1H-NMR (CDCl.sub.3) =8.31-8.25 (m, 2H), 7.42-7.35 (m, 2H), 5.80-5.55 (m, 1.5H), 5.35-5.30 (m, 0.5H), 5.28-5.19 (m, 0.5H), 4.72-4.63 (m, 0.5H), 3.04-2.96 (m, 0.5H), 2.74-2.65 (m, 0.5H), 2.53-2.19 (m, 2.5H), 2.11-1.83 (m, 3H), 1.61-1.47 (m, 1H), 1.42-1.12 (m, 2H), 0.89-0.77 (m, 0.5H) ppm.
[0804] .sup.13C-NMR (CDCl.sub.3) =155.7, 155.6, 152.0, 151.8, 145.3, 138.5, 137.0, 128.1, 125.3, 125.1, 121.8, 121.8, 85.9, 83.5, 40.5, 39.8, 36.0, 35.6, 35.6, 35.5, 32.7, 30.6, 23.5, 20.4 ppm.
[0805] HR MS (FAB pos.) m/z: calcd for C.sub.15H.sub.18NO.sub.5 [m+H].sup.+: 291.1185, meas.: 292.1189.
##STR00148##
[0806] Fmoc-Lys-OH*HCl (1.5 eq., 5.43 g, 20.0 mmol) was dissolved in DIEA (3.0 eq., 6.97 ml, 40.0 mmol) and anhydrous DMSO (0.2 M, 67 ml) under Ar. Next, a clear solution of compound 20 (1.0 eq., 3.88 g, 13.3 mmol) in anhydrous DMSO (0.5 M, 27 ml) was added dropwise at rt and under Ar over a period of 2 h. The reaction mixture was stirred o/n at rt. H.sub.2O (80 ml) and EtOAc (170 ml) were added. The pH of the aqueous layer was adjusted to 1-3 with conc. HCl. The phases were separated and the aqueous layer was extracted with EtOAc (3). The combined organic layers were washed with brine (2) and dried over Na.sub.2SO.sub.4. All volatile components were evaporated under reduced pressure and the crude product was purified by FC (10% MeOH in CH.sub.2C.sub.12) to yield compound 21 (4.79 g, 9.20 mmol, 71%) as a white foam.
[0807] R.sub.f (8% MeOH and 2% AcOH in CH.sub.2C.sub.12)=0.5.
[0808] .sup.1H-NMR (CDCl.sub.3) =7.76 (d, .sup.3J(H,H)=7.4 Hz, 2H), 7.64-7.55 (m, 2H), 7.40 (t, .sup.3J(H,H)=7.3 Hz, 2H), 7.31 (t, .sup.3J(H,H)=7.3 Hz, 2H), 5.73-5.44 (m, 2.5H), 5.27-5.18 (m, 0.5H), 4.52-4.33 (m, 3H), 4.27-4.18 (m, 1H), 3.24-3.12 (m, 2H), 2.60-0.73 (m, 14H) ppm.
[0809] HR MS (ESI neg.) m/z: calcd for C.sub.30H.sub.35N.sub.2O.sub.6 [MH].sup.: 519.25006, meas.: 519.25114; calcd for C.sub.30H.sub.35N.sub.2O.sub.7 [MOH].sup.: 535.24498, meas.: 535.24600.
##STR00149##
[0810] Compound 21 (1.0 eq., 4.16 g, 7.98 mmol) was dissolved in 20% piperidine in CH.sub.2Cl.sub.2 (25 ml) and stirred for 30 min at rt. After addition of H.sub.2O (30 ml), all volatile components were removed under reduced pressure and high vacuum. The crude product was purified via FC (acetone:MeOH:H.sub.2O 85:10:5 v/v/v to wash off all impurities followed by 65:25:10 v/v/v to elute the product) on silica gel to yield compound 4 (2.02 g, 6.78 mmol, 85%) as a white powder. Purified 3 decomposed under heating (starting at 180 C.). Compound 4 is also referred to as TCO.sup.# in this publication.
[0811] R.sub.f (acetone:MeOH:H.sub.2O 65:25:10 v/v/v)=0.6.
[0812] .sup.1H-NMR (MeOD) =5.76-5.47 (m, 1.5H), 5.31-5.21 (m, 0.5H), 5.13 (br, 0.5H), 4.57-4.49 (m, 0.5H), 3.54-3.47 (m, 1H), 3.15-3.06 (m, 4H), 2.82-2.73 (m, 0.5H), 2.48-2.34 (m, 1.5H), 2.23-2.12 (m, 1H), 2.06-1.75 (m, 4.5H), 1.74-1.67 (m, 0.5H), 1.57-1.37 (m, 4H), 1.27-1.06 (m, 1.5H), 0.89-0.78 (m, 0.5H) ppm.
[0813] .sup.13C-NMR (MeOD) =150.7, 149.2, 137.4, 135.7, 132.3, 54.7, 45.5, 44.4, 40.8, 39.8, 39.7, 37.6, 35.0, 32.7, 30.5, 29.2, 24.0, 23.3, 22.5, 22.1 ppm.
[0814] HR MS (ESI neg.) m/z: calcd for C.sub.15H.sub.25N.sub.2O.sub.4 [MH].sup.: 297.18198, meas.: 297.18287.
Examples 5: N--((Cyclooct-2-yn-1-yloxy)carbonyl)-
[0815] ##STR00150##
[0816] Unnatural lysine-based amino acid 5 was purchased from Sirius Fine Chemicals SiChem (Bremen, Germany). Compound 5 can also be synthesized as described in WO 2012/051885. Compound 5 is also referred to as SCO.
Examples 6: Propargyl-Lysine
[0817] ##STR00151##
[0818] Unnatural lysine-based amino acid 6 was purchased from Sirius Fine Chemicals SiChem (Bremen, Germany). Compound 6 is also referred to as PrK.
[0819] MS (ESI) m/z: calculated for C.sub.15H.sub.27N.sub.2O.sub.4 [M+H].sup.+: 299.19653, measured: 299.19656.
BIOLOGICAL EXAMPLES
Example A: Recombinant Protein Expression in E. coli
[0820] The previously reported plasmids pEvolv tRNA.sup.Pyl/PyIRS.sup.AF and pBAD GFP.sup.Y39TAG were used to express GFP.sup.TAG.fwdarw.UAA, genetically encoding the respective unnatural amino acid (UAA) (a) T. Plass, S. Milles, C. Koehler, C. Schultz, E. A. Lemke, Angew Chem Int Ed Engl 2011, 50, 3878-3881; b) T. Plass, S. Milles, C. Koehler, J. Szymanski, R. Mueller, M. Wiessler, C. Schultz, E. A. Lemke, Angew Chem Int Ed Engl 2012, 51, 4166-4170). Briefly, plasmids were co-transformed into E. coli Top10 (Invitrogen) and grown at 37 C. in the presence of ampicillin and chloramphenicol. For small scale expression, 0.5 ml of an overnight culture was used to inoculate 50 ml Terrific Broth (TB) medium in a shake flask. Cultures grew within 2 h to an OD of 0.2-0.3 at which point a compound selected from compounds 1-5 (
[0821] Compound 3 as well as its pure axial and equatorial isomers 3a and 3b showed very similar incorporation rates, were more readily incorporated than compound 2 by about a factor of two (
Example B: In Vitro Cross-Reactivity and Orthogonality of SPAAC and SPIEDAC Reactions
[0822] GFP.sup.TAG.fwdarw.UAA was expressed in E. coli as described above in presence of 1, 3, and 5. Subsequently, purified protein (Ni-NTA, see above) was labeled with either Cy3-azide (45 M, 6 h, 37 C.), Me-Tet-Cy3 or H-Tet-Atto532 (both 15 M, 20 min, 37 C.). All three dyes were obtained from Jena Bioscience. After labeling, samples were directly loaded on a SDS-PAGE gel and analyzed for fluorescence on a commercially available gel documentation system (Alpha Innotech, CA) with UV excitation and ethidium-bromide detection filter settings. Afterwards, the gel was stained with Coomassie (
Example C: Constructs for Expression of Insulin Receptor (IR) in Mammalian Cells
[0823] The IR.sup.TAG amber mutant was generated through PCR-based site-directed mutagenesis of a pEGFPN1_IR plasmid, creating a TAG mutation at K676 in the IR gene. This position was picked based on the available IR structure (PDB: 2DTG) (N. M. McKern, M. C. Lawrence, V. A. Streltsov, M. Z. Lou, T. E. Adams, G. O. Lovrecz, T. C. Elleman, K. M. Richards, J. D. Bentley, P. A. Pilling, P. A. Hoyne, K. A. Cartledge, T. M. Pham, J. L. Lewis, S. E. Sankovich, V. Stoichevska, E. Da Silva, C. P. Robinson, M. J. Frenkel, L. G. Sparrow, R. T. Fernley, V. C. Epa, C. W. Ward, Nature 2006, 443, 218-221) The resulting pEGFPN1_IR.sup.TAG was used in
Example D: Cell Culture and Transfections with IR Constructs
[0824] For insulin receptor experiments, HEK293T cells were maintained in Dulbecco's Modified Eagle's MediumDMEM (high glucose4.5 g/l) supplemented with 10% FBS (Sigma), 1%
Example E: Pulse-Chase Labeling of IR
[0825] In the morning following transfections, medium was exchanged to serum-free high glucose DMEM supplemented with 10% FBS and Pen-Strep, in which all the subsequent washing and labeling steps were also performed. The transfected cells were then labeled according to the following protocols. In case of SPIEDAC-SPAAC combination, cells were incubated with 10 M solution of sulfo-Cy5-azide (Lumiprobe, Hannover, Germany) dissolved in serum-free DMEM for 10 min at 37 C., washed with fresh medium, incubated with 5 M solution of sulfonated-Cy3-Me-Tet (6-Methyl-Tetrazine-Sulfo-Cy3, Jena Bioscience, Jena, Germany) for 10 min at 37 C. and then washed with fresh medium and kept at 37 C. before fixation. For further details regarding SPAAC labeling, please see Example M.
[0826] In case of SPIEDAC with seSPIEDAC combination, cells were first incubated with the 5 m solution of sulfonated Me-Tet-Cy5 (6-Methyl-Tetrazine-Sulfo-Cy5, Jena Bioscience) dissolved in serum-free DMEM for 10 min at 37 C. After the Me-Tet-Cy5 labeling, cells were rinsed with fresh medium. To quench any unreacted TCO* (see
Example F: Microscopy of IR
[0827] After fixation, cells were taken to the microscope, either on the same day or maximum 1-2 days later. This was especially important for the SRM imaging. All confocal imaging was performed on a commercial LEICA TCS SP8 microscope equipped with HCX PL APO 100/1.40 OIL objective (Mannheim, Germany). For images comparing different levels of labeling, same acquisition settings were used for all the experiments. Cells were imaged in PBS and single plane images were acquired with a pixel size of 114 nm. All SRM was performed on a commercial Leica GSD microscope, equipped with Leica HCX PL APO 100/NA 1.47 Oil CORR TIRF PIFOC objective and Cy3 and Cy5 filter sets. For SRM, we used an imaging buffer containing oxygen scavenging system (glucose oxidase with catalase GLOX) in presence of thiols (10 mm 2-aminoethanethiol, MEA) made according to a published protocol (G. T. Dempsey, J. C. Vaughan, K. H. Chen, M. Bates, X. Zhuang, Nature methods 2011, 8, 1027-1036). The buffer was prepared fresh and exchanged after 1-3 h of imaging or earlier in case of insufficient blinking events. All the images were acquired in epifluorescent mode, first in the Cy5 and then in Atto532 channel. For the Cy5 channel, a 642 nm Laser and for the Atto532 channel a 532 nm Laser respectively were used for pumping and imaging the blinking with exposure times of 10 ms. To facilitate the return of fluorophores to the ground state, a 405 nm laser was used at very low intensities.
Example G: Constructs for VLP Expression in Mammalian Cells
[0828] M1 (A/Hong Kong/68) and HA (A/Aichi/2/68) in the eukaryotic expression vector pCAGGS was obtained from Mikhail Matrosovich (Marburg). The HA sequence was cloned into the pCI expression vector and based on the available structure of HA (PDB: 1E08) (X. Morelli, M. Czjzek, C. E. Hatchikian, O. Bornet, J. C. Fontecilla-Camps, N. P. Palma, J. J. Moura, F. Guerlesquin, The Journal of biological chemistry 2000, 275, 23204-23210) and information about sequence conservation between different flu variants, different amino acid positions were selected and substituted by the amber TAG codon with standard site-directed mutagenesis. In this study the amino acid substitution HA342 was used as it showed good UAA incorporation and labeling efficiency.
Example H: Cell Culture and Sample Preparation for VLPs
[0829] HEK293T were maintained in DMEM (low glucose, pyruvate, no glutamine, no phenol red, 11880-028 GIBCO/Invitrogen) supplemented with 10% fetal calf serum (FCS) and
[0830] For fluorescence and SRM, cells were seeded on thoroughly cleaned high precision cover slips (=18 mm, thickness=0.170.005 mm, CarlRoth) in 6-well tissue culture dishes. Cells were grown to 70-80% confluence before being transfected with the appropriate plasmids at 1:1 ratios with jetPrime (PEQLAB) or 239Expresso (Excellgen) transfection reagent according to the manufacturers instructions. At 1 h post-transfection 250 m SCO, PrK or TCO* was added to the growth medium. If production of filamentous virus particles was induced by co-transfection of HA and M1, exogenous bacterial neuraminidase was addedduring both UAA pulsesin addition to the UAA at a concentration of 100 mU/ml (Clostridium perfrigens; Sigma-Aldrich, Frankfurt, Germany) in order to avoid immediate attachment of generated filaments to the producer cells via binding of HA to sialic acid. After 10 h the UAA containing medium was exchanged to growth medium with the second UAA and incubated for 18 h. After this chase the cells were incubated for 1 h in normal growth medium before labeling the incorporated UAA with tetrazine modified dyes at 37 C. for 20-30 min. First, TCO* was labeled with Me-Tet-Cy5 (Jena Bioscience, 5 m final concentration), the non-reacted TCO* was then quenched with 50 m Me-Tet-NH.sub.2 for 5 min and SCO was labeled with H-Tet-Atto532 (Jena Bioscience, 5 m final concentration). Before mounting the cover slides on depression slides (1.2-1.5 mm, Menzel-Glaeser/Thermo-Scientific) the cells were once washed with normal growth medium for 30 min and subsequently fixed with 2% PFA in PBS for 10 min. For SRM, same acquisition settings as described above for IR were used. For confocal microscopy, the sample was mounted with Pro-Long Gold (Invitrogen) on a standard objective slide and cured for 24 h at room temperature before it was imaged with a Leica TCS SP8 microscope.
Example I: Image Analysis
[0831] Confocal images were processed using Fiji ImageJ (J. Schindelin, I. Arganda-Carreras, E. Frise, V. Kaynig, M. Longair, T. Pietzsch, S. Preibisch, C. Rueden, S. Saalfeld, B. Schmid, J. Y. Tinevez, D. J. White, V. Hartenstein, K. Eliceiri, P. Tomancak, A. Cardona, Nature methods 2012, 9, 676-682). For IR images, a median filter with a radius of two pixels was applied. ImageJ was also used to adjust contrast and brightness (only linear changes were applied) for display of both IR and VLP images (
[0832] SRM processing was performed in IgorPro (WaveMetrics, Portland Oreg., USA). ImageJ was used for linear contrast-brightness adjustments for display. Molecules from SRM movies were localized in each frame using the Localizer package (Dr. Peter Dedecker, Katholieke University, Louvain, Belgium) for IgorPro. Individual molecules were fitted with a Gaussian to determine the (x,y) position of each blinking event of a single molecule. Localized positions were then analyzed by Fourier ring correlation to estimate the resolution of the data set, which was then used to determine the spot deviation in reconstructed SRM images (a) N. Banterle, K. H. Bui, E. A. Lemke, M. Beck, J Struct Biol 2013; b) R. P. Nieuwenhuizen, K. A. Lidke, M. Bates, D. L. Puig, D. Grunwald, S. Stallinga, B. Rieger, Nature methods 2013, 10, 557-562). Final images were displayed with an 88 nm.sup.2 pixel size
Example J: Determination of Labeling Kinetics Via a FRET Assay
[0833] For observation of labeling kinetics, GFP.sup.TAG.fwdarw.UAA was expressed with 1-5 (for structures of UAAs see
[0834] Resulting reaction kinetics were fit with a simple monoexponential model according to
GFP.sup.UAA.fwdarw.(t)=A.sub.0(1exp(kBt)),
where A.sub.0 corresponds to the amplitude of the fit and is proportional to the initial GFP concentration, and B corresponds to the concentration of dye within the reaction. The rate constant k of the reaction is obtained from the fit under the assumption of constant B during the reaction (which is valid due to the large dye excess). Approximate rate constants under these experimental conditions measured at 20 C. are reported in Table 1 below and were obtained by fitting the FRET traces from three independent experiments for each UAA (different protein expressions, different days) and subsequent averaging.
TABLE-US-00003 TABLE 1 Reaction kinetics under tested experimental conditions Me-Tet-Cy3 H-Tet-Atto532 [M.sup.1 .Math. s.sup.1] [M.sup.1 .Math. s.sup.1] GFP.sup.TAG.fwdarw.1 480 190 16000 2000 GFP.sup.TAG.fwdarw.2 2240 340 21000 4000 GFP.sup.TAG.fwdarw.3 1240 250 13000 2000 GFP.sup.TAG.fwdarw.4 3880 470 10000 1200 GFP.sup.TAG.fwdarw.5 not determined 670 180
[0835] It is noted that Me-Tet-Cy3 derivatives are compared with H-Tet-Atto532 derivatives (due to commercial availability). However, it can be expected that the dye differences do not contribute markedly to the different observed reactivities.
[0836] All UAAs show reduced reactivity with Me-Tet than with H-Tet. However, the drop in reactivity is more dramatic for alkynes than for alkenes, leading to basically no detectable reactivity of SCO under the tested experimental conditions.
[0837] It is also noted that that the substituents of the tetrazines used in this work suggest that a strong inverse electron demand is not a major driving force for the speed of the described SPIEDAC reactions.
[0838] As shown in
Example J1: Reactivity of GFP.SUP.TAG3., GFP.SUP.TAG3a .and GFP.SUP.TAG3b .with Cy5-Labeled Tetrazine Derivatives
[0839] GFP.sup.TAG.fwdarw.UAA was expressed in E. coli as described above in presence of 1, 3, 3a, 3b and 5. Subsequently, purified protein (Ni-NTA, see above) was labeled with H-Tet-Cy5 (Tetrazine-C5 from Jena Bioscience) or Me-Tet-Cy5 (6-Methyl-Tetrazine-Sulfo-Cy5 from Jena Bioscience) as described below. Kinetic experiments were performed using stopped-flow spectroscopy (SFM-3000, Bio-Logic). The kinetic of the labeling reaction was monitored by detecting the increase in fluorescence of Cy5 when covalently linked to the UAA of the respective GFP due to Fosters Resonance Energy Transfer (FRET) of the GFP-chromophore (serving as a Donor, D) to the fluorophore Cy5 (Acceptor, A). In the spectra, this is visible by an increase of Cy5-fluorescence over time (
[0840] FRET efficiency curves were not analyzed due to photophysical effects occurring in the GFP signal in the presence of an excess of Cy5. The measurements were done under pseudo-first order conditions in PBS pH 7.4 using 100 nM purified GFP.sup.TAG.fwdarw.x protein and an excess (10-40 M) of Cy5 dye (H-Tet-Cy5 or Me-Tet-Cy5). Data analysis was performed by fitting Cy5 fluorescence data to the inverse mono-exponential function F(t)=A.Math.(1e.sup.Kobs.Math.t)+. The
[0841] Akaike Information criterion was used to determine the time-point of the curve until which a mono-exponential function fitted better than a bi-exponential function. The different observed reaction rate constants k.sub.obs determined based on the fits were plotted against the concentration of Cy5 dye and the reaction constants K were obtained by doing a linear fit forcing it to 0 (
TABLE-US-00004 TABLE 2 Reaction constants K for labeling of GFP.sup.TAG->UAA with tetrazine-Cy5 dyes Reaction with H-Tet-Cy5 Reaction with Me-Tet-Cy5 K [M.sup.1 .Math. s.sup.1] K [M.sup.1 .Math. s.sup.1] GFP.sup.TAG.fwdarw.1 80400 1100 390 2 GFP.sup.TAG.fwdarw.3 30500 600 700 10 .sup.GFP.sup.TAG.fwdarw.3a 36500 400 680 10 .sup.GFP.sup.TAG.fwdarw.3b 12100 200 not determined* GFP.sup.TAG.fwdarw.5 1180 80 not determined* *not determined because reaction rate was too low to obtain reliable values
Example K: Determination of the Long Time Stability of the Covalent Bond in Labeled Proteins
[0842] To proof the stability of the formed covalent bonds between TCO* and the dye-Tet in a SPIEDAC reaction, long time FRET experiments were carried out. Basically, the same FRET assay as described above was used to test whether the fluorophores stays covalently attached to the protein or not over a period of 36 h. 200 nM GFP.sup.TAG.fwdarw.3 were separately reacted with 2 M Me-Tet-Cy3 at room temperature (rt) and the ratio between D and A fluorophore was followed over time. No data support a potential loss of the small molecule fluorophore over time (
[0843] In another experiment, Ni-NTA-purified GFP.sup.TAG.fwdarw.UAA (1-4) was labeled with Me-Tet-Cy3 (2 h, 37 C.). Excess Me-Tet-Cy3 was filtered off (2 h). 200 nM labeled GFP.sup.TAG.fwdarw.UAA+Cy3 (with 1-4) were followed over time by FRET as described above. Note that the first data point was taken approximately 4 h after adding the tetrazine to the proteins. No significant changes between the FRET ratio measured after 4 h and after 76 h were observed (
Example L: Determination of the Stability of the Different Trans-Cyclooctenyl Isomers Via .SUP.1.H-NMR
[0844] Previous studies showed the degradation of compounds with high ring strain, such as 1 and 4, in the presence of thiols (a) B. R. Varga, M. Kelley, K. Hegyi, S. Beni, P. Kele, Chemistry 2012, 18, 822-828; b) R. van Geel, G. J. Pruijn, F. L. van Delft, W. C. Boelens, Bioconjugate chemistry 2012, 23, 392-398). For example for trans-cyclooctenes, isomerization of the trans-form to its corresponding but by orders of magnitude less reactive cis-form has been observed when treated with
[0845] .sup.1H-NMR analysis showed that UAAs 1-5 dissolved in either 0.1 M NaOD in D20 or DMSO-d6 were stable at room temperature (rt), 37 C., as well as at 60 C. over a period of 72 h (data not shown). Therefore, 0.1 M NaOH (for E. coli cells) and DMSO (for mammalian cells) are well suited solvents for the preparation of stock solutions for biological experiments. However, stock solutions were stored at 20 C. and thaw 30 min before usage.
[0846] .sup.1H-NMR analysis showed that UAAs 2-4 dissolved in 1 deuterated PBS (dPBS) in D.sub.2O (pH 7.4) mixed with 1,4-dioxane-d8 (v/v 1:1) were stable at room temperature (rt), 37 C., as well as at 60 C. over a period of 72 h (
[0847] In order to test for stability against thiols, UAAs 2-4 were separately combined with two equivalents of cysteamine hydrochloride in dPBS/dioxane-d8 (v/v 1:1), NMR tubes were tightly sealed, and incubated at rt, 37 C., or 60 C. .sup.1H-NMR spectra were measured after 24 h of incubation and later time points (in case of 3). The .sup.1H-NMR data showed that all UAAs degrade over time in the presence of cysteamine in a temperature-dependent manner (
[0848] To show that also 3 (TCO*) can be completely converted to its cis-form in the presence of thiols at 60 C., incubation at 60 C. was continued and .sup.1H-NMR spectra were measured beyond the time points indicated in
[0849] Further, the axial TCO* isomer 3a was found to be more stable, i.e. less prone to decay (mostly by conversion into cis-form) than the equatorial TCO* isomer 3b. The half-life of 3a was determined to be close to two days at 60 C. and 34d at 37 C., while 3b decayed under these conditions within a few hours (
Example M: SPAAC Labeling of Insulin Receptor with/without Endocytosis Blocker
[0850] HEK293T cells were transfected with pEGFPN1_IR.sup.K676TAG and pCMV tRNA.sup.Pyl/PyIRS.sup.AF plasmids as described above. After the transfections, cells were incubated overnight with BCN. On the following morning, cells were rinsed with serum-free DMEM. 2 h later labeling was performed. As shown in
[0851] In a further experiment, the transfected cells were incubated with 250 M of 3, 3a or 3b for 8h. On the following day, the cells were labelled with 5 M H-Tet-Cy5 or Me-Tet-Cy5 for 10 min at 37 C. in DMEM. After changing the medium for fresh DMEM, the cells were incubated at 37 C. for another 1-2h. Afterwards, the cells were fixed and analyzed via confocal microscopy (see above for details). As shown in
Example N: IR Dual-Color Labeling Controls
[0852] HEK293T cells were transfected with pEGFPN1_IR.sup.TAG and pCMV tRNA.sup.Pyl/PyIRS.sup.AF plasmid as described above. After transfections, cells were first pulsed with UAA1 and then chased with UAA2 (see
[0853] Since TCO* can react with both Me-Tet (applied during the 1.sup.st labeling step) and H-Tet (applied during the 2.sup.nd labeling step), it was needed to exclude the possibility that if not all TCO* reacts off in the first step, it could get labeled by H-Tet in the second step. Full consumption of TCO* in the first labeling step is a requirement for an orthogonal dual labeling design, as otherwise it would yield an ambiguous result. Such a phenomenon could e.g. occur, if cells express high concentration of TCO*, so that it does not get fully consumed in the first labeling reaction with Me-Tet. To test for this, the following control experiments were performed:
[0854] After transfections, cells were first pulsed with UAA1(TCO*) and then chased with UAA2(PrK), see
[0855] Dual-color labeling after pulsing the cells with UAA1 (TCO*) and chasing them with UAA2 (BCN) was also performed. Me-Tet-Cy5 (5 M in serum-free DMEM, 10 min at 37 C.) targeting TCO* labeling was followed by quenching as described above. In the second labeling step, H-Tet-Atto532 targeting BCN was applied. As shown in
[0856] Also shown in
[0857] To test for the possibility of non-specific labeling in
Example O: Mass Spectrometry Validation
[0858] For mass spectrometric validation corresponding to protein shown (compare
TABLE-US-00005 TABLE3 Massspectrometricvalidation offormationofGFP.sup.TAG.fwdarw.UAA Mono- Peptide isotopic Match sequence mass(calc) mass, (X=amber Protein [Da] found[Da] TAGsite) GFP.sup.TAG.fwdarw.3 2075.07864 2075.07944 FSVSGEGEGD ATXGKLTLK GFP.sup.TAG.fwdarw.4 2075.07864 2075.07724 FSVSGEGEGD ATXGKLTLK GFP.sup.TAG.fwdarw.5 2073.06300 2073.06368 FSVSGEGEGD ATXGKLTLK
[0859] Test expressions with a GFP.sup.TAG reporter construct, which only gives full length expression and hence fluorescence if the amber mutation at position Y39 is suppressed, show that TCO* and TCO.sup.# are accepted by the tRNA.sup.Pyl/PyIRS.sup.AF pair approximately three times better than the original cyclooct-4-ene TCO (
[0860] The tRNA.sup.Pyl/PyIRS.sup.AF mutant pair permits encoding TCO* and BCN which can undergo SPIEDAC and SPAAC reactions, respectively (
[0861] Then the pulse-chase experiment as outlined in
[0862] The cyclooctynyl-lysine derivative (SCO) (
[0863] Furthermore, it is shown in
[0864] Since Cy5 and Atto532 are commonly used for localization-based SRM, dual-color SRM measurements were performed (M. Heilemann, S. van de Linde, M. Schuttpelz, R. Kasper, B. Seefeldt, A. Mukherjee, P. Tinnefeld, M. Sauer, Angew Chem Int Ed Engl 2008, 47, 6172-6176; M. Bates, B. Huang, G. T. Dempsey, X. Zhuang, Science 2007, 317, 1749-1753; J. Foiling, M. Bossi, H. Bock, R. Medda, C. A. Wurm, B. Hein, S. Jakobs, C. Eggeling, S. W. Hell, Nature methods 2008, 5, 943-945). The confocal (
[0865] Notably, clustering has also been observed for other growth factor receptors using SRM studies (S. Wilmes, M. Staufenbiel, D. Lisse, C. P. Richter, O. Beutel, K. B. Busch, S. T. Hess, J. Piehler, Angew Chem Int Ed Engl 2012, 51, 4868-4871)
[0866] To demonstrate the generality of the approach of the invention, labeled virus-like particles (VLPs) were assembled by the co-expression of influenza virus proteins hemagglutinin (HA) and matrix protein 1 (M1) (for review see J. S. Rossman, R. A. Lamb, Virology 2011, 411, 229-236). Viral genomes are compact and often contain overlapping genes, which makes inserting genetically-encoded tags into viral proteins a particular challenge. We generated a TAG mutant of HA and expressed it together with M1 and the tRNA.sup.Pyl/PyIRS.sup.AF in HEK293T cells. We repeated the pulse-chase protocol using TCO*, SCO and labeled with Me-Tet-Cy5 and H-Tet-Atto532. As shown in
[0867] In summary, the genetically encoded SPIEDAC reaction was tuned into two mutually orthogonal SPIEDAC reactions which can be used to perform rapid labeling of proteins in living cells. This expands the existing repertoire of biocompatible click labeling methods using an expanded genetic code from SPIEDAC & SPAAC to SPIEDAC & seSPIEDAC & SPAAC. The two rapid SPIEDAC reactions allowed SRM compatible dual-color labeling experiments in mammalian cells, while the slow reactivity of SPAAC seemed insufficient for rapid high contrast labeling of live cells.
[0868] TCO* is an improved TCO with higher biostability and incorporation efficiency. TCO* reacts rapidly with both tested tetrazines (Me-Tet, H-Tet), while BCN has comparatively much more reduced reactivity towards Me-Tet. Under the performed experimental conditions, SCO only reacted with H-Tet and not Me-Tet. Dual-color labeling was achieved using a promiscuous tRNA/RS pair and a pulse-chase approach. The labeling step is done in living cells, creating new possibilities for studying protein fate with very high resolution. Combining the dual-color labeling of the invention with genetic switches, such as temperature sensitive mutants and promoter control, could enable distinct proteins to be labeled. However, the labeling chemistries of the present invention are general and can also be directly applied to specific encoding via two distinct codons.
[0869] The small size of the UAA tag, in comparison with other genetically-encoded fluorescent tags, is a major advantage especially for studies of complex protein assemblies such as IR and HA, where multiple functional interactions with other proteins and lipids might be influenced by larger tags in unpredictable ways. In particular, viral genomes are frequently extremely compact and do not tolerate large modifications. The need for changing only a single codon, thus dramatically increases the chance of finding permissive sites that do not alter protein function.
[0870] Since the techniques of the present invention rely on the generic ligation mechanism of two tuned SPIEDAC reactions, it will thus be compatible with any dye developments suitable for live intracellular labeling and also applicable to a broad range of other disciplines for installing tags, such as MRI and PET studies.
Example P: .SUP.1.H-NMR Assay to Prove the Orthogonality of seSPIEDAC and SPIEDAC Reactions
[0871] Stock solutions of the dienophiles in DMSO-d6 with a final concentration of 10 mm were prepared. A 20 mm stock of the formic acid salt of (4-(6-methyl-1,2,4,5-tetrazine-3-yl)phenyl)methanamine (termed as methyl tetrazine or Me-Tet-NH.sub.2) in DMSO-d6 was prepared, too. As control experiment, either the dienophile or the diene (Me-Tet-NH.sub.2) were mixed with DMSO-d6 1:1 (v/v; 760 l total volume) to yield a final concentration of 5 mm or 10 mm, respectively, in the NMR tube. To confirm whether a dienophile reacts with the diene (Me-Tet-NH.sub.2) or not, the corresponding stocks were mixed 1:1 (v/v; 760 l total volume) to yield a final concentration of 5 mm of the dienophile and 10 mm of the diene in the NMR tube. The samples were incubated for 10 min at room temperature before analyzed by .sup.1H-NMR.
[0872] Comparison of the .sup.1H-NMR spectra of the dienophile and the diene with the reaction mixture showed that the trans-cyclooct-2-ene had completely reacted with the tetrazine 10 min after mixing the trans-cyclooct-2-ene with the tetrazine (
[0873] Conversely, neither the 5-norbornene-2-ol (endo- and exo-isomer) nor the cyclooctyne moieties reacted at all with the tetrazine (indicated by the black dots in
[0874] The reaction with bicyclononyne moiety (two isomers), however, took place, although it had not yet completely reacted with the tetrazine 10 min after mixing (upper spectrum of
[0875] Similar experiments carried out in 1 deuterated PBS (dPBS) in D.sub.2O (pH 7.4) mixed with 1,4-dioxane-d8 (v/v 1:1) gave the same results.
ABBREVIATIONS
[0876] AcF=p-acetylphenylalanine [0877] AcOH=acetic acid [0878] aq.=aqueous [0879] Ar=argon/inert gas atmosphere [0880] BCN=N--((1R,8S,9S)-bicyclo[6.1.0]non-4-yn-9-methyloxy)carbonyl)-L-lysine (