Modulation of lipid metabolism for protein production

10655111 ยท 2020-05-19

Assignee

Inventors

Cpc classification

International classification

Abstract

The present disclosure features methods and compositions for modulating lipid metabolism to achieve improved production and quality of recombinant products, such as next generation biologics. Modulation of lipid metabolism as described herein includes, for example, introducing a lipid metabolism modulator described herein to a cell or a cell-free system. Also encompassed by the present disclosure are engineered cells with improved production capacity and improved product quality, methods for engineering such cells, and preparations and mixtures comprising the products from such cells.

Claims

1. A cell comprising: a first exogenous nucleic acid encoding a first lipid metabolism modulator (LMM), wherein the first LMM comprises a sterol regulatory element-binding transcription factor 1 (SREBF1) or a functional fragment or isoform thereof; and an exogenous nucleic acid encoding a recombinant polypeptide, wherein the first exogenous nucleic acid is integrated into the chromosomal genome of the cell; and wherein the cell is a CHO-derived cell.

2. The cell of claim 1, wherein the cell is selected from the group consisting of CHO-K1, CHOK1SV, Potelligent CHOK1SV (FUT8-KO), CHO GS-KO, Exceed (CHOK1SV GS-KO), CHO-S, CHO DG44, CHO DXB11, and CHOZN.

3. The cell of claim 1, wherein the first LMM modulates the expression of the recombinant polypeptide.

4. The cell of claim 3, wherein the first LMM alters the expression of a component involved in a lipid metabolism pathway.

5. The cell of claim 1, further comprising a second exogenous nucleic acid encoding a second LMM, wherein the second exogenous nucleic acid encoding a second LMM is integrated into the chromosomal genome of the cell.

6. The cell of claim 5, wherein the second LMM is selected from a transcription regulator that mediates the expression of a lipid metabolism gene product selected from SREBF2 (sterol regulatory element-binding transcription factor 2), PRMT5, FAS (fatty acid synthase), ACC (acetyl-coA carboxylase), ACL (ATP citrate lyase), DGAT (diglyceride acyltransferase), GPAT (glycerol 3-phosphate acyltransferase), LPL (lipoprotein lipase), AGPAT (1-actyl-sn-glycerol-3-phosphate O-acyltransferase), AGNPR (acyl/alkylglycerone-phosphate reductase), CCT (phosphocholine cytidyltransferase), CDS (phosphatidate cytidylyltransferase), CEPT (diacylglycerol choline/ethanolaminephosphotransferase), CERT (ceramide transfer protein), CGT (N-acylsphingosine galactosyltransferase), CPT (diacylglycerol cholinephosphotransferase), CLS (cardiolipin synthase), CRD (ceramidase), GNPAT (glycerone-phosphate O-acyltransferase), KDSR (3-ketosphinganine reductase), LCS (polypeptide N-acetylgalactosaminyltransferase), PAP (phosphatidic acid phosphatase), PEMT (phosphatidylethanolamine N-methyltransferase), PGP (phosphatidylglycerophosphatase), PGS (CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase), PIS (CDP-diacylglycerol-inositol 3-phosphatidyltransferase), PSD (phosphatidylserine decarboxylase), PSS1 (phosphatidylserine synthase 1), PSS2 (phosphatidylserine synthase 2), SGMS (ceramide choline phosphotransferase), SNAT (sphingosine N-acyltransferase), SPK (sphinganine kinase), SPP (sphingosine-1-phosphate phosphatase), SPT (serine Co-palmitoyltransferase), PED (plasmanylethanolamine desaturase), S1P (site-1 protease), S2P (site-2 protease), SCAP (SREBF cleavage-activating protein), INSIG1 (insulin induced gene 1), INSIG2 (insulin induced gene 2), HMG CoA reductase (2-hydroxy-3-methylgulatryl-CoA reductase), a PPAR receptor, or a functional fragment or analog of any of the same.

7. The cell of claim 5, wherein the second LMM is selected from: SCD1 (stearoyl CoA desaturase-1), SCD2 (stearoyl CoA desaturase-2), SCD3 (stearoyl CoA desaturase-3), SCD4 (stearoyl CoA desaturase-4), SCD5 (Steoryl CoA desaturase-5).

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 is a series of immunofluorescent images obtained of Flp-In CHO engineered cell pools, separately transfected with either a control expression vector (Ctrl), or ones encoding SCD1 fused at its C-terminus to a V5 epitope tag (SCD1-V5) or SREBF1 fused at its C-terminus to a V5 epitope tag (SREBF1-V5). The pools were imaged with an anti-V5 primary antibody and a secondary anti-mouse FITC antibody (middle images) as well as DAPI (left images) and an overlay of both the left and middle images (right hand column) is shown. Images were generated using a Leica Confocal Microscope.

(2) FIG. 2 shows a series of immunofluorescent images obtained of CHOK1SV glutamine synthetase knock-out (GS-KO) cell pools, transfected with either a control expression vector (Ctrl), or ones encoding SCD1-V5 or SREBF1-V5. The pools were imaged with an anti-V5 primary and anti-mouse secondary TRITC antibody (middle images) as well as DAPI (left images) and an overlay of both the left and middle images (right hand column) is also shown. Images were generated using a Leica Confocal Microscope.

(3) FIGS. 3A, 3B, and 3C show the determination of exogenous SCD1-V5 and SREBF1-V5 expressed in CHO Flp-In cell pools following transient transfection with a plasmid encoding a difficult to express recombinant Fc fusion protein (also referred to as Fc fusion protein or FP) (FIG. 3A) or eGFP (FIG. 3B). FIG. 3C shows determination of exogenous V5-tagged SCD1 and SREBF1 expressed in untransfected stably expressing CHO Flp-In cell pools. Western blot analysis was performed on cell lysates obtained 96 hours following electroporation with the Fc fusion protein, as well as the cell pool solely expressing the indicated V5-tagged lipid metabolism modulator (LMM), SCD1 or SREBF1. Anti-V5 primary antibody and anti-mouse HRP conjugated secondary antibody was used to detect expression of the V5-tagged LMM and anti--actin or anti L7a (as indicated) followed by exposure with anti-mouse and anti-rabbit HRP conjugated secondary antibodies respectively were used as loading controls for LMM detection.

(4) FIG. 4 shows the viable cell concentration, as determined using a ViCell cell counter, of the CHO Flp-In cell pools engineered to stably overexpress the LMM SCD1-V5 and SREBF1-V5 post transfection with eGFP-containing construct JB3.3 (n=2).

(5) FIGS. 5A and 5B show the cell culture concentration and culture viability at 24, 48, 72, and 96 hours after transfection of control, SCD1-V5, SREBF1-V5 and SREBF410-V5 over-expressing CHOK1SV GS-KO cell pools with an eGFP containing plasmid. FIG. 5A shows cell concentration. The lower columns represent viable cell concentration whilst the whole column represents the total concentration of cells; lower error bars represent the standard deviation of viable cells whilst upper error bars represent that of the total cell concentration.

(6) FIG. 5B shows culture viability based on the data outlined in FIG. 5A. Error bars represent standard deviation. Statistical significance was calculated using two-tailed T-test compared to the control values of the particular time points: *Viable cell concentration significance using two-tailed T-test [p<0.05]. Total cell concentration significance using two-tailed T-tests [p<0.05] (n=3).

(7) FIGS. 6A, 6B and 6C show flow cytometry generated data using a FACSCalibur instrument (BD Biosciences). Median (FIG. 6A), geometric mean (FIG. 6B) and arithmetic mean (FIG. 6C) values were acquired at 24, 48, 72 and 96 hours post transfection with an eGFP containing plasmid where samples were taken from control, SCD1-V5 or SREBF1-V5 overexpressing Flp-In CHO cell pools (n=2).

(8) FIGS. 7A, 7B and 7C show flow cytometry generated data using a FACSCalibur instrument (BD Biosciences). Median (FIG. 7A), geometric mean (FIG. 7B) values were acquired at 24, 48, 72 and 96 hours post transfection with an eGFP containing plasmid where samples were taken from control, SCD1-V5, SREBF1-V5 or SREBF410-V5 overexpressing CHOK1SV GS-KO derived cells. FIG. 7C shows the total fluorescence per ml of culture as calculated by multiplying the measured arithmetic mean fluorescence by total cell concentration (10.sup.6/ml). Error bars indicate standard deviation. Statistical significance was calculated using a two-tailed T-test compared to the control values of the particular time points (n=3). *Indicates statistically significant values [p<0.05]. Data was generated using FACSCalibur (BD Biosciences).

(9) FIGS. 8A and 8B show antibody A production in CHO Flp-In cells stably overexpressing SCD1-V5 and SREBF1-V5 after transient transfection of a nucleic acid construct encoding antibody A heavy and light chains. FIG. 8A is a western blot showing bands corresponding to antibody A, as detected by using an anti-heavy chain primary antibody and an anti-rabbit HRP conjugated secondary antibody. FIG. 8B shows the average fold change in antibody production in the LMM engineered cell pools compared to values generated from the control cell pool as determined by Protein A HPLC.

(10) FIGS. 9A and 9B show the production of an Fc fusion protein in CHO Flp-In cell pools stably overexpressing SCD1-V5 and SREBF1-V5 after transient transfection of a nucleic acid construct encoding the fusion protein. FIG. 9A is a western blot showing the bands representative of the Fc fusion protein as detected by using an anti-heavy chain primary antibody and an anti-rabbit HRP conjugated secondary antibody. FIG. 9B shows the average fold change in the Fc fusion protein production in the LMM engineered cell pools compared to values generated from the control cell pool as determined by Protein A HPLC.

(11) FIGS. 10A and 10B show the production of a well expressed antibody A in CHO GSKO cell pools stably overexpressing SCD1-V5, SREBF1-V5 and SREBF410-V5 after transient transfection of a nucleic acid construct encoding antibody A heavy and light chains at 48, 72 and 96 h post transfection and in a control, Null CHOK1SV GS-KO cell pool (a control pool of cells generated using an empty plasmid to express selection GS gene only, no LMM agents). FIG. 10A is a western blot showing the bands representative of antibody A as detected by using an anti-heavy chain primary antibody and an anti-rabbit HRP conjugated secondary antibody. FIG. 10B shows the average fold change in antibody production in the LMM engineered cell pools compared to values generated in the control cell pool as determined by Protein A HPLC.

(12) FIGS. 11A and 11B shows the relative production of a difficult to express Fc fusion protein in CHOK1SV GS-KO cell pools stably overexpressing SCD1-V5 and SREBF1-V5 or in a control cell pool after transient transfection of a nucleic acid construct encoding the Fc fusion protein. FIG. 11A shows a western blot of the transiently produced fusion protein, as detected by using an anti-heavy chain primary antibody followed by exposure with an anti-rabbit HRP conjugated secondary antibody. FIG. 11B shows the average fold change in the Fc fusion protein production in the LMM engineered cell pool compared to the control cell pools as determined by Protein A HPLC.

(13) FIGS. 12A and 12B show the analysis of antibody A production from supernatant harvested after 48 and 72 hours from a CHO cell line stably expressing antibody A which have been transiently transfected with plasmid constructs containing either control (empty), SCD1-V5, SREBF1-V5 or SREBF410-V5 genes. FIG. 12A shows a western blot of the supernatants from the cells; antibody A was detected by using an anti-heavy chain primary antibody followed by exposure with an anti-rabbit HRP conjugated secondary antibody. FIG. 12B shows Coomassie analysis in which the bands show the relative levels of antibody A present in the supernatant at 168 hours post transfection.

(14) FIG. 13 shows analysis of antibody A production from supernatant harvested after 48, 72, 96 and 144 hours from a CHO cell line stably expressing antibody A which had been transiently transfected with plasmid constructs containing either control (empty), SCD1-V5, SREBF1-V5 or SREBF410-V5 genes where protein A Octet analysis was used to determine volumetric antibody concentration (n=2).

(15) FIG. 14 shows analysis of an FC fusion protein from supernatant samples harvested after 48, 72, 96 and 144 hours from a CHO cell line stably expressing antibody A which had been transiently transfected with plasmid constructs containing either control (empty), SCD1-V5, SREBF1-V5 or SREBF410-V5 genes where viable cell number and protein A titre measurements were used to determine specific productivity of the FC fusion protein Error bars show standard deviation (n=3).

(16) FIGS. 15A and 15B shows analysis of antibody A production from supernatant samples harvested after 48, 72, 96 and 144 hours from CHO cell pools stably integrated with control, SCD1-V5 or SREBF1-V5 containing vectors and subsequently stably integrated with an antibody A construct. FIG. 15A shows volumetric antibody concentration whilst FIG. 15B shows specific productivity of antibody A. Error bars show standard deviation (n=3).

(17) FIGS. 16A and 16B shows analysis of FC fusion protein production from supernatant samples harvested after 48, 72, 96 and 144 hours from a CHO cell pools stably integrated with control, SCD1-V5, SREBF1-V5 or SREBF410-V5 containing vectors and subsequently stably integrated with an FC fusion protein construct. FIG. 16A shows volumetric FC fusion protein concentration whilst FIG. 16B shows specific productivity of the FC fusion protein. Error bars show standard deviation (n=3).

(18) FIG. 17A shows western analysis of immunocytokine expression from CHO GSKO cells following transient transfection of a nucleic acid construct encoding genes appropriate for expression of the immunocytokine and either no LMM (control), SCD1, SREBF1 or SREB411 genes at 48 and 96 h post transfection. Supernatant samples were reduced and bands present detected using an anti heavy chain primary antibody followed by exposure to an anti-rabbit HRP conjugated secondary antibody. The lower band represents a native heavy chain antibody whilst the upper band is indicative of a heavy chain molecule fused to a cytokine. FIG. 17B shows relative immunocytokine abundance of samples obtained at 96 hours post transfection.

DETAILED DESCRIPTION

(19) As both current and next generation biologics continue to gain therapeutic utility in patients, the demand for large quantities of next generation biologic products having a high grade of quality for therapeutic use, as well as efficient means for production and efficient development of production cell line will escalate. Furthermore, many next generation biologics are difficult to express and produce in conventional cell lines using conventional expression techniques known in the art. The current methods are not sufficient to produce these products in the large quantities and at the high grade of quality required for clinical use. As such, the present disclosure features methods and compositions for obtaining higher yields of a product, e.g., a next generation biologics, with improved quality as compared to the yield and quality obtained from current production methods. The methods and compositions described herein are also useful for engineering cells or cell lines with improved productivity, product quality, robustness, and/or culture viability, as compared to the cell expression systems currently used to produce recombinant products.

Definitions

(20) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains. Although any methods and materials similar or equivalent to those described herein can be used in the practice of and/or for the testing of the present invention, the preferred materials and methods are described herein. In describing and claiming the present invention, the following terminology will be used according to how it is defined, where a definition is provided.

(21) It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting.

(22) The articles a and an are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, a cell can mean one cell or more than one cell.

(23) Component of a lipid metabolism pathway, as used herein, refers to a molecule, polypeptide, or enzyme that, directly or indirectly, synthesizes a lipid, degrades a lipid, converts a lipid from one lipid species to another lipid species, or modifies a lipid. In one embodiment, the component can be an enzyme substrate, an enzyme reaction product, or an enzyme cofactor. In one embodiment, the component of a lipid metabolism pathway is a LMM. In one embodiment, the component of a lipid metabolism pathway is provided in Table 1.

(24) Endogenous, as used herein, refers to any material from or naturally produced inside an organism, cell, tissue or system.

(25) Exogenous, as used herein, refers to any material introduced to or produced outside of an organism, cell, tissue or system. Accordingly, exogenous nucleic acid refers to a nucleic acid that is introduced to or produced outside of an organism, cell, tissue or system. In an embodiment, sequences of the exogenous nucleic acid are not naturally produced, or cannot be naturally found, inside the organism, cell, tissue, or system that the exogenous nucleic acid is introduced into. In embodiments, non-naturally occurring products, or products containing portions that are non-naturally occurring are exogenous materials with respect to the host cells described herein.

(26) Forming, as used herein, refers to introducing into the cell, synthesizing within the cell, or any other process that results in the nucleic acid encoding a LMM or an exogenous LMM being located within the cell.

(27) Heterologous, as used herein, refers to any material from one species, when introduced to an organism, cell, tissue or system from a different species. In embodiments, a heterologous material also encompasses a material that includes portions from one or multiple species or portions that are non-naturally occurring. By way of example, in an embodiment, a nucleic acid encoding a fusion protein wherein a portion of the fusion protein is human, a portion of the fusion protein is bacteria, and a portion of the fusion protein is non-naturally occurring, and the nucleic acid is introduced to a human cell, the nucleic acid is a heterologous nucleic acid.

(28) Lipid metabolism pathway, as used herein, refers to a process associated with the synthesis of a lipid or lipid-associated molecule, the elongation of a lipid or lipid-associated molecule, the degradation of a lipid or lipid-associated molecule, the incorporation of a lipid or lipid-associated molecule into a membrane, the state of saturation of a lipid or lipid-associated molecule (e.g., saturated or unsaturated), or conversion or modification of the chemical structure (e.g., re-esterification) of a lipid or lipid-associated molecule. In one embodiment, the lipid metabolism pathway results in lipid synthesis, lipid elongation, lipid degradation, changes in membrane composition or fluidity, formation or modulation of lipid rafts, or modification or conversion of a lipid (e.g., saturation or de-saturation of a lipid, or re-esterification of a lipid). Examples of lipid metabolism pathways include, but are not limited to: de novo lipogenesis, fatty acid re-esterification, fatty acid saturation, fatty acid de-saturation, fatty acid elongation, and phospholipid biosynthesis, and unfolded protein response.

(29) Lipid metabolism modulator or LMM, as used herein, refers to a molecule, gene product, polypeptide, or enzyme that modulates, e.g., increases or decreases, one or more of the following: the expression (e.g., transcription or translation) of a component involved in a lipid metabolism pathway; the activity (e.g., enzymatic activity) of a component, e.g., gene product, involved in a lipid metabolism pathway; the level or amount of lipids present in a cell; the level or amount of lipid rafts or rate of lipid raft formation; the fluidity, permeability, or thickness of a cell membrane, e.g., plasma membrane or an organelle membrane; the conversion of saturated lipids to unsaturated lipids or vice versa; the level or amount of saturated lipids or unsaturated lipids in a cell, e.g., monounsaturated lipids; lipid composition to achieve a favorable lipid composition that has a favorable impact on the activity of the ER; the expansion of the ER; the expansion of the Golgi; the level or amount of secretory vesicles or secretory vesicle formation; the level or rate of secretion; activation or inactivation of membrane receptors (e.g., ATR (see e.g., The increase of cell-membranous phosphatidylcholines containing polyunsaturated fatty acid residues induces phosphorylation of p53 through activation of ATR. Zhang X H, Zhao C, Ma Z A. J Cell Sci. 2007 Dec. 1; 120(Pt 23):4134-43 PMID: 18032786; ATR (ataxia telangiectasia mutated- and Rad3-related kinase) is activated by mild hypothermia in mammalian cells and subsequently activates p53. Roobol A, Roobol J, Carden M J, Bastide A, Willis A E, Dunn W B, Goodacre R, Smales C M. Biochem J. 2011 Apr. 15; 435(2):499-508. doi: 10.1042/BJ20101303. PMID: 21284603) and SREPB (see e.g., Int J Biol Sci. 2016 Mar. 21; 12(5):569-79. doi: 10.7150/ijbs.14027. eCollection 2016. Dysregulation of the Low-Density Lipoprotein Receptor Pathway Is Involved in Lipid Disorder-Mediated Organ Injury. Zhang Y, Ma K L, Ruan X Z, Liu B C); and additional receptors, see e.g., Biochim Biophys Acta. 2016 Mar. 17. pii: S1388-1981(16)30071-3. doi: 10.1016/j.bbalip.2016.03.019; and/or the unfolded protein response (UPR). In one embodiment, the LMM comprises a polypeptide. In one embodiment, the LMM comprises a transcriptional regulator, e.g., a transcription factor. In one embodiment, the LMM comprises SREBF1 or a functional fragment thereof (e.g., SREBF-410). In one embodiment, the LMM comprises an enzyme. In one embodiment, the LMM comprises SCD1 or a functional fragment thereof.

(30) Modification as used herein in the expression modification that modulates lipid metabolism refers to an agent that is capable of effecting an increase or decrease in the expression or activity of a component, e.g., gene product, of a lipid metabolism pathway described herein. In embodiments, the modification results in increasing the expression or activity of a component of a lipid metabolism pathway, e.g., a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% 95%, 99%, 1-fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, or 100-fold or more increase in expression or activity of a component of a lipid metabolism pathway, e.g., as compared to the expression or activity of the component in the absence of the modification. In embodiments, the modification results in decreasing the expression or activity of a component of a lipid metabolism pathway, e.g., a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% 95%, 99%%, 1-fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, or 100-fold or more decrease in expression or activity of a component of a lipid metabolism pathway, e.g., as compared to the expression or activity of the component in the absence of the modification. In some embodiments where the expression or activity of a component of the lipid metabolism pathway is decreased, the component is a negative regulator of a lipid metabolism pathway. In one embodiment, the modification comprises a heterologous or exogenous nucleic acid sequence encoding a lipid metabolism modulator. In one embodiment, the modification is an exogenous lipid metabolism modulator, e.g., small molecule or polypeptide, that can be introduced to a cell, e.g., by culturing the cell in the presence of the molecule or polypeptide, to modulate the lipid metabolism of the cell.

(31) The terms nucleic acid, polynucleotide, and nucleic acid molecule, as used interchangeably herein, refer to deoxyribonucleic acid (DNA) or ribonucleic acid (RNA), or a combination of a DNA or RNA thereof, and polymers thereof in either single-, double-, or triple-stranded form. The term nucleic acid includes, but is not limited to, a gene, cDNA, or an mRNA. In one embodiment, the nucleic acid molecule is synthetic (e.g., chemically synthesized or artificial) or recombinant. Unless specifically limited, the term encompasses molecules containing analogues or derivatives of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally or non-naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).

(32) Peptide, polypeptide, and protein, as used interchangeably herein, refer to a compound comprised of amino acid residues covalently linked by peptide bonds, or by means other than peptide bonds. A protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence. In one embodiment, a protein may comprise of more than one, e.g., two, three, four, five, or more, polypeptides, in which each polypeptide is associated to another by either covalent or non-covalent bonds/interactions. Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds or by means other than peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types. Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.

(33) Recombinant product refers to a product that can be produced by a cell or a cell-free system. The product can be a molecule, a nucleic acid, a polypeptide, or any hybrid thereof. A recombinant product is one for at which at least one component of the product or at least one nucleotide of a sequence which controls the production or expression of the product, was formed by genetic engineering. Genetic engineering as used herein to generate a recombinant product or a construct that encodes a recombinant product encompasses recombinant DNA expression techniques known in the art (e.g., as described in Current Protocols in Molecular Biology); site-directed, scanning, or random mutagenesis; genome modification strategies employing CRISPR-based strategies; and zinc finger nuclease (ZFN)-based strategies. By way of example, in embodiments where the recombinant product is a nucleic acid, at least one nucleotide of the recombinant nucleic acid, or at least one nucleotide of a sequence that controls the production, e.g., transcription, of the recombinant nucleic acid was formed by genetic engineering. In one embodiment, the recombinant product is a recombinant polypeptide. In one embodiment, the recombinant product is a naturally occurring product. In one embodiment, the recombinant product is a non-naturally occurring product, e.g., a synthetic product. In one embodiment, a portion of the recombinant product is naturally occurring, while another portion of the recombinant product is non-naturally occurring. In another embodiment, a first portion of the recombinant product is one naturally occurring molecule, while another portion of the recombinant product is another naturally occurring molecule that is different from the first portion.

(34) Recombinant polypeptide refers to a polypeptide that can be produced by a cell described herein. A recombinant polypeptide is one for which at least one nucleotide of the sequence encoding the polypeptide, or at least one nucleotide of a sequence which controls the expression of the polypeptide, was formed by genetic engineering or manipulation (of the cell or of a precursor cell). E.g., at least one nucleotide was altered, e.g., it was introduced into the cell or it is the product of a genetically engineered rearrangement. In an embodiment, the sequence of a recombinant polypeptide does not differ from a naturally or non-naturally occurring isoform of the polypeptide or protein. In an embodiment, the amino acid sequence of the recombinant polypeptide differs from the sequence of a naturally occurring or a non-naturally isoform of the polypeptide or protein. In an embodiment, the recombinant polypeptide and the cell are from the same species. In an embodiment, the amino acid sequence of the recombinant polypeptide is the same as or is substantially the same as, or differs by no more than 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% from, a polypeptide encoded by the endogenous genome of the cell. In an embodiment, the recombinant polypeptide and the cell are from the same species, e.g., the recombinant polypeptide is a human polypeptide and the cell is a human cell. In an embodiment, the recombinant polypeptide and the cell are from different species, e.g., the recombinant polypeptide is a human polypeptide and the cell is a non-human, e.g., a rodent, e.g., a CHO, other mammalian cell, an insect cell, a plant cell, a fungal cell, a viral cell, or a bacterial cell. In an embodiment, the recombinant polypeptide is exogenous to the cell, in other words, the cell is from a first species and the recombinant polypeptide is from a second species. In one embodiment, the polypeptide is a synthetic polypeptide. In one embodiment, the polypeptide is derived from a non-naturally occurring source. In an embodiment, the recombinant polypeptide is a human polypeptide or protein which does not differ in amino acid sequence from a naturally or non-naturally occurring isoform of the human polypeptide or protein. In an embodiment, the recombinant polypeptide differs from a naturally or non-naturally occurring isoform of the human polypeptide or protein at no more than 1, 2, 3, 4, 5, 10, 15 or 20 amino acid residues. In an embodiment, the recombinant polypeptide differs from a naturally occurring isoform of the human polypeptide at no more than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, or 15% of its amino acid residues. In embodiments where a portion of the recombinant polypeptide comprises a sequence derived from a portion of a naturally or non-naturally occurring isoform of a human polypeptide, the portion of the recombinant polypeptide differs from the corresponding portion of the naturally or non-naturally occurring isoform by no more than 1, 2, 3, 4, 5, 10, 15, or 20 amino acid residues, or 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, or 15% of its amino acid residues.

(35) Homologous, identity, or similarity as used herein refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules. When a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous or identical at that position. The homology between two sequences is a direct function of the number of matching or homologous positions; e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous.

(36) The term next generation biologic or NGB as used herein refers to a biological composition comprising a cell or a composition produced by a cell. The biological composition is selected from the group consisting of a composition with at least one natural component, a composition with at least one natural component and at least one non-natural component, a composition with at least one natural component and at least one natural structure, and a composition with at least one natural component and at least one non-natural structure, or any combinations thereof. Next generation biologics often comprise complex and/or non-natural structures. Examples of next generation biologics include, but are not limited to, fusion proteins, enzymes or recombinant enzymes, proteins or recombinant proteins, recombinant factors with extended half-lives, growth hormones with long acting therapies, multimeric glycoproteins, next generation antibodies, antibody fragments, or antibody-like proteins (ALPs), vesicles, exosomes, liposomes, viruses, and virus-like particles, mucins, nanoparticles, extracts of a cell, and a cell being used as a reagent.

(37) The disclosures of each and every patent, patent application, and publication cited herein are hereby incorporated herein by reference in their entirety. While this invention has been disclosed with reference to specific aspects, it is apparent that other aspects and variations of this invention may be devised by others skilled in the art without departing from the true spirit and scope of the invention. The appended claims are intended to be construed to include all such aspects and equivalent variations.

(38) Modulation of Lipid Metabolism

(39) The present disclosure features methods and compositions for modulating lipid metabolism in a cell or a cell-free system, for example, by introducing a modification to the cell or cell-free system that results in the modulation of lipid metabolism. In embodiments, the present disclosure features the use of global regulators that impact multiple aspects of pathways or processes involved in lipid metabolism, e.g., the de novo lipogenesis, fatty acid re-esterification, fatty acid saturation or desaturation, fatty acid elongation, and phospholipid biosynthesis pathways. By way of example, the global regulator is upstream in one or more lipid metabolism pathways or processes such that the global regulator impacts several, e.g., two or more, downstream processes or downstream components of lipid metabolism. In one embodiment, the global regulator is a transcription factor that can activate the expression of more than one, e.g., two or more, target genes involved in different lipid metabolism processes or pathways. Accordingly, without wishing to be bound by any theory, the use of a global regulator as described herein can result in a greater increase in production capacity, robustness, and survival of the cell than compared to the use of a downstream effector that modulates only a single target or other component of lipid metabolism. While not wishing to be bound by any theory, it is believed that a global or more widespread modulation of multiple lipid metabolism pathways increases the production capacity of a cell by affecting more processes involved in improving production capacity, product quality, and robustness of the cell.

(40) Lipid metabolism pathways as described herein refer to processes that relate to the synthesis, degradation, conversion, or modification of lipids or lipid-associated molecules. Lipid molecules include, but are not limited to, fatty acids, glycerolipids, glycerophospholipids, phospholipids, saccharolipids, sphingolipids, and sterol lipids, e.g., cholesterol, and polyketides. Examples of lipid metabolism pathways include, but are not limited to: de novo lipogenesis, fatty acid re-esterification, fatty acid saturation, fatty acid de-saturation, fatty acid elongation, and phospholipid biosynthesis. In one embodiment, the methods described herein provide a cell comprising a modification that modulates lipid metabolism. The modification that modulates lipid metabolism can be an agent that increases or decreases the expression of a component involved in lipid metabolism. In one embodiment, the modification that modulates lipid metabolism comprises an exogenous nucleic acid encoding a lipid metabolism modulator (LMM). In such embodiments, the exogenous nucleic acid encoding a LMM is introduced to the cell by any of the nucleic acid delivery methods or techniques described herein, e.g., transduction or transfection

(41) In one embodiment, the methods described herein provide a cell comprising one or more, e.g., one, two, three, four, five, six, seven, eight, nine or ten, modifications that modulate lipid metabolism. In embodiments where the cell comprises two or more modifications that modulate lipid metabolism, each modification that modulates lipid metabolism comprises an exogenous nucleic acid that encodes a LMM. In one embodiment, each of the two or more exogenous nucleic acids that encode a LMM can be located within the same nucleic acid molecule, or are placed on two or more different nucleic acid molecules. In such embodiments where the cell comprises two or more nucleic acid sequences encoding LMMs, the LMMs are different from each other, e.g., encode a different polypeptide sequence or have a different function.

(42) In embodiments, modulation of lipid metabolism in a cell, e.g., by introducing and expressing an exogenous nucleic acid encoding an LMM described herein, alters, e.g., increases or decreases, one or more of the following: i) the expression (e.g., transcription and/or translation) of a component involved in a lipid metabolism pathway; ii) the activity (e.g., enzymatic activity) of a component involved in a lipid metabolism pathway; iii) the amount of lipids (e.g., phospholipids, or cholesterol) present in a cell; iv) the amount of lipid rafts or rate of lipid raft formation; v) the fluidity, permeability, and/or thickness of a cell membrane (e.g., a plasma membrane, a vesicle membrane, or an organelle membrane); vi) the conversion of saturated lipids to unsaturated lipids or conversion of unsaturated lipids to saturated lipids; vii) the amount of saturated lipids or unsaturated lipids, e.g., monounsaturated lipids; viii) the composition of lipids in the cell to attain a favorable composition that increases ER activity; ix) the expansion of the ER (e.g., size of the ER, the ER membrane surface, or the amounts of the proteins and lipids that constitute and/or reside within the ER); x) the expansion of the Golgi (e.g., the number and size of the Golgi, the Golgi surface, or the number or amounts of proteins and molecules that reside within the Golgi); xi) the amount of secretory vesicles or the formation of secretory vesicles; xii) the amount or rate of secretion of the product; xiii) the proliferation capacity, e.g., the proliferation rate; xiv) culture viability or cell survival; xv) activation of membrane receptors; xvi) the unfolded protein response (UPR); xvii) the yield or rate of production of the product; xviii) the product quality (e.g., aggregation, glycosylation heterogeneity, fragmentation, proper folding or assembly, post-translational modification, or disulfide bond scrambling); and/or xix) cell growth/proliferation or cell specific growth rate.

(43) In an embodiment, modulation of lipid metabolism results in an increase in any of the properties listed above, e.g., a 1%, 2%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 99%, or more, or at least 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 20-fold, 50-fold, or 100-fold or more, increase in any of the properties listed above as compared to a cell without modulation of lipid metabolism. In an embodiment, modulation of lipid metabolism results in a decrease in any of the properties listed above, e.g., a 1%, 2%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 99%, or more, or at least 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 20-fold, 50-fold, or 100-fold or more, decrease in any of the properties listed above as compared to a cell without modulation of lipid metabolism.

(44) In an embodiment, a modification that modulates lipid metabolism increases or decreases the expression or activity of a component involved in one or more lipid metabolism pathways. In embodiments where the modification that modulates lipid metabolism results in an increase in the expression, e.g., transcription or translation, or an increase in the activity of a component of a lipid metabolism pathway, the component is a positive regulator of the lipid metabolism pathway. In embodiments where the modification that modulates lipid metabolism results in a decrease in the expression, e.g., transcription or translation, or a decrease in the activity of a component of a lipid metabolism pathway, the component is a negative regulator of the lipid metabolism pathway. Assays for quantifying the expression, e.g., transcription and/or translation, of a gene of the lipid metabolism pathway, are known in the art, and include quantifying the amount of mRNA encoding the gene; or quantifying the amount of the gene product, or polypeptide; PCR-based assays, e.g., quantitative real-time PCR; Northern blot; or microarray. Assays for quantifying the activity of a component of the lipid metabolism pathway, e.g., an enzyme of the lipid metabolism pathway, will be specific to the particular component of the lipid metabolism pathway.

(45) In embodiments where the modulation of the lipid metabolism of a cell results in an increase in the level or amount of lipids in the cell, the total level or total amount of lipids in the cell can be increased. In another embodiment, the level or amount of one or more species of lipids, e.g., a phospholipid or cholesterol, in the cell can be increased. An increase in the level or amount of lipids in the cell (e.g., total or a select lipid species) comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or more, or a one-fold, two-fold, three-fold, four-fold, or five-fold, 10-fold, 20-fold, 50-fold, or 100-fold, increase in the level or amount of lipids in the cell after modulation of lipid metabolism, e.g., live cells, as compared to cells that do not comprise a modification that modulates lipid metabolism. Assays for quantifying the level or amount of lipids in a cell are known in the art, and include enzymatic assays and oxidation assays and measurement by mass spectrometry of lipid components in a particular compartment (e.g., organelle) or from the total cell.

(46) In one embodiment, a modification that modulates lipid metabolism results in increased cell survival. For example, cell survival can be measured by determining or quantifying cell apoptosis, e.g., the number or amount of cells that have been killed or died. An increase in cell survival comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or more, or a one-fold, two-fold, three-fold, four-fold, or five-fold, 10-fold, 20-fold, 50-fold, or 100-fold, increase in the number of cells after modulation of lipid metabolism, e.g., live cells, as compared to cells that do not comprise a modification that modulates lipid metabolism. Alternatively, an increase in cell survival comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or more decrease in the number of apoptotic cells after modulation of lipid metabolism, e.g., as compared to cells without modulation of lipid metabolism. Methods for detecting cell survival or apoptosis are known in the art, e.g., Annexin V assays, and are described herein in the Examples.

(47) In one embodiment, a modification that modulates lipid metabolism results in increased culture viability. For example, culture viability can be measured by determining or quantifying the number or amount of live cells, e.g., live cells in a culture or population of cells, or cells that have a characteristic related to being viable, e.g., proliferation markers, intact DNA, or do not display apoptotic markers. An increase in culture viability comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or more, or a one-fold, two-fold, three-fold, four-fold, or five-fold, 10-fold, 20-fold, 50-fold, or 100-fold, or more increase in the number of cells, e.g., live cells, after modulation of lipid metabolism, e.g., as compared to cells without modulation of lipid metabolism. Methods for determining culture viability are known in the art, and are described herein in Example 3. Other methods for assessing culture viability include, but are not limited to, trypan blue exclusion methods followed by counting using a hemocytometer or Vi-CELL (Beckman-Coulter). Other methods for determining viable biomass include methods using radiofrequency impedance or capacitance (e.g., Carvell and Dowd, 2006, Cytotechnology, 50:35-48), or using Raman spectroscopy (e.g., Moretto et al., 2011, American Pharmaceutical Review, Vol. 14).

(48) In one embodiment, a modification that modulates lipid metabolism results in increased cell proliferation. For example, the ability of a cell to proliferate can be measured by quantifying or counting the number of cells, cell doublings, or growth rate of the cells. Alternatively, proliferating cells can be identified by analysis of the genomic content of the cells (e.g., replicating DNA), e.g., by flow cytometry analysis, or presence of proliferation markers, e.g., Ki67, phosphorylated cyclin-CDK complexes involved in cell cycle. An increase in the ability to proliferate comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or more, or one-fold, two-fold, three-fold, four-fold, five-fold, 10-fold, 20-fold, 50-fold, or 100-fold, or more increase in the number of cells, or number of cells expressing a proliferation marker, after modulation of lipid metabolism. Alternatively, an increase in the ability to proliferate comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or more, or one-fold, two-fold, three-fold, four-fold, five-fold, 10-fold, 20-fold, 50-fold, or 100-fold, or more increase in the doubling or growth rate of the cells after modulation of lipid metabolism. Cell counting can be performed using a cell counting machine, or by use of a hemacytometer.

(49) In one embodiment, a modification that modulates lipid metabolism results in an increase in production capacity, e.g., the amount, quantity, or yield of product produced, or the rate of production. An increase in the amount, quantity, or yield of the product produced comprises 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or more, or by 1-fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold or more increase in the amount, quantity, or yield of the product produced after modulation of lipid metabolism, e.g., as compared to the amount, quantity, or yield of the product produced by a cell without modulation of the lipid metabolism. An increase in the rate of production comprises 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or more, or by 1-fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold, or more increase in the amount, quantity, or yield of the product produced after modulation of lipid metabolism, after modulation of lipid metabolism, e.g., as compared to the rate of production of a cell without modulation of the lipid metabolism. In one embodiment, the rate of production is determined by determining the amount, quantity, or yield of the product produced in a specific unit of time.

(50) In one embodiment, a modification that modulates lipid metabolism results in an increase in the quality of the product, e.g., aggregation, glycosylation status or heterogeneity, fragmentation, proper folding or assembly, post-translational modification, or disulfide bond scrambling. An increase quality of the product comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or more, or by 1-fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold or more of: an increase in the amount or quantity of non-aggregated product, an increase in the ratio of non-aggregated product to aggregated product, or decrease in the amount or quantity of aggregated product, after modulation of lipid metabolism e.g., as compared to that observed in a cell without modulation of the lipid metabolism. An increase quality of the product comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or more, or by 1-fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold or more of: an increase in the amount or quantity of properly folded or assembled product, an increase in the ratio of properly folded or assembled product to misfolded, unfolded, partially assembled, or non-assembled product, or decrease in the amount or quantity of misfolded, unfolded, partially assembled, or non-assembled product, after modulation of lipid metabolism e.g., as compared to that observed in a cell without modulation of the lipid metabolism. An increase quality of the product comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or more, or by 1-fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold or more of: an increase in the amount or quantity of non-fragmented or full-length product, or a decrease in the amount or quantity of fragmented product after modulation of lipid metabolism, e.g., as compared to that observed in a cell without modulation of the lipid metabolism. An increase quality of the product comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or more, or by 1-fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold or more of: an increase in the amount or quantity of functional product, or a decrease in the amount or quantity of non-functional or dysfunctional product after modulation of lipid metabolism, e.g., as compared to that observed in a cell without modulation of the lipid metabolism. An increase quality of the product comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or more, or by 1-fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold or more of: an increase or decrease in the glycan heterogeneity after modulation of lipid metabolism, e.g., as compared to that observed in a cell without modulation of the lipid metabolism. An increase quality of the product comprises a 1%, 2%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or more, or by 1-fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold or more of: an increase in the amount or quantity of functional product, or a decrease in the amount or quantity of non-functional or dysfunctional product after modulation of lipid metabolism, e.g., as compared to that observed in a cell without modulation of the lipid metabolism.

(51) Lipid Metabolism Modulators

(52) As described herein, modulation of the lipid metabolism can be achieved by expressing or introducing a LMM, or by altering the regulation of a LMM. In one embodiment, an LMM is overexpressed in a cell, e.g., by introducing an exogenous nucleic acid encoding a LMM or by increasing expression by introducing promoter elements or other regulatory transcriptional elements. In another embodiment, the expression or activity of an LMM is inhibited or decreased, e.g., by introducing an inhibitor of the LMM or an exogenous inhibitory nucleic acid, e.g., an RNA interfering agent. Examples of inhibitory nucleic acids include short interfering RNAs (siRNAs) and short hairpin RNAs (shRNAs) that target the LMM, e.g, the mRNA encoding the LMM. In one embodiment, the activity or expression of an LMM is increased or decreased by altering the post-translational modifications or other endogenous regulatory mechanisms that regulate LMM activity or expression. Regulation by post-translational modifications include, but are not limited to, phosphorylation, sumoylation, ubiquitination, acetylation, methylation, or glycosylation can increase or decrease LMM expression or activity. By way of example, regulation of post-translational modifications can be achieved through modulation of the enzyme or molecule that modifies the LMM, or modification of the LMM such that the post-translational modification cannot occur or occurs more frequently or constitutively. Regulation of the LMM can also include modulating endogenous regulatory mechanisms that can increase or decrease LMM expression or activity, e.g., increase or decrease one or more of: miRNA regulation, protein cleavage, expression of specific isoforms, alternative splicing, and degradation.

(53) In one embodiment, the LMM modulates, e.g., increases or decreases, the expression, e.g., transcription, or activity of a component of the lipid metabolism pathway. In another embodiment, the LMM modulates, e.g., increases or decreases, the synthesis, degradation, elongation, or structural conformation (e.g., saturation or desaturation, or esterification) of a lipid or lipid-associated molecule. Exemplary LMMs and/or components of the lipid metabolism pathway are listed, but not limited, to those listed in Table 1.

(54) TABLE-US-00001 TABLE 1 Lipid Metabolism Pathways and Components/Gene Products Thereof Pathway Component/Gene Product Global Lipid Metabolism Regulators SREBF1 (sterol regulatory element-binding transcription factor 1) SREBF2 (sterol regulatory element-binding transcription factor 2) PRMT5 De Novo Lipogenesis FAS (fatty acid synthase) ACC (acetyl-coA carboxylase) ACL (ATP citrate lyase) Fatty Acid Re-esterification DGAT (diglyceride acyltransferase) GPAT (glycerol 3-phosphate acyltransferase) LPL (lipoprotein lipase) Phospholipid Biosynthesis AGPAT (1-actyl-sn-glycerol-3-phosphate O-acyltransferase) AGNPR (acyl/alkylglycerone-phosphate reductase) CCT (phosphocholine cytidyltransferase) CDS (phosphatidate cytidylyltransferase) CEPT (diacylglycerol choline/ehtanolaminephosphotransferase) CERT (ceramide transfer protein) CGT (N-acylsphingosine galactosyltransferase) CPT (diacylglycerol cholinephosphotransferase) CLS (cardiolipin synthase) CRD (ceramidase) GNPAT (glycerone-phosphate O-acyltransferase) KDSR (3-ketosphinganine reductase) LCS (polypeptide N-acetylgalactosaminyltransferase) PAP (phosphatidic acid phosphatase) PEMT (phosphatidylethanolamine N-methyltransferase) PGP (phosphatidylglycerophosphatase) PGS (CDP-diacylglycerol-glycerol-3-phosphate 3- phosphatidyltransferase) PIS (CDP-diacylglycerol-inositol 3-phosphatidyltransferase) PSD (phosphatidylserine decarboxylase) PSS1 (phosphatidylserine synthase 1) PSS2 (phosphatidylserine synthase 2) SGMS (ceramide choline phosphotransferase) SNAT (sphingosine N-acyltransferase) SPK (sphinganine kinase) SPP (sphingosine-1-phosphate phosphatase) SPT (serine Co-palmitoyltransferase) Fatty Acid Desaturation SCD1 (stearoyl CoA desaturase-1) SCD2 (stearoyl CoA desaturase-2) SCD3 (stearoyl CoA desaturase-3) SCD4 (stearoyl CoA desaturase-4) SCD5 (Steoryl CoA desaturase-5) PED (plasmanylethanolamine desaturase) Regulation of SREBF1 and other S1P (site-1 protease) pathways S2P (site-2 protease) SCAP (SREBF cleavage-activating protein) INSIG1 (insulin induced gene 1) INSIG2 (insulin induced gene 2) HMG CoA reductase (2-hydroxy-3-methylgulatryl-CoA reductase) PPAR receptors, e.g., PPAR, PPAR

(55) In one embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity or homology with a component, e.g., gene product, involved in a lipid metabolism pathway, e.g., provided in Table 1; or differs by 1, 2, or 3 or more amino acid residues but no more than 50, 40, 30, 20, 15, or 10 amino acid residues from the amino acid sequence of a component, e.g., gene product, involved in the lipid metabolism pathway, e.g., provided in Table 1.

(56) In one embodiment, the LMM comprises a functional fragment of a component involved in the lipid metabolism pathway, e.g., provided in Table 1. A functional fragment of an LMM as described herein may comprise one or more functional domains of the LMM. By way of example, a functional fragment of a LMM that is a transcription factor comprises a DNA binding domain and a transactivation domain. By way of example, a functional fragment of a LMM that is an enzyme comprises a domain with enzymatic activity. A functional fragment of an LMM as described herein retains functional activity, e.g., at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the functional activity, of the full-length LMM. Functional fragments of an LMM can be experimentally determined by one skilled in the art, or can be predicted using algorithms based on sequence homology of functional domains. Exemplary LMMs are further described below.

(57) In any of the embodiments of the methods described herein, the LMM is a transcriptional regulator. In one embodiment, the LMM is a transcription factor or transcriptional activator, that binds to the DNA or associates in a complex that binds to DNA, and recruits or associates in a complex that recruits RNA polymerase for transcription of one or more gene products involved in lipid metabolism. In one embodiment, the LMM binds to a sterol binding element and/or E-box promoter sequences. In one embodiment, the LMM comprises sterol regulatory element binding factor 1 (SREBF1) or sterol regulatory element binding factor 2 (SREBF2) or a functional fragment or isoform thereof.

(58) In an embodiment, the LMM comprises a global transcriptional activator or transcription factor. In one embodiment, the LMM is capable of modulating the transcription of two or more, e.g., two, three, four, five, six, or more, components of a lipid metabolism pathway, e.g., as provided in Table 1. In another embodiment, the LMM is capable of modulating the transcription of one or more, e.g., one, two, three, four, or five, or more, components of two or more lipid metabolism pathways, e.g., components and pathways as provided in Table 1.

(59) Sterol regulatory element binding factor 1 (SREBF1) is a global transcriptional activator which upregulates the transcription of genes involved in lipogenesis, fatty acid re-esterification, fatty acid desaturation and elongation, and phospholipid biosynthesis by binding to sterol regulatory element (SRE) and E-box promoter sequences (Hagen, Rodriguez-Cuenca et al. 2010) present in the promoter regions of target genes. Transcription of the SREBF1 gene itself is endogenously regulated by the presence of the sterol regulatory element (SRE) amongst other transcriptional regulating elements in the promoter region of the gene. On top of this, a multitude of posttranslational regulating mechanisms including phosphorylation, ubiquitination, sumoylation, acetylation, fatty acid-mediated modifications and proteolytic processing make for a tightly controlled but adaptable homeostatic system fixed around SREBF1.

(60) Full-length SREBF1 is synthesized and localizes primarily to the endoplasmic reticulum (ER). Membrane integral SREBF1 forms a complex with SREBF cleavage-activating protein (SCAP) which can facilitate migration of SREBF1 to the Golgi. However, when high sterol levels (particularly cholesterol) are present, a conformational change in SCAP is induced which aids binding to the membrane integral protein insig (insulin induced gene), thus inhibiting migration of this complex. In the absence of sterols, insig does not bind to SCAP, therefore allowing COPII mediated vesicle formation, and subsequent migration of the SREBF:SCAP complex to the Golgi. Sequential proteolytic cleavage occurs in the Golgi mediated by site-1 protease (S1P) and site-2 protease (S2P) proteins liberating the N-terminal basic helix loop helix leucine zipper (bHLHlz) of SREBF1 which is immediately present in the cytoplasm, but migrates to the nucleus. Lysine residues present on the cleaved SREBF1 are ubiquitinated and degraded by the 26S proteasome but this ubiquitination can be inhibited through acetylation of the lysine residues which allows migration to the nucleus. Finally, nuclear SREBF1 can bind to sterol regulatory element (SRE) sequences upstream of a number of genes responsible for de novo lipogenesis (fatty acid synthase (FAS) and acetyl coA carboxylase (ACC)), fatty acid re-esterfication (diacylglycerol acyltransferase (DGAT), glycerol-3-phosphate (GPAT) and lipoprotein lipase (LPL)), phospholipid biosynthesis (CTP:phosphocholine cytidylyltransferase (CCT)), fatty acid desaturation (stearoyl-coA desaturase 1 (SCD1)). Nuclear SREBF1 is also capable of activating transcription of the full length SREBF1 gene itself, but this is also dependent on activation of the liver X receptor (LXR) promoter sequence also located upstream of the gene (Brown, Goldstein 1997-BROWN, M. S. and GOLDSTEIN, J. L., 1997. The SREBP Pathway: Regulation of Cholesterol Metabolism by Proteolysis of a Membrane-Bound Transcription Factor. Cell, 89(3), pp. 331-340) (Hagen, Rodriguez-Cuenca-HAGEN, R. M., RODRIGUEZ-CUENCA, S. and VIDAL-PUIG, A., 2010. An allostatic control of membrane lipid composition by SREBP1. FEBS letters, 584(12), pp. 2689-2698).

(61) In one embodiment, the LMM comprises SREBF1, an isoform, or a functional fragment thereof. The amino acid sequence for SREBF1 is provided below:

(62) TABLE-US-00002 (SEQ ID NO: 1) MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAP YAGGETGDTGPSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPS APAALKMYPSVSPFSPGPGIKEEPVPLTILQPAAPQPSPGTLLPPSFPAP PVQLSPAPVLGYSSLPSGFSGTLPGNTQQPPSSLPLAPAPGVLPTPALHT QVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKADSLLLTAVKT DAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIH RLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAK LNKSAVLRKAIDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSG GGTDVSMEGMKPEVVETLTPPPSDAGSPSQSSPLSFGSRASSSGGSDSEP DSPAFEDSQVKAQRLPSHSRGMLDRSRLALCVLAFLCLTCNPLASLFGWG ILTPSDATGTHRSSGRSMLEAESRDGSNWTQWLLPPLVWLANGLLVLACL ALLFVYGEPVTRPHSGPAVHFWRHRKQADLDLARGDFPQAAQQLWLALQA LGRPLPTSNLDLACSLLWNLIRHLLQRLWVGRWLAGQAGGLLRDRGLRKD ARASARDAAVVYHKLHQLHAMGKYTGGHLAASNLALSALNLAECAGDAIS MATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPLAMQ WLCHPVGHRFFVDGDWAVHGAPPESLYSVAGNPVDPLAQVTRLFREHLLE RALNCIAQPSPGAADGDREFSDALGYLQLLNSCSDAAGAPACSFSVSSSM AATTGPDPVAKWWASLTAVVIHWLRRDEEAAERLYPLVEHIPQVLQDTER PLPRAALYSFKAARALLDHRKVESSPASLAICEKASGYLRDSLASTPTGS SIDKAMQLLLCDLLLVARTSLWQRQQSPASVQVAHGTSNGPQASALELRG FQHDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASPARTHQLLDRSLRR RAGSSGKGGTTAELEPRPTWREHTEALLLASCYLPPAFLSAPGQRMSMLA EAARTVEKLGDHRLLLDCQQMLLRLGGGTTVTSS.
The nucleotide sequence for SREBF1 is provided below:

(63) TABLE-US-00003 (SEQ ID NO: 2) atggacgagctggccttcggtgaggcggctctggaacagacactggccga gatgtgcgaactggacacagcggttttgaacgacatcgaagacatgctcc agctcatcaacaaccaagacagtgacttcccgggcctgtttgacgccccc tatgctgggggtgagacaggggacacaggccccagcagcccaggtgccaa ctctcctgagagcttctcttctgcttctctggcctcctctctggaagcct tcctgggaggacccaaggtgacacctgcacccttgtcccctccaccatcg gcacccgctgctttaaagatgtacccgtccgtgtcccccttttcccctgg gcctgggatcaaagaggagccagtgccactcaccatcctacagcctgcag cgccacagccgtcaccggggaccctcctgcctccgagcttccccgcacca cccgtacagctcagccctgcgcccgtgctgggttactcgagcctgccttc aggcttctcagggacccttccaggaaacactcagcagccaccatctagcc tgccgctggcccctgcaccaggagtcttgcccacccctgccctgcacacc caggtccaaagcttggcctcccagcagccgctgccagcctcagcagcccc tagaacaaacactgtgacctcacaggtccagcaggtcccagttgtactgc agccacacttcatcaaggcagactcactgctgctgacagctgtgaagaca gatgcaggagccaccgtgaagactgcaggcatcagcaccctggctcctgg cacagccgtgcaggcaggtcccctgcagaccctggtgagtggagggacca tcttggccacagtacctttggttgtggacacagacaaactgcccatccac cgactcgcagctggcagcaaggccctaggctcagctcagagccgtggtga gaagcgcacagcccacaatgccattgagaagcgctaccggtcttctatca atgacaagattgtggagctcaaagacctggtggtgggcactgaagcaaag ctgaataaatctgctgtcttgcgcaaggccatcgactacatccgcttctt gcagcacagcaaccagaagctcaagcaggagaacctgaccctacgaagtg cacacaaaagcaaatcactgaaggacctggtgtcagcttgtggcagtgga ggaggcacagatgtgtctatggagggcatgaaacccgaagtggtggagac gcttacccctccaccctcagacgccggctcaccctcccagagtagcccct tgtcttttggcagcagagctagcagcagtggtggtagtgactctgagccc gacagtccagcctttgaggatagccaggtcaaagcccagcggctgccttc acacagccgaggcatgctggaccgctcccgcctggccctgtgtgtactgg cctttctgtgtctgacctgcaatcctttggcctcgcttttcggctggggc attctcactccctctgatgctacgggtacacaccgtagttctgggcgcag catgctggaggcagagagcagagatggctctaattggacccagtggttgc tgccacccctagtctggctggccaatggactactagtgttggcctgcttg gctcttctctttgtctatggggaacctgtgactaggccacactctggccc ggctgtacacttctggagacatcgcaaacaagctgacctggatttggccc ggggagatttcccccaggctgctcaacagctgtggctggccctgcaagcg ctgggccggcccctgcccacctcaaacctggatctggcctgcagtctgct ttggaacctcatccgccacctgctccagcgtctctgggtgggccgctggc tggcaggccaggccgggggcctgctgagggaccgtgggctgaggaaggat gcccgtgccagtgcccgggatgcggctgttgtctaccataagctgcacca gctgcatgccatgggcaagtacacaggaggacatcttgctgcttctaacc tggcactaagtgccctcaacctggctgagtgcgcaggagatgctatctcc atggcaacactggcagagatctatgtggcagcggccctgagggtcaaaac cagcctcccaagagccctgcacttcttgacacgtttcttcctgagcagcg cccgccaggcctgcctagcacagagcggctcggtgcctcttgccatgcag tggctctgccaccctgtaggtcaccgtttctttgtggacggggactgggc cgtgcacggtgcccccccggagagcctgtacagcgtggctgggaacccag tggatccgctggcccaggtgacccggctattccgtgaacatctcctagag cgagcgttgaactgtattgctcagcccagcccaggggcagctgacggaga cagggagttctcagatgcccttggatatctgcagttgctaaatagctgtt ctgatgctgccggggctcctgcttgcagtttctctgtcagctccagcatg gctgccaccactggcccagacccagtggccaagtggtgggcctcactgac agctgtggtgatccactggctgaggcgggatgaagaggcagctgagcgct tgtacccactggtagagcatatcccccaggtgctgcaggacactgagaga cccctgcccagggcagctctgtactccttcaaggctgcccgggctctgct ggaccacagaaaggtggaatctagcccagccagcctggccatctgtgaga aggccagtgggtacctgcgggacagcttagcctctacaccaactggcagt tccattgacaaggccatgcagctgctcctgtgtgatctacttcttgtggc ccgtaccagtctgtggcagcggcagcagtcaccagcttcagtccaggtag ctcacggtaccagcaatggaccccaggcctctgctctggagctgcgtggt ttccaacatgacctgagcagcctgcggcggttggcacagagcttccggcc tgctatgaggagggtattcctacatgaggccacagctcggctgatggcag gagcaagtcctgcccggacacaccagctcctggatcgcagtctgaggagg agggcaggttccagtggcaaaggaggcactacagctgagctggagccacg gcccacatggcgggagcacaccgaggccctgctgttggcatcctgctatc tgccccctgccttcctgtcggctcctgggcagcgaatgagcatgctggcc gaggcggcacgcaccgtagagaagcttggcgatcaccggctactgctgga ctgccagcagatgctcctgcgcctgggcggcggaaccaccgtcacttcca gctag.

(64) In one embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the amino acid sequence of SREBF1; e.g., SEQ ID NO: 1; or differs by 1, 2, or 3 or more amino acid residues but no more than 50, 40, 30, 20, 15, or 10 amino acid residues from the amino acid sequence of SREBF1, e.g., SEQ ID NO: 1.

(65) Isoforms of SREBF1 are known in the art, and include isoform a and isoform b, as well as species or cell specific, e.g., CHO cell specific, isoforms, such as isoform c. The amino acid sequence for SREBF1 isoform a (GenBank Accession No. NP_001005291.2) is provided below.

(66) TABLE-US-00004 (SEQ ID NO: 28) MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGA DRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPG SLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGP GIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPG GFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAP TAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPL VSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQS RGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYI RFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTE VEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAK PEQRPSLHSRGMLDRSRLALCTLVFLCLSCNPLASLLGARGLPSPSDTTS VYHSPGRNVLGTESRDGPGWAQWLLPPVVWLLNGLLVLVSLVLLFVYGEP VTRPHSGPAVYFWRHRKQADLDLARGDFAQAAQQLWLALRALGRPLPTSH LDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLQQDCALRVDASASARDAA LVYHKLHQLHTMGKHTGGHLTATNLALSALNLAECAGDAVSVATLAEIYV AAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHR FFVDGDWSVLSTPWESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQP NPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVD PVAKWWASLTAVVIHWLRRDEEAAERLCPLVEHLPRVLQESERPLPRAAL HSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTPASSSIDKAVQ LFLCDLLLVVRTSLWRQQQPPAPAPAAQGTSSRPQASALELRGFQRDLSS LRRLAQSFRPAMRRVFLHEATARLMAGASPTRTHQLLDRSLRRRAGPGGK GGAVAELEPRPTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLE KLGDRRLLHDCQQMLMRLGGGTTVTSS

(67) The nucleic acid sequence, or mRNA sequence, for SREBF1 isoform a (GenBank Accession No. NM_001005291.2) is provided below.

(68) TABLE-US-00005 (SEQ ID NO: 29) AGCAGAGCTGCGGCCGGGGGAACCCAGTTTCCGAGGAACTTTTCGCCGGC GCCGGGCCGCCTCTGAGGCCAGGGCAGGACACGAACGCGCGGAGCGGCGG CGGCGACTGAGAGCCGGGGCCGCGGCGGCGCTCCCTAGGAAGGGCCGTAC GAGGCGGCGGGCCCGGCGGGCCTCCCGGAGGAGGCGGCTGCGCCATGGAC GAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTG CGATCTGGACGCGGCGCTGCTGACCGACATCGAAGGTGAAGTCGGCGCGG GGAGGGGTAGGGCCAACGGCCTGGACGCCCCAAGGGCGGGCGCAGATCGC GGAGCCATGGATTGCACTTTCGAAGACATGCTTCAGCTTATCAACAACCA AGACAGTGACTTCCCTGGCCTATTTGACCCACCCTATGCTGGGAGTGGGG CAGGGGGCACAGACCCTGCCAGCCCCGATACCAGCTCCCCAGGCAGCTTG TCTCCACCTCCTGCCACATTGAGCTCCTCTCTTGAAGCCTTCCTGAGCGG GCCGCAGGCAGCGCCCTCACCCCTGTCCCCTCCCCAGCCTGCACCCACTC CATTGAAGATGTACCCGTCCATGCCCGCTTTCTCCCCTGGGCCTGGTATC AAGGAAGAGTCAGTGCCACTGAGCATCCTGCAGACCCCCACCCCACAGCC CCTGCCAGGGGCCCTCCTGCCACAGAGCTTCCCAGCCCCAGCCCCACCGC AGTTCAGCTCCACCCCTGTGTTAGGCTACCCCAGCCCTCCGGGAGGCTTC TCTACAGGAAGCCCTCCCGGGAACACCCAGCAGCCGCTGCCTGGCCTGCC ACTGGCTTCCCCGCCAGGGGTCCCGCCCGTCTCCTTGCACACCCAGGTCC AGAGTGTGGTCCCCCAGCAGCTACTGACAGTCACAGCTGCCCCCACGGCA GCCCCTGTAACGACCACTGTGACCTCGCAGATCCAGCAGGTCCCGGTCCT GCTGCAGCCCCACTTCATCAAGGCAGACTCGCTGCTTCTGACAGCCATGA AGACAGACGGAGCCACTGTGAAGGCGGCAGGTCTCAGTCCCCTGGTCTCT GGCACCACTGTGCAGACAGGGCCTTTGCCGACCCTGGTGAGTGGCGGAAC CATCTTGGCAACAGTCCCACTGGTCGTAGATGCGGAGAAGCTGCCTATCA ACCGGCTCGCAGCTGGCAGCAAGGCCCCGGCCTCTGCCCAGAGCCGTGGA GAGAAGCGCACAGCCCACAACGCCATTGAGAAGCGCTACCGCTCCTCCAT CAATGACAAAATCATTGAGCTCAAGGATCTGGTGGTGGGCACTGAGGCAA AGCTGAATAAATCTGCTGTCTTGCGCAAGGCCATCGACTACATTCGCTTT CTGCAACACAGCAACCAGAAACTCAAGCAGGAGAACCTAAGTCTGCGCAC TGCTGTCCACAAAAGCAAATCTCTGAAGGATCTGGTGTCGGCCTGTGGCA GTGGAGGGAACACAGACGTGCTCATGGAGGGCGTGAAGACTGAGGTGGAG GACACACTGACCCCACCCCCCTCGGATGCTGGCTCACCTTTCCAGAGCAG CCCCTTGTCCCTTGGCAGCAGGGGCAGTGGCAGCGGTGGCAGTGGCAGTG ACTCGGAGCCTGACAGCCCAGTCTTTGAGGACAGCAAGGCAAAGCCAGAG CAGCGGCCGTCTCTGCACAGCCGGGGCATGCTGGACCGCTCCCGCCTGGC CCTGTGCACGCTCGTCTTCCTCTGCCTGTCCTGCAACCCCTTGGCCTCCT TGCTGGGGGCCCGGGGGCTTCCCAGCCCCTCAGATACCACCAGCGTCTAC CATAGCCCTGGGCGCAACGTGCTGGGCACCGAGAGCAGAGATGGCCCTGG CTGGGCCCAGTGGCTGCTGCCCCCAGTGGTCTGGCTGCTCAATGGGCTGT TGGTGCTCGTCTCCTTGGTGCTTCTCTTTGTCTACGGTGAGCCAGTCACA CGGCCCCACTCAGGCCCCGCCGTGTACTTCTGGAGGCATCGCAAGCAGGC TGACCTGGACCTGGCCCGGGGAGACTTTGCCCAGGCTGCCCAGCAGCTGT GGCTGGCCCTGCGGGCACTGGGCCGGCCCCTGCCCACCTCCCACCTGGAC CTGGCTTGTAGCCTCCTCTGGAACCTCATCCGTCACCTGCTGCAGCGTCT CTGGGTGGGCCGCTGGCTGGCAGGCCGGGCAGGGGGCCTGCAGCAGGACT GTGCTCTGCGAGTGGATGCTAGCGCCAGCGCCCGAGACGCAGCCCTGGTC TACCATAAGCTGCACCAGCTGCACACCATGGGGAAGCACACAGGCGGGCA CCTCACTGCCACCAACCTGGCGCTGAGTGCCCTGAACCTGGCAGAGTGTG CAGGGGATGCCGTGTCTGTGGCGACGCTGGCCGAGATCTATGTGGCGGCT GCATTGAGAGTGAAGACCAGTCTCCCACGGGCCTTGCATTTTCTGACACG CTTCTTCCTGAGCAGTGCCCGCCAGGCCTGCCTGGCACAGAGTGGCTCAG TGCCTCCTGCCATGCAGTGGCTCTGCCACCCCGTGGGCCACCGTTTCTTC GTGGATGGGGACTGGTCCGTGCTCAGTACCCCATGGGAGAGCCTGTACAG CTTGGCCGGGAACCCAGTGGACCCCCTGGCCCAGGTGACTCAGCTATTCC GGGAACATCTCTTAGAGCGAGCACTGAACTGTGTGACCCAGCCCAACCCC AGCCCTGGGTCAGCTGATGGGGACAAGGAATTCTCGGATGCCCTCGGGTA CCTGCAGCTGCTGAACAGCTGTTCTGATGCTGCGGGGGCTCCTGCCTACA GCTTCTCCATCAGTTCCAGCATGGCCACCACCACCGGCGTAGACCCGGTG GCCAAGTGGTGGGCCTCTCTGACAGCTGTGGTGATCCACTGGCTGCGGCG GGATGAGGAGGCGGCTGAGCGGCTGTGCCCGCTGGTGGAGCACCTGCCCC GGGTGCTGCAGGAGTCTGAGAGACCCCTGCCCAGGGCAGCTCTGCACTCC TTCAAGGCTGCCCGGGCCCTGCTGGGCTGTGCCAAGGCAGAGTCTGGTCC AGCCAGCCTGACCATCTGTGAGAAGGCCAGTGGGTACCTGCAGGACAGCC TGGCTACCACACCAGCCAGCAGCTCCATTGACAAGGCCGTGCAGCTGTTC CTGTGTGACCTGCTTCTTGTGGTGCGCACCAGCCTGTGGCGGCAGCAGCA GCCCCCGGCCCCGGCCCCAGCAGCCCAGGGCACCAGCAGCAGGCCCCAGG CTTCCGCCCTTGAGCTGCGTGGCTTCCAACGGGACCTGAGCAGCCTGAGG CGGCTGGCACAGAGCTTCCGGCCCGCCATGCGGAGGGTGTTCCTACATGA GGCCACGGCCCGGCTGATGGCGGGGGCCAGCCCCACACGGACACACCAGC TCCTCGACCGCAGTCTGAGGCGGCGGGCAGGCCCCGGTGGCAAAGGAGGC GCGGTGGCGGAGCTGGAGCCGCGGCCCACGCGGCGGGAGCACGCGGAGGC CTTGCTGCTGGCCTCCTGCTACCTGCCCCCCGGCTTCCTGTCGGCGCCCG GGCAGCGCGTGGGCATGCTGGCTGAGGCGGCGCGCACACTCGAGAAGCTT GGCGATCGCCGGCTGCTGCACGACTGTCAGCAGATGCTCATGCGCCTGGG CGGTGGGACCACTGTCACTTCCAGCTAGACCCCGTGTCCCCGGCCTCAGC ACCCCTGTCTCTAGCCACTTTGGTCCCGTGCAGCTTCTGTCCTGCGTCGA AGCTTTGAAGGCCGAAGGCAGTGCAAGAGACTCTGGCCTCCACAGTTCGA CCTGCGGCTGCTGTGTGCCTTCGCGGTGGAAGGCCCGAGGGGCGCGATCT TGACCCTAAGACCGGCGGCCATGATGGTGCTGACCTCTGGTGGCCGATCG GGGCACTGCAGGGGCCGAGCCATTTTGGGGGGCCCCCCTCCTTGCTCTGC AGGCACCTTAGTGGCTTTTTTCCTCCTGTGTACAGGGAAGAGAGGGGTAC ATTTCCCTGTGCTGACGGAAGCCAACTTGGCTTTCCCGGACTGCAAGCAG GGCTCTGCCCCAGAGGCCTCTCTCTCCGTCGTGGGAGAGAGACGTGTACA TAGTGTAGGTCAGCGTGCTTAGCCTCCTGACCTGAGGCTCCTGTGCTACT TTGCCTTTTGCAAACTTTATTTTCATAGATTGAGAAGTTTTGTACAGAGA ATTAAAAATGAAATTATTTATAATCTGGGTTTTGTGTCTTCAGCTGATGG ATGTGCTGACTAGTGAGAGTGCTTGGGCCCTCCCCCAGCACCTAGGGAAA GGCTTCCCCTCCCCCTCCGGCCACAAGGTACACAACTTTTAACTTAGCTC TTCCCGATGTTTGTTTGTTAGTGGGAGGAGTGGGGAGGGCTGGCTGTATG GCCTCCAGCCTACCTGTTCCCCCTGCTCCCAGGGCACATGGTTGGGCTGT GTCAACCCTTAGGGCCTCCATGGGGTCAGTTGTCCCTTCTCACCTCCCAG CTCTGTCCCCATCAGGTCCCTGGGTGGCACGGGAGGATGGACTGACTTCC AGGACCTGTTGTGTGACAGGAGCTACAGCTTGGGTCTCCCTGCAAGAAGT CTGGCACGTCTCACCTCCCCCATCCCGGCCCCTGGTCATCTCACAGCAAA GAAGCCTCCTCCCTCCCGACCTGCCGCCACACTGGAGAGGGGGCACAGGG GCGGGGGAGGTTTCCTGTTCTGTGAAAGGCCGACTCCCTGACTCCATTCA TGCCCCCCCCCCCAGCCCCTCCCTTCATTCCCATTCCCCAACCTAAAGCC TGGCCCGGCTCCCAGCTGAATCTGGTCGGAATCCACGGGCTGCAGATTTT CCAAAACAATCGTTGTATCTTTATTGACTTTTTTTTTTTTTTTTTTCTGA ATGCAATGACTGTTTTTTACTCTTAAGGAAAATAAACATCTTTTAGAAAC AAAAAAAAAAAA

(69) The amino acid sequence for SREBF1 isoform b (GenBank Accession No. NP_004167.3) is provided below.

(70) TABLE-US-00006 (SEQ ID NO: 30) MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPP YAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPP QPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFP APAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVS LHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSL LLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDA EKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLV VGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDL VSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGS GGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLALCTLVFLCLSC NPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGWAQWLLPPVVW LLNGLLVLVSLVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQ AAQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAG GLQQDCALRVDASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSAL NLAECAGDAVSVATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACL AQSGSVPPAMQWLCHPVGHRFFVDGDWSVLSTPWESLYSLAGNPVDPLAQ VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAA GAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL VEHLPRVLQESERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASG YLQDSLATTPASSSIDKAVQLFLCDLLLVVRTSLWRQQQPPAPAPAAQGT SSRPQASALELRGFQRDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASP TRTHQLLDRSLRRRAGPGGKGGAVAELEPRPTRREHAEALLLASCYLPPG FLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQMLMRLGGGTTVTSS

(71) The nucleic acid sequence, or mRNA sequence, for SREBF1 isoform b (GenBank Accession No. NM_004176.4) is provided below.

(72) TABLE-US-00007 (SEQ ID NO: 31) AGCAGAGCTGCGGCCGGGGGAACCCAGTTTCCGAGGAACTTTTCGCCGGC GCCGGGCCGCCTCTGAGGCCAGGGCAGGACACGAACGCGCGGAGCGGCGG CGGCGACTGAGAGCCGGGGCCGCGGCGGCGCTCCCTAGGAAGGGCCGTAC GAGGCGGCGGGCCCGGCGGGCCTCCCGGAGGAGGCGGCTGCGCCATGGAC GAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGGGCGAGCCGTG CGATCTGGACGCGGCGCTGCTGACCGACATCGAAGACATGCTTCAGCTTA TCAACAACCAAGACAGTGACTTCCCTGGCCTATTTGACCCACCCTATGCT GGGAGTGGGGCAGGGGGCACAGACCCTGCCAGCCCCGATACCAGCTCCCC AGGCAGCTTGTCTCCACCTCCTGCCACATTGAGCTCCTCTCTTGAAGCCT TCCTGAGCGGGCCGCAGGCAGCGCCCTCACCCCTGTCCCCTCCCCAGCCT GCACCCACTCCATTGAAGATGTACCCGTCCATGCCCGCTTTCTCCCCTGG GCCTGGTATCAAGGAAGAGTCAGTGCCACTGAGCATCCTGCAGACCCCCA CCCCACAGCCCCTGCCAGGGGCCCTCCTGCCACAGAGCTTCCCAGCCCCA GCCCCACCGCAGTTCAGCTCCACCCCTGTGTTAGGCTACCCCAGCCCTCC GGGAGGCTTCTCTACAGGAAGCCCTCCCGGGAACACCCAGCAGCCGCTGC CTGGCCTGCCACTGGCTTCCCCGCCAGGGGTCCCGCCCGTCTCCTTGCAC ACCCAGGTCCAGAGTGTGGTCCCCCAGCAGCTACTGACAGTCACAGCTGC CCCCACGGCAGCCCCTGTAACGACCACTGTGACCTCGCAGATCCAGCAGG TCCCGGTCCTGCTGCAGCCCCACTTCATCAAGGCAGACTCGCTGCTTCTG ACAGCCATGAAGACAGACGGAGCCACTGTGAAGGCGGCAGGTCTCAGTCC CCTGGTCTCTGGCACCACTGTGCAGACAGGGCCTTTGCCGACCCTGGTGA GTGGCGGAACCATCTTGGCAACAGTCCCACTGGTCGTAGATGCGGAGAAG CTGCCTATCAACCGGCTCGCAGCTGGCAGCAAGGCCCCGGCCTCTGCCCA GAGCCGTGGAGAGAAGCGCACAGCCCACAACGCCATTGAGAAGCGCTACC GCTCCTCCATCAATGACAAAATCATTGAGCTCAAGGATCTGGTGGTGGGC ACTGAGGCAAAGCTGAATAAATCTGCTGTCTTGCGCAAGGCCATCGACTA CATTCGCTTTCTGCAACACAGCAACCAGAAACTCAAGCAGGAGAACCTAA GTCTGCGCACTGCTGTCCACAAAAGCAAATCTCTGAAGGATCTGGTGTCG GCCTGTGGCAGTGGAGGGAACACAGACGTGCTCATGGAGGGCGTGAAGAC TGAGGTGGAGGACACACTGACCCCACCCCCCTCGGATGCTGGCTCACCTT TCCAGAGCAGCCCCTTGTCCCTTGGCAGCAGGGGCAGTGGCAGCGGTGGC AGTGGCAGTGACTCGGAGCCTGACAGCCCAGTCTTTGAGGACAGCAAGGC AAAGCCAGAGCAGCGGCCGTCTCTGCACAGCCGGGGCATGCTGGACCGCT CCCGCCTGGCCCTGTGCACGCTCGTCTTCCTCTGCCTGTCCTGCAACCCC TTGGCCTCCTTGCTGGGGGCCCGGGGGCTTCCCAGCCCCTCAGATACCAC CAGCGTCTACCATAGCCCTGGGCGCAACGTGCTGGGCACCGAGAGCAGAG ATGGCCCTGGCTGGGCCCAGTGGCTGCTGCCCCCAGTGGTCTGGCTGCTC AATGGGCTGTTGGTGCTCGTCTCCTTGGTGCTTCTCTTTGTCTACGGTGA GCCAGTCACACGGCCCCACTCAGGCCCCGCCGTGTACTTCTGGAGGCATC GCAAGCAGGCTGACCTGGACCTGGCCCGGGGAGACTTTGCCCAGGCTGCC CAGCAGCTGTGGCTGGCCCTGCGGGCACTGGGCCGGCCCCTGCCCACCTC CCACCTGGACCTGGCTTGTAGCCTCCTCTGGAACCTCATCCGTCACCTGC TGCAGCGTCTCTGGGTGGGCCGCTGGCTGGCAGGCCGGGCAGGGGGCCTG CAGCAGGACTGTGCTCTGCGAGTGGATGCTAGCGCCAGCGCCCGAGACGC AGCCCTGGTCTACCATAAGCTGCACCAGCTGCACACCATGGGGAAGCACA CAGGCGGGCACCTCACTGCCACCAACCTGGCGCTGAGTGCCCTGAACCTG GCAGAGTGTGCAGGGGATGCCGTGTCTGTGGCGACGCTGGCCGAGATCTA TGTGGCGGCTGCATTGAGAGTGAAGACCAGTCTCCCACGGGCCTTGCATT TTCTGACACGCTTCTTCCTGAGCAGTGCCCGCCAGGCCTGCCTGGCACAG AGTGGCTCAGTGCCTCCTGCCATGCAGTGGCTCTGCCACCCCGTGGGCCA CCGTTTCTTCGTGGATGGGGACTGGTCCGTGCTCAGTACCCCATGGGAGA GCCTGTACAGCTTGGCCGGGAACCCAGTGGACCCCCTGGCCCAGGTGACT CAGCTATTCCGGGAACATCTCTTAGAGCGAGCACTGAACTGTGTGACCCA GCCCAACCCCAGCCCTGGGTCAGCTGATGGGGACAAGGAATTCTCGGATG CCCTCGGGTACCTGCAGCTGCTGAACAGCTGTTCTGATGCTGCGGGGGCT CCTGCCTACAGCTTCTCCATCAGTTCCAGCATGGCCACCACCACCGGCGT AGACCCGGTGGCCAAGTGGTGGGCCTCTCTGACAGCTGTGGTGATCCACT GGCTGCGGCGGGATGAGGAGGCGGCTGAGCGGCTGTGCCCGCTGGTGGAG CACCTGCCCCGGGTGCTGCAGGAGTCTGAGAGACCCCTGCCCAGGGCAGC TCTGCACTCCTTCAAGGCTGCCCGGGCCCTGCTGGGCTGTGCCAAGGCAG AGTCTGGTCCAGCCAGCCTGACCATCTGTGAGAAGGCCAGTGGGTACCTG CAGGACAGCCTGGCTACCACACCAGCCAGCAGCTCCATTGACAAGGCCGT GCAGCTGTTCCTGTGTGACCTGCTTCTTGTGGTGCGCACCAGCCTGTGGC GGCAGCAGCAGCCCCCGGCCCCGGCCCCAGCAGCCCAGGGCACCAGCAGC AGGCCCCAGGCTTCCGCCCTTGAGCTGCGTGGCTTCCAACGGGACCTGAG CAGCCTGAGGCGGCTGGCACAGAGCTTCCGGCCCGCCATGCGGAGGGTGT TCCTACATGAGGCCACGGCCCGGCTGATGGCGGGGGCCAGCCCCACACGG ACACACCAGCTCCTCGACCGCAGTCTGAGGCGGCGGGCAGGCCCCGGTGG CAAAGGAGGCGCGGTGGCGGAGCTGGAGCCGCGGCCCACGCGGCGGGAGC ACGCGGAGGCCTTGCTGCTGGCCTCCTGCTACCTGCCCCCCGGCTTCCTG TCGGCGCCCGGGCAGCGCGTGGGCATGCTGGCTGAGGCGGCGCGCACACT CGAGAAGCTTGGCGATCGCCGGCTGCTGCACGACTGTCAGCAGATGCTCA TGCGCCTGGGCGGTGGGACCACTGTCACTTCCAGCTAGACCCCGTGTCCC CGGCCTCAGCACCCCTGTCTCTAGCCACTTTGGTCCCGTGCAGCTTCTGT CCTGCGTCGAAGCTTTGAAGGCCGAAGGCAGTGCAAGAGACTCTGGCCTC CACAGTTCGACCTGCGGCTGCTGTGTGCCTTCGCGGTGGAAGGCCCGAGG GGCGCGATCTTGACCCTAAGACCGGCGGCCATGATGGTGCTGACCTCTGG TGGCCGATCGGGGCACTGCAGGGGCCGAGCCATTTTGGGGGGCCCCCCTC CTTGCTCTGCAGGCACCTTAGTGGCTTTTTTCCTCCTGTGTACAGGGAAG AGAGGGGTACATTTCCCTGTGCTGACGGAAGCCAACTTGGCTTTCCCGGA CTGCAAGCAGGGCTCTGCCCCAGAGGCCTCTCTCTCCGTCGTGGGAGAGA GACGTGTACATAGTGTAGGTCAGCGTGCTTAGCCTCCTGACCTGAGGCTC CTGTGCTACTTTGCCTTTTGCAAACTTTATTTTCATAGATTGAGAAGTTT TGTACAGAGAATTAAAAATGAAATTATTTATAATCTGGGTTTTGTGTCTT CAGCTGATGGATGTGCTGACTAGTGAGAGTGCTTGGGCCCTCCCCCAGCA CCTAGGGAAAGGCTTCCCCTCCCCCTCCGGCCACAAGGTACACAACTTTT AACTTAGCTCTTCCCGATGTTTGTTTGTTAGTGGGAGGAGTGGGGAGGGC TGGCTGTATGGCCTCCAGCCTACCTGTTCCCCCTGCTCCCAGGGCACATG GTTGGGCTGTGTCAACCCTTAGGGCCTCCATGGGGTCAGTTGTCCCTTCT CACCTCCCAGCTCTGTCCCCATCAGGTCCCTGGGTGGCACGGGAGGATGG ACTGACTTCCAGGACCTGTTGTGTGACAGGAGCTACAGCTTGGGTCTCCC TGCAAGAAGTCTGGCACGTCTCACCTCCCCCATCCCGGCCCCTGGTCATC TCACAGCAAAGAAGCCTCCTCCCTCCCGACCTGCCGCCACACTGGAGAGG GGGCACAGGGGCGGGGGAGGTTTCCTGTTCTGTGAAAGGCCGACTCCCTG ACTCCATTCATGCCCCCCCCCCCAGCCCCTCCCTTCATTCCCATTCCCCA ACCTAAAGCCTGGCCCGGCTCCCAGCTGAATCTGGTCGGAATCCACGGGC TGCAGATTTTCCAAAACAATCGTTGTATCTTTATTGACTTTTTTTTTTTT TTTTTTCTGAATGCAATGACTGTTTTTTACTCTTAAGGAAAATAAACATC TTTTAGAAACAAAAAAAAAAAA

(73) The nucleic acid sequence, or CDS, for SREBF1 isoform c (GenBank Accession No. NM_001244003) is provided below.

(74) TABLE-US-00008 (SEQ ID NO: 32) ATGGACGAGCTGCCTTTCGGTGAGGCGGCTGTGGAACAGGCGCTGGACGA GCTGGGCGAACTGGACGCCGCACTGCTGACCGACATCCAAGACATGCTTC AGCTCATCAACAACCAAGACAGTGACTTCCCTGGCCTGTTTGATTCCCCC TATGCAGGGGGCGGGGCAGGAGACACAGAGCCCACCAGCCCTGGTGCCAA CTCTCCTGAGAGCTTGTCTTCTCCTGCTTCCCTGGGTTCCTCTCTGGAAG CCTTCCTGGGGGAACCCAAGGCAACACCTGCATCCTTGTCCCCTGTGCCG TCTGCATCCACTGCTTTAAAGATGTACCCGTCTGTGCCCCCCTTCTCCCC TGGGCCTGGAATCAAAGAAGAGCCAGTGCCACTCACCATCCTGCAGCCCC CAGCAGCACAGCCATCACCAGGGACCCTCCTGCCTCCGAGTTTCCCTCCA CCACCCCTGCAGCTCAGCCCGGCTCCTGTGCTGGGGTATTCTAGCCTTCC TTCAGGCTTCTCAGGGACCCTTCCTGGAAATACCCAACAGCCACCATCTA GCCTGTCACTGGCCTCTGCACCAGGAGTCTCGCCCATCTCTTTACACACC CAGGTCCAGAGCTCAGCCTCCCAGCAGCCACTGCCAGCCTCAACAGCCCC TAGAACAACCACTGTGACCTCACAGATCCAGCGGGTCCCAGTCGTACTGC AGCCACATTTCATCAAGGCAGATTCACTGCTACTGACAACTGTAAAAACA GATACAGGAGCCACGATGAAGACGGCTGGCATCAGTACCTTAGCCCCTGG CACAGCCGTGCAGGCAGGCCCCTTGCAGACCCTGGTGAGTGGTGGGACCA TCCTGGCCACAGTACCATTGGTTGTGGATACAGACAAACTGCCCATCCAT CGACTGGCAGCTGGCAGCAAGGCCCTGGGCTCAGCTCAGAGCCGTGGTGA GAAGCGCACAGCCCACAATGCCATTGAGAAGCGCTACCGTTCCTCTATCA ATGACAAGATTGTGGAGCTCAAAGACCTGGTGGTGGGCACTGAGGCAAAG CTGAATAAATCTGCCGTCTTGCGCAAGGCCATCGACTATATCCGCTTCTT ACAGCACAGCAACCAGAAGCTCAAGCAGGAGAACCTGGCCCTGCGAAATG CCGCTCACAAAAGCAAATCCCTGAAGGACCTGGTGTCGGCCTGTGGCAGT GCAGGAGGCACAGATGTGGCTATGGAGGGTGTGAAGCCTGAGGTGGTGGA TACGCTGACCCCTCCACCCTCAGACGCTGGCTCGCCCTCCCAGAGTAGCC CCTTGTCCCTCGGCAGCAGAGGTAGCAGCAGTGGTGGCAGTGACTCGGAG CCTGACAGCCCAGTCTTTGAGGATAGCCAGGTGAAAGCCCAACGGCTGCA CAGTCATGGCATGCTGGACCGCTCCCGCCTAGCCCTGTGTGCGCTGGTCT TCCTGTGTCTGACCTGCAACCCCTTGGCATCACTGTTTGGCTGGGGCATC CCCGGTCCCTCCAGTGCCTCTGGTGCACACCACAGCTCTGGGCGTAGCAT GCTGGAGGCCGAGAGCAGAGATGGCTCTAATTGGACCCAGTGGTTGCTGC CACCCCTAGTCTGGCTGGCCAATGGACTACTAGTGTTGGCCTGCCTGGCT CTTCTCTTTGTCTATGGGGAACCTGTGACCCGGCCACACACTAGCCCAGC TGTACACTTCTGGAGACATCGCAAACAGGCTGACCTGGACTTGGCTCGGG GAGATTTTGCCCAGGCTGCTCAGCAGCTGTGGCTGGCCCTGCAGGCATTG GGACGGCCCCTGCCCACCTCGAACCTAGACTTGGCCTGCAGCCTGCTTTG GAACCTCATCCGCCACCTGCTGCAGCGTCTCTGGGTTGGCCGCTGGCTGG CAGGCCGGGCTGGGGGCTTGCGGAGAGACTGTGGACTGAGAATGGATGCA CGTGCCAGTGCTCGAGATGCGGCTCTCGTCTACCATAAGCTGCACCAGCT GCATGCCATGGGCAAATACACAGGAGGGCACCTCATTGCTTCTAACCTGG CACTGAGTGCCCTGAACCTGGCCGAGTGCGCAGGAGATGCTGTATCCATG GCAACGCTGGCAGAGATCTATGTGGCTGCTGCCCTGAGGGTCAAGACCAG TCTCCCAAGAGCCTTGCACTTTTTGACACGTTTCTTCCTGAGTAGTGCCC GCCAGGCCTGCCTGGCACAGAGTGGCTCAGTGCCTCTTGCCATGCAGTGG CTCTGCCACCCTGTAGGCCACCGTTTCTTCGTGGATGGGGACTGGGCTGT GCATGGTGCCCCACAGGAGAGCCTGTACAGCGTGGCTGGGAACCCAGTGG ATCCCCTCGCCCAGGTGACTCGACTATTCTGCGAACATCTCTTGGAGAGA GCACTGAACTGTATTGCTCAACCCAGCCCGGGGACAGCTGATGGAGACAG GGAGTTCTCTGACGCACTTGGATACCTGCAGTTGCTAAATCGCTGCTCTG ATGCTGTCGGGACTCCTGCCTGCAGCTTCTCTGTCAGCTCCAGCATGGCT TCCACCACCGGCACAGACCCAGTGGCCAAGTGGTGGGCCTCACTGACGGC TGTGGTGATCCACTGGCTGCGGCGGGATGAAGAGGCAGCTGAGCGCCTAT ACCCGCTGGTAGAGCGTATGCCCCACGTGCTGCAGGAGACTGAGAGACCC CTGCCCAAGGCAGCTCTGTACTCCTTCAAGGCTGCCCGGGCTCTGCTGGA CCACAGAAAAGTGGAGTCTGGCCCAGCCAGCCTGGCCATCTGTGAGAAGG CCAGCGGGTACTTGCGGGACAGCTTAGCCGCTCCACCAACTGGCAGCTCC ATTGACAAGGCCATGCAGCTGCTCCTGTGTGATCTACTTCTTGTGGCCCG CACTAGTATGTGGCAGCGCCAGCAGTCACCAGCCTCAGCCCAGGTAGCTC ACAGTGCCAGCAATGGATCTCAGGCCTCCGCTTTGGAGCTTCGAGGTTTC CAACAGGACCTGAGCAGCCTGAGGCGCTTGGCACAGAACTTCCGGCCTGC TATGAGGAGAGTGTTCCTACACGAGGCCACAGCTCGGCTGATGGCAGGGG CAAGTCCTGCCCGGACACACCAGCTCCTGGACCGAAGTCTGCGGAGGCGG GCCGGCTCCAGTGGCAAAGGAGGCACTGTAGCTGAGCTGGAGCCTCGACC CACATGGCGGGAGCACACAGAGGCCTTGCTGCTGGCCTCCTGCTATCTGC CACCTGCCTTCCTGTCGGCCCCTGGACAGCAAATGAGCATGTTGGCTGAG GCAGCACGCACTGTAGAGAAGCTTGGTGATCATCGGCTACTGCTTGACTG CCAGCAGATGCTTCTGCGCCTGGGCGGTGGGACCACTGTCACTTCCAGCT AA

(75) The nucleic acid sequence, or mRNA sequence, for SREBF1 isoform c (GenBank Accession No. NM_001244003) is provided below.

(76) TABLE-US-00009 (SEQ ID NO: 33) CTCCTGCGAAGCCTGGCGGGCGCCGCCGCCATGGACGAGCTGCCTTTCGG TGAGGCGGCTGTGGAACAGGCGCTGGACGAGCTGGGCGAACTGGACGCCG CACTGCTGACCGACATCCAAGACATGCTTCAGCTCATCAACAACCAAGAC AGTGACTTCCCTGGCCTGTTTGATTCCCCCTATGCAGGGGGCGGGGCAGG AGACACAGAGCCCACCAGCCCTGGTGCCAACTCTCCTGAGAGCTTGTCTT CTCCTGCTTCCCTGGGTTCCTCTCTGGAAGCCTTCCTGGGGGAACCCAAG GCAACACCTGCATCCTTGTCCCCTGTGCCGTCTGCATCCACTGCTTTAAA GATGTACCCGTCTGTGCCCCCCTTCTCCCCTGGGCCTGGAATCAAAGAAG AGCCAGTGCCACTCACCATCCTGCAGCCCCCAGCAGCACAGCCATCACCA GGGACCCTCCTGCCTCCGAGTTTCCCTCCACCACCCCTGCAGCTCAGCCC GGCTCCTGTGCTGGGGTATTCTAGCCTTCCTTCAGGCTTCTCAGGGACCC TTCCTGGAAATACCCAACAGCCACCATCTAGCCTGTCACTGGCCTCTGCA CCAGGAGTCTCGCCCATCTCTTTACACACCCAGGTCCAGAGCTCAGCCTC CCAGCAGCCACTGCCAGCCTCAACAGCCCCTAGAACAACCACTGTGACCT CACAGATCCAGCGGGTCCCAGTCGTACTGCAGCCACATTTCATCAAGGCA GATTCACTGCTACTGACAACTGTAAAAACAGATACAGGAGCCACGATGAA GACGGCTGGCATCAGTACCTTAGCCCCTGGCACAGCCGTGCAGGCAGGCC CCTTGCAGACCCTGGTGAGTGGTGGGACCATCCTGGCCACAGTACCATTG GTTGTGGATACAGACAAACTGCCCATCCATCGACTGGCAGCTGGCAGCAA GGCCCTGGGCTCAGCTCAGAGCCGTGGTGAGAAGCGCACAGCCCACAATG CCATTGAGAAGCGCTACCGTTCCTCTATCAATGACAAGATTGTGGAGCTC AAAGACCTGGTGGTGGGCACTGAGGCAAAGCTGAATAAATCTGCCGTCTT GCGCAAGGCCATCGACTATATCCGCTTCTTACAGCACAGCAACCAGAAGC TCAAGCAGGAGAACCTGGCCCTGCGAAATGCCGCTCACAAAAGCAAATCC CTGAAGGACCTGGTGTCGGCCTGTGGCAGTGCAGGAGGCACAGATGTGGC TATGGAGGGTGTGAAGCCTGAGGTGGTGGATACGCTGACCCCTCCACCCT CAGACGCTGGCTCGCCCTCCCAGAGTAGCCCCTTGTCCCTCGGCAGCAGA GGTAGCAGCAGTGGTGGCAGTGACTCGGAGCCTGACAGCCCAGTCTTTGA GGATAGCCAGGTGAAAGCCCAACGGCTGCACAGTCATGGCATGCTGGACC GCTCCCGCCTAGCCCTGTGTGCGCTGGTCTTCCTGTGTCTGACCTGCAAC CCCTTGGCATCACTGTTTGGCTGGGGCATCCCCGGTCCCTCCAGTGCCTC TGGTGCACACCACAGCTCTGGGCGTAGCATGCTGGAGGCCGAGAGCAGAG ATGGCTCTAATTGGACCCAGTGGTTGCTGCCACCCCTAGTCTGGCTGGCC AATGGACTACTAGTGTTGGCCTGCCTGGCTCTTCTCTTTGTCTATGGGGA ACCTGTGACCCGGCCACACACTAGCCCAGCTGTACACTTCTGGAGACATC GCAAACAGGCTGACCTGGACTTGGCTCGGGGAGATTTTGCCCAGGCTGCT CAGCAGCTGTGGCTGGCCCTGCAGGCATTGGGACGGCCCCTGCCCACCTC GAACCTAGACTTGGCCTGCAGCCTGCTTTGGAACCTCATCCGCCACCTGC TGCAGCGTCTCTGGGTTGGCCGCTGGCTGGCAGGCCGGGCTGGGGGCTTG CGGAGAGACTGTGGACTGAGAATGGATGCACGTGCCAGTGCTCGAGATGC GGCTCTCGTCTACCATAAGCTGCACCAGCTGCATGCCATGGGCAAATACA CAGGAGGGCACCTCATTGCTTCTAACCTGGCACTGAGTGCCCTGAACCTG GCCGAGTGCGCAGGAGATGCTGTATCCATGGCAACGCTGGCAGAGATCTA TGTGGCTGCTGCCCTGAGGGTCAAGACCAGTCTCCCAAGAGCCTTGCACT TTTTGACACGTTTCTTCCTGAGTAGTGCCCGCCAGGCCTGCCTGGCACAG AGTGGCTCAGTGCCTCTTGCCATGCAGTGGCTCTGCCACCCTGTAGGCCA CCGTTTCTTCGTGGATGGGGACTGGGCTGTGCATGGTGCCCCACAGGAGA GCCTGTACAGCGTGGCTGGGAACCCAGTGGATCCCCTCGCCCAGGTGACT CGACTATTCTGCGAACATCTCTTGGAGAGAGCACTGAACTGTATTGCTCA ACCCAGCCCGGGGACAGCTGATGGAGACAGGGAGTTCTCTGACGCACTTG GATACCTGCAGTTGCTAAATCGCTGCTCTGATGCTGTCGGGACTCCTGCC TGCAGCTTCTCTGTCAGCTCCAGCATGGCTTCCACCACCGGCACAGACCC AGTGGCCAAGTGGTGGGCCTCACTGACGGCTGTGGTGATCCACTGGCTGC GGCGGGATGAAGAGGCAGCTGAGCGCCTATACCCGCTGGTAGAGCGTATG CCCCACGTGCTGCAGGAGACTGAGAGACCCCTGCCCAAGGCAGCTCTGTA CTCCTTCAAGGCTGCCCGGGCTCTGCTGGACCACAGAAAAGTGGAGTCTG GCCCAGCCAGCCTGGCCATCTGTGAGAAGGCCAGCGGGTACTTGCGGGAC AGCTTAGCCGCTCCACCAACTGGCAGCTCCATTGACAAGGCCATGCAGCT GCTCCTGTGTGATCTACTTCTTGTGGCCCGCACTAGTATGTGGCAGCGCC AGCAGTCACCAGCCTCAGCCCAGGTAGCTCACAGTGCCAGCAATGGATCT CAGGCCTCCGCTTTGGAGCTTCGAGGTTTCCAACAGGACCTGAGCAGCCT GAGGCGCTTGGCACAGAACTTCCGGCCTGCTATGAGGAGAGTGTTCCTAC ACGAGGCCACAGCTCGGCTGATGGCAGGGGCAAGTCCTGCCCGGACACAC CAGCTCCTGGACCGAAGTCTGCGGAGGCGGGCCGGCTCCAGTGGCAAAGG AGGCACTGTAGCTGAGCTGGAGCCTCGACCCACATGGCGGGAGCACACAG AGGCCTTGCTGCTGGCCTCCTGCTATCTGCCACCTGCCTTCCTGTCGGCC CCTGGACAGCAAATGAGCATGTTGGCTGAGGCAGCACGCACTGTAGAGAA GCTTGGTGATCATCGGCTACTGCTTGACTGCCAGCAGATGCTTCTGCGCC TGGGCGGTGGGACCACTGTCACTTCCAGCTAAACCTTGGATGGTCTCCCC AGTATTAGAGGCCCTTAAGGACCTTTGTCACTGGCTGTGGTCGTCCAGAG AGGGTGAGCCTGACAAGCAATCAGGATCATGCCGACCTCTAGTGACAAAT CTAGAAATTGCAGAGGCTGCACTGGCCCAATGCCACCCTCTTGCTCTGTA GGCACCTTTTTCCTGTCCTATGGAAAGGAACCTTTCCCCTAGCTGAGGGC CACCCTGTCCTGAGGCTCTCACCCACTCCTGGAAGACTTGTATATAGTGT AGATCCAGCTGAGCCAGTTTCCTGTGCAGGCTCATGTACTACTTTAACTT TTGCAAACTTTATTTTCATAGGTTGAGAAATTTTGTACAGAAAATTAAAA AGTGAAATTATTTATA

(77) The amino acid sequence for SREBF1 isoform c (GenBank Accession No. NM_001244003) is provided below.

(78) TABLE-US-00010 (SEQ ID NO: 34) MDELPFGEAAVEQALDELGELDAALLTDIQDMLQLINNQDSDFPGLFDSP YAGGGAGDTEPTSPGANSPESLSSPASLGSSLEAFLGEPKATPASLSPVP SASTALKMYPSVPPFSPGPGIKEEPVPLTILQPPAAQPSPGTLLPPSFPP PPLQLSPAPVLGYSSLPSGFSGTLPGNTQQPPSSLSLASAPGVSPISLHT QVQSSASQQPLPASTAPRTTTVTSQIQRVPVVLQPHFIKADSLLLTTVKT DTGATMKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIH RLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAK LNKSAVLRKAIDYIRFLQHSNQKLKQENLALRNAAHKSKSLKDLVSACGS AGGTDVAMEGVKPEVVDTLTPPPSDAGSPSQSSPLSLGSRGSSSGGSDSE PDSPVFEDSQVKAQRLHSHGMLDRSRLALCALVFLCLTCNPLASLFGWGI PGPSSASGAHHSSGRSMLEAESRDGSNWTQWLLPPLVWLANGLLVLACLA LLFVYGEPVTRPHTSPAVHFWRHRKQADLDLARGDFAQAAQQLWLALQAL GRPLPTSNLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLRRDCGLRMDA RASARDAALVYHKLHQLHAMGKYTGGHLIASNLALSALNLAECAGDAVSM ATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPLAMQW LCHPVGHRFFVDGDWAVHGAPQESLYSVAGNPVDPLAQVTRLFCEHLLER ALNCIAQPSPGTADGDREFSDALGYLQLLNRCSDAVGTPACSFSVSSSMA STTGTDPVAKWWASLTAVVIHWLRRDEEAAERLYPLVERMPHVLQETERP LPKAALYSFKAARALLDHRKVESGPASLAICEKASGYLRDSLAAPPTGSS IDKAMQLLLCDLLLVARTSMWQRQQSPASAQVAHSASNGSQASALELRGF QQDLSSLRRLAQNFRPAMRRVFLHEATARLMAGASPARTHQLLDRSLRRR AGSSGKGGTVAELEPRPTWREHTEALLLASCYLPPAFLSAPGQQMSMLAE AARTVEKLGDHRLLLDCQQMLLRLGGGTTVTSS

(79) The nucleic acid sequence, or mRNA sequence, for truncated SREBF1 isoform c (GenBank Accession No. NM_001244003), e.g., SREB411, is provided below.

(80) TABLE-US-00011 (SEQ ID NO: 35) atggacgagctgcctttcggtgaggcggctgtggaacaggcgctggacga gctgggcgaactggacgccgcactgctgaccgacatccaagacatgcttc agctcatcaacaaccaagacagtgacttccctggcctgtttgattccccc tatgcagggggcggggcaggagacacagagcccaccagccctggtgccaa ctctcctgagagcttgtcttctcctgcttccctgggttcctctctggaag ccttcctgggggaacccaaggcaacacctgcatccttgtcccctgtgccg tctgcatccactgctttaaagatgtacccgtctgtgccccccttctcccc tgggcctggaatcaaagaagagccagtgccactcaccatcctgcagcccc cagcagcacagccatcaccagggaccctcctgcctccgagtttccctcca ccacccctgcagctcagcccggctcctgtgctggggtattctagccttcc ttcaggcttctcagggacccttcctggaaatacccaacagccaccatcta gcctgtcactggcctctgcaccaggagtctcgcccatctctttacacacc caggtccagagctcagcctcccagcagccactgccagcctcaacagcccc tagaacaaccactgtgacctcacagatccagcgggtcccagtcgtactgc agccacatttcatcaaggcagattcactgctactgacaactgtaaaaaca gatacaggagccacgatgaagacggctggcatcagtaccttagcccctgg cacagccgtgcaggcaggccccttgcagaccctggtgagtggtgggacca tcctggccacagtaccattggttgtggatacagacaaactgcccatccat cgactggcagctggcagcaaggccctgggctcagctcagagccgtggtga gaagcgcacagcccacaatgccattgagaagcgctaccgttcctctatca atgacaagattgtggagctcaaagacctggtggtgggcactgaggcaaag ctgaataaatctgccgtcttgcgcaaggccatcgactatatccgcttctt acagcacagcaaccagaagctcaagcaggagaacctggccctgcgaaatg ccgctcacaaaagcaaatccctgaaggacctggtgtcggcctgtggcagt gcaggaggcacagatgtggctatggagggtgtg

(81) The amino acid sequence for truncated SREBF1 isoform c (GenBank Accession No. NM_001244003), e.g., SREB411, is provided below.

(82) TABLE-US-00012 (SEQ ID NO: 36) MDELPFGEAAVEQALDELGELDAALLTDIQDMLQLINNQDSDFPGLFDSP YAGGGAGDTEPTSPGANSPESLSSPASLGSSLEAFLGEPKATPASLSPVP SASTALKMYPSVPPFSPGPGIKEEPVPLTILQPPAAQPSPGTLLPPSFPP PPLQLSPAPVLGYSSLPSGFSGTLPGNTQQPPSSLSLASAPGVSPISLHT QVQSSASQQPLPASTAPRTTTVTSQIQRVPVVLQPHFIKADSLLLTTVKT DTGATMKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIH RLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAK LNKSAVLRKAIDYIRFLQHSNQKLKQENLALRNAAHKSKSLKDLVSACGS AGGTDVAMEGV

(83) In one embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the amino acid sequence of an isoform of SREBF1; e.g., SEQ ID NOs: 28, 30, 34, or 36; or differs by 1, 2, or 3 or more amino acid residues but no more than 50, 40, 30, 20, 15, or 10 amino acid residues from the amino acid sequence of an isoform of SREBF1; e.g., SEQ ID NOs: 28, 30, 34, or 36.

(84) In one embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the amino acid sequence of SREBF1; e.g., SEQ ID NO: 34; or differs by 1, 2, or 3 or more amino acid residues but no more than 50, 40, 30, 20, 15, or 10 amino acid residues from the amino acid sequence of SREBF1, e.g., SEQ ID NO: 34.

(85) In another embodiment, the LMM comprises a functional fragment of SREBF1 or an isoform thereof, e.g., a truncated SREBF1. In one embodiment, the LMM comprises a functional fragment of SREBF1, e.g., a functional fragment of SEQ ID NOs: 1 or 34, or a functional fragment of an SREBF1 isoform, e.g., SEQ ID NOs: 28, 30, or 36. In one embodiment, the LMM comprises a functional domain of SREBF1, e.g., the transactivation domain of SREBF1. In one embodiment, the LMM comprises the helix-loop-helix (HLH) domain of SREBF1. In one embodiment, the LMM comprises a functional fragment of SREBF1 that is capable of translocating into the nucleus and/or capable of initiating transcription of SREBF1 target genes.

(86) In one embodiment, the LMM comprises the N-terminal 410 amino acids of SREBF1 (also referred to herein as SREBF410), e.g., amino acids 1-410 of SEQ ID NO: 1. The amino acid sequence of the N-terminal 410 amino acids of SREBF1 is provided below:

(87) TABLE-US-00013 (SEQ ID NO: 26) MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAP YAGGETGDTGPSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPS APAALKMYPSVSPFSPGPGIKEEPVPLTILQPAAPQPSPGTLLPPSFPAP PVQLSPAPVLGYSSLPSGFSGTLPGNTQQPPSSLPLAPAPGVLPTPALHT QVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKADSLLLTAVKT DAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIH RLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAK LNKSAVLRKAIDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSG GGTDVSMEGM

(88) In one embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the amino acid sequence of the N-terminal 410 amino acids of SREBF1; e.g., SEQ ID NO: 26; or differs by 1, 2, or 3 or more amino acid residues but no more than 50, 40, 30, 20, 15, or 10 amino acid residues from the amino acid sequence of the N-terminal 410 amino acids of SREBF1; e.g., SEQ ID NO: 26.

(89) In another embodiment, the LMM comprises amino acids 91-410 of SREBF1, e.g., amino acids 91-410 of SEQ ID NO: 1. The amino acid sequence of the amino acids at positions 91-410 of SREBF1 is provided below:

(90) TABLE-US-00014 (SEQ ID NO: 27) MPAPLSPPPSAPAALKMYPSVSPFSPGPGIKEEPVPLTILQPAAPQPSPG TLLPPSFPAPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQPPSSLPLAPAP GVLPTPALHTQVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKA DSLLLTAVKTDAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPL VVDTDKLPIHRLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVEL KDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLTLRSAHKSKSL KDLVSACGSGGGTDVSMEGM

(91) In one embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the amino acid sequence at positions 91-410 of SREBF1; e.g., SEQ ID NO: 27; or differs by 1, 2, or 3 or more amino acid residues but no more than 50, 40, 30, 20, 15, or 10 amino acid residues from the amino acid sequence at positions 91-410 of SREBF1; e.g., SEQ ID NO: 27. In one embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the nucleic acid sequence encoding SREBF1 or a functional fragment thereof; e.g., encoding the amino acid sequence SEQ ID NO: 1 or a functional fragment thereof. In one embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the nucleic acid of SEQ ID NO: 2.

(92) In another embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with SREBF2 or a functional fragment thereof; or differs by 1, 2, or 3 or more amino acid residues but no more than 50, 40, 30, 20, 15, or 10 amino acid residues from SREBF2 or a functional fragment thereof.

(93) In one embodiment, the LMM comprises an enzyme. In one embodiment, the LMM comprises an enzyme that converts saturated fatty acids to unsaturated fatty acids. In one embodiment, the LMM comprises an enzyme that converts saturated fatty acids to monounsaturated fatty acids, e.g., fatty acids with one double bond. In one embodiment, the LMM comprises an enzyme that converts saturated fatty acids to polyunsaturated fatty acids, e.g., fatty acids with more than one, e.g., 2, 3, 4, 5, or more, double bonds. In one embodiment, the LMM comprises stearoyl CoA desaturase 1 (SCD1), stearoyl CoA desaturase 2 (SCD2), stearoyl CoA desaturase 3 (SCD3), stearoyl CoA desaturase 4 (SCD4), stearoyl CoA desaturase 5 (SCD5), an isoform thereof, or a functional fragment thereof.

(94) SCD1 is the rate limiting enzyme responsible for the conversion of saturated fatty acids (SFA) to monounsaturated fatty acids (MUFA). Increased focus has been placed upon SCD1 in recent years due to studies linking expression of this gene to increased cell survival, proliferation and tumorigenesis properties (Angelucci, Maulucci et al. 2015) (Igal 2011). SCD1 has also been shown to play key roles in both cellular metabolic rate control and overall lipogenesis. The latter is controlled through direct interactions with a major biosynthetic pathway regulator acetyl-CoA carboxylase (ACC) as well as conversion of SFA to MUFA which, since SFA is known to inhibit ACC, facilitates enzyme functionality to increase lipid biosynthesis (Igal 2010). The main regulation of SCD1 is through transcriptional activation whereby transcription factors, such as SREBF1, bind to the SRE sequence in the promoter region of the gene. SCD1 is endogenously located in the ER as a membrane integral protein, where SCD1 carries out its enzymatic function of catalyzing the conversion of SFA to MUFA. Its role in conversion of SFA to MUFA (e.g., upregulation of the ratio of MUFA to SFA) can regulate a decrease in lipid raft domains, which can in turn result in increased membrane fluidity. This change in membrane fluidity and membrane lipid composition may also have implications in vesicle formation and thus cellular communication and ER size or morphology (e.g., ER expansion). Knockdown of the SCD1 gene has also been shown to upregulate the unfolded protein response (Ariyama, Kono et al. 2010). Furthermore, SCD1 negatively regulates cellular palmitic acid which, in turn, is a strong negative regulator of ACC. SCD1 also controls the phosphorylation status of AMP activated protein kinase (AMPK), consequentially reducing its ability to phosphorylate and therefore inhibit ACC; a rate-limiting enzyme in the lipid synthesizing process. Lastly, desaturation of SFA prevents its accumulation which can cause cell death. As such, modulation of SCD1 results in increased lipid biosynthesis, cell survival and proliferation rates. (Hagen, Rodriguez-Cuenca et al.), (Scaglia, Chisholm et al. 2009).

(95) In one embodiment, the LMM comprises SCD1. The amino acid sequence of SCD1 is provided below:

(96) TABLE-US-00015 (SEQ ID NO: 3) MPAHMLQEISSSYTTTTTITAPPSGNEREKVKTVPLHLEEDIRPEMKEDI HDPTYQDEEGPPPKLEYVWRNIILMVLLHLGGLYGIILVPSCKLYTCLFG IFYYMTSALGITAGAHRLWSHRTYKARLPLRIFLIIANTMAFQNDVYEWA RDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGGKLDMSD LKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGETFVNSLFVSTFLRY TLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHTF PFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDG SHKSS
The nucleotide sequence of SCD1 is provided below:

(97) TABLE-US-00016 (SEQ ID NO: 4) atgccggcccacatgctccaagagatctccagttcttacacgaccaccac caccatcactgcacctccctccggaaatgaacgagagaaggtgaagacgg tgcccctccacctggaagaagacatccgtcctgaaatgaaagaagatatt cacgaccccacctatcaggatgaggagggacccccgcccaagctggagta cgtctggaggaacatcattctcatggtcctgctgcacttgggaggcctgt acgggatcatactggttccctcctgcaagctctacacctgcctcttcggg attttctactacatgaccagcgctctgggcatcacagccggggctcatcg cctctggagccacagaacttacaaggcacggctgcccctgcggatcttcc ttatcattgccaacaccatggcgttccagaatgacgtgtacgaatgggcc cgagatcaccgcgcccaccacaagttctcagaaacacacgccgaccctca caattcccgccgtggcttcttcttctctcacgtgggttggctgcttgtgc gcaaacacccggctgtcaaagagaagggcggaaaactggacatgtctgac ctgaaagccgagaagctggtgatgttccagaggaggtactacaagcccgg cctcctgctgatgtgcttcatcctgcccacgctggtgccctggtactgct ggggcgagacttttgtaaacagcctgttcgttagcaccttcttgcgatac actctggtgctcaacgccacctggctggtgaacagtgccgcgcatctcta tggatatcgcccctacgacaagaacattcaatcccgggagaatatcctgg tttccctgggtgccgtgggcgagggcttccacaactaccaccacaccttc cccttcgactactctgccagtgagtaccgctggcacatcaacttcaccac gttcttcatcgactgcatggctgccctgggcctggcttacgaccggaaga aagtttctaaggctactgtcttagccaggattaagagaactggagacggg agtcacaagagtagctga

(98) In one embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the amino acid sequence of SCD1; e.g., SEQ ID NO: 3; or differs by 1, 2, or 3 or more amino acid residues but no more than 50, 40, 30, 20, 15, or 10 amino acid residues from the amino acid sequence of SCD1, e.g., SEQ ID NO: 3. In one embodiment, the LMM comprises a functional fragment of SCD1, e.g., a functional fragment of SEQ ID NO: 3.

(99) In one embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the nucleic acid sequence encoding SCD1 or a functional fragment thereof; e.g., encoding the amino acid sequence SEQ ID NO: 3 or a functional fragment thereof. In one embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the nucleic acid of SEQ ID NO: 4.

(100) In another embodiment, the LMM comprises at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity with the amino acid sequence of SCD2, SCD3, SCD4, SCD5, or a functional fragment thereof; or differs by 1, 2, or 3 or more amino acid residues but no more than 50, 40, 30, 20, 15, or 10 amino acid residues from the amino acid sequence of SCD2, SCD3, SCD4, SCD5, or a functional fragment thereof. In another embodiment, the LMM comprises at least

(101) In another embodiment, the LMM comprises a functional fragment of SCD1, SCD2, SCD3, SCD4, or SCD5, e.g., a truncated SCD1, SCD2, SCD3, SCD4, or SCD5. In one embodiment, the LMM comprises a functional fragment of SCD1, SCD2, SCD3, SCD4, or SCD5, e.g., a functional fragment of SEQ ID NO: 3. In one embodiment, the LMM comprises a functional domain of SCD1, SCD2, SCD3, SCD4, or SCD5, e.g., a domain having enzymatic activity for converting saturated fatty acids to monounsaturated fatty acids.

(102) Percent identity in the context of two or more amino acid or nucleic acid sequences, refers to two or more sequences that are the same. Two sequences are substantially identical if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (e.g., 60% identity, optionally 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity over a specified region, or, when not specified, over the entire sequence, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. In some embodiments, alignment may result in gaps or inserted sequences, in which sequence similarity can be determined for specified regions flanking the gaps or inserted sequences, or sequence similarity can be determined across a region that includes the gaps or inserted sequences. Optionally, the identity exists over a region that is at least about 50 amino acids or nucleotides, 100 amino acids or nucleotides, 150 amino acids or nucleotides, in length. More preferably, the identity exists over a region that is about 200 or more amino acids or nucleotides, or about 500 or 1000 or more amino acids or nucleotides, in length.

(103) For sequence comparison, one sequence typically acts as a reference sequence, to which one or more test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch, (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman, (1988) Proc. Nat'l. Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Brent et al., (2003) Current Protocols in Molecular Biology). Multiple sequence alignments can be performed by algorithms such as ClustalW, Clustal Omega, and MAFFT. Other algorithms for comparing relationships between two or more sequences include the Hidden Markov models. A hidden Markov Model is a model that describes the probability of a having a particular nucleotide (or amino acid) type following another (the probability path being hidden).

(104) It is really a probabilistic model not an algorithm. Example of an algorithm (or program implementing the algorithm) might be HMMER (http://hmmer.org/).

(105) Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., (1977) Nuc. Acids Res. 25:3389-3402; and Altschul et al., (1990) J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (NCBI).

(106) Products

(107) Provided herein are methods and compositions for engineering or making a cell or a cell-free expression system capable of producing high yields of a product and/or improved product quality. Products described herein include polypeptides, e.g., recombinant proteins; nucleic acid molecules, e.g., DNA or RNA molecules; multimeric proteins or complexes; lipid-encapsulated particles, e.g., virus-like particles, vesicles, or exosomes; or other molecules, e.g., lipids. In an embodiment, the product is a polypeptide, e.g., a recombinant polypeptide. In an embodiment, the product is an exosome. For example, the recombinant polypeptide can be a difficult to express protein or a protein having complex and/or non-natural structures, such as a next generation biologic, e.g., a bispecific antibody molecule, a fusion protein, or a glycosylated protein.

(108) In embodiments, the cell or cell line generated by the methods or compositions described herein produces a product, e.g., a recombinant polypeptide, useful in the treatment of a medical condition, disorder or disease. Examples of medical conditions, disorders or diseases include, but are not limited to, metabolic disease or disorders (e.g., metabolic enzyme deficiencies), endocrine disorders (e.g., hormone deficiencies), dysregulation of hemostasis, thrombosis, hematopoietic disorders, pulmonary disorders, gastro-intestinal disorders, autoimmune diseases, immuno-dysregulation (e.g., immunodeficiency), infertility, transplantation, cancer, and infectious diseases.

(109) In embodiments, the product is an exogenous protein, e.g., a protein that is not naturally expressed by the cell. In one embodiment, the protein is from one species while the cell is from a different species. In another embodiment, the protein is a non-naturally occurring protein.

(110) In other embodiments, the product is a protein that is endogenously expressed by the cell. In one embodiment, the product is a protein that is endogenously expressed by the cell at endogenous or natural levels. The present methods and compositions described herein are used to increase the production and quality of the endogenous product, e.g., a naturally occurring product that is naturally produced by the cell. In another embodiment, an exogenous nucleic acid encoding the product, e.g., protein, is introduced to and expressed by the cell. In another embodiment, an exogenous nucleic acid that increases the expression of a product that is endogenously expressed by the cell is introduced into the cell. By way of example, the exogenous nucleic acid comprises a sequence that activates the promoter (e.g., SRF promoter sequence, see e.g., The transcription factor Ap-1 regulates monkey 20-hydroxysteroid dehydrogenase promoter activity in CHO cells. Nanjidsuren T, Min K S. BMC Biotechnol. 2014 Jul. 30; 14:71. doi: 10.1186/1472-6750-14-71.PMID: 25073972) that controls the expression of an endogenous product of the cell.

(111) The recombinant product can be a therapeutic product or a diagnostic product, e.g., useful for drug screening. The therapeutic or diagnostic product can include, but is not limited to, an antibody molecule, e.g., an antibody or an antibody fragment, a fusion protein, a hormone, a cytokine, a growth factor, an enzyme, a glycoprotein, a lipoprotein, a reporter protein, a therapeutic peptide, or a structural and/or functional fragment or hybrid of any of these. In other embodiments, the therapeutic or diagnostic product is a synthetic polypeptide, e.g., wherein the entire polypeptide or portions thereof is not derived from or has any sequence or structural similarity to any naturally occurring polypeptide, e.g., a naturally occurring polypeptide described above.

(112) In one embodiment, the recombinant product is an antibody molecule. In one embodiment, the recombinant product is a therapeutic antibody molecule. In another embodiment, the recombinant product is a diagnostic antibody molecule, e.g., a monoclonal antibody useful for imaging techniques or diagnostic tests.

(113) An antibody molecule, as used herein, is a protein, or polypeptide sequence derived from an immunoglobulin molecule which specifically binds with an antigen. In an embodiment, the antibody molecule is a full-length antibody or an antibody fragment. Antibodies and multiformat proteins can be polyclonal or monoclonal, multiple or single chain, or intact immunoglobulins, and may be derived from natural sources or from recombinant sources. Antibodies can be tetramers of immunoglobulin molecules. In an embodiment, the antibody is a monoclonal antibody. The antibody may be a human or humanized antibody. In one embodiment, the antibody is an IgA, IgG, IgD, or IgE antibody. In one embodiment, the antibody is an IgG1, IgG2, IgG3, or IgG4 antibody.

(114) Antibody fragment refers to at least one portion of an intact antibody, or recombinant variants thereof, and refers to the antigen binding domain, e.g., an antigenic determining variable region of an intact antibody, that is sufficient to confer recognition and specific binding of the antibody fragment to a target, such as an antigen. Examples of antibody fragments include, but are not limited to, Fab, Fab, F(ab).sub.2, and Fv fragments, scFv antibody fragments, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, and multi-specific antibodies formed from antibody fragments such as a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region, and an isolated CDR or other epitope binding fragments of an antibody. An antigen binding fragment can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, Nature Biotechnology 23:1126-1136, 2005). Antigen binding fragments can also be grafted into scaffolds based on polypeptides such as a fibronectin type III (Fn3)(see U.S. Pat. No. 6,703,199, which describes fibronectin polypeptide minibodies).

(115) Exemplary recombinant products that can be produced using the methods described herein include, but are not limited to, those provided in the tables below.

(116) TABLE-US-00017 TABLE 2 Exemplary Recombinant Products Therapeutic Protein type Therapeutic Trade Name Hormone Erythropoietin, Epoein- Epogen, Procrit Darbepoetin- Aranesp Insulin Humulin, Novolin Growth hormone (GH), Genotropin, Humatrope, Norditropin, NovIVitropin, somatotropin Nutropin, Omnitrope, Protropin, Siazen, Serostim, Valtropin Human follicle-stimulating Gonal-F, Follistim hormone (FSH) Human chorionic gonadotropin Ovidrel Lutropin- Luveris Glucagon GlcaGen Growth hormone releasing Geref hormone (GHRH) ChiRhoStim (human peptide), SecreFlo (porcine Secretin peptide) Thyroid stimulating hormone Thyrogen (TSH), thyrotropin Blood Factor VIIa NovoSeven Clotting/Coagulation Factor VIII Bioclate, Helixate, Kogenate, Recombinate, ReFacto Factors Factor IX Benefix Antithrombin III (AT-III) Thrombate III Protein C concentrate Ceprotin Cytokine/Growth Type I alpha-interferon Infergen factor Interferon-n3 (IFNn3) Alferon N Interferon-1a (rIFN-) Avonex, Rebif Interferon-1b (rIFN-) Betaseron Interferon-1b (IFN ) Actimmune Aldesleukin (interleukin 2(IL2), Proleukin epidermal theymocyte activating factor; ETAF Palifermin (keratinocyte growth Kepivance factor; KGF) Becaplemin (platelet-derived RegranexAnril, Kineret growth factor; PDGF) Anakinra (recombinant IL1 antagonist) Antibody molecules Bevacizumab (VEGFA mAb) Avastin Cetuximab (EGFR mAb) Erbitux Panitumumab (EGFR mAb) Vectibix Alemtuzumab (CD52 mAb) Campath Rituximab (CD20 chimeric Ab) Rituxan Trastuzumab (HER2/Neu mAb) Herceptin Abatacept (CTLA Ab/Fc fusion) Orencia Adalimumab (TNF mAb) Humira Infliximab (TNF chimeric mAb) Remicade Alefacept (CD2 fusion protein) Amevive Efalizumab (CD11a mAb) Raptiva Natalizumab (integrin 4 subunit Tysabri mAb) Eculizumab (C5mAb) Soliris Muromonab-CD3 Orthoclone, OKT3 Other: Hepatitis B surface antigen Engerix, Recombivax HB Fusion (HBsAg) proteins/Protein HPV vaccine Gardasil vaccines/Peptides OspA LYMErix Anti-Rhesus(Rh) immunoglobulin G Rhophylac Enfuvirtide Fuzeon Spider silk, e.g., fibrion QMONOS Etanercept (TNF receptor/Fc Enbrel fusion) Cergutuzumab Amunaleukin

(117) TABLE-US-00018 TABLE 3 Additional Exemplary Recombinant Products: Bispecific Formats Name (other names, sponsoring Proposed mechanisms Development Diseases (or organizations) BsAb format Targets of action stages healthy volunteers) Catumaxomab BsIgG: CD3, Retargeting of T cells to Approved in Malignant ascites in (Removab, Fresenius Triomab EpCAM tumor, Fc mediated EU EpCAM positive Biotech, Trion Pharma, effector functions tumors Neopharm) Ertumaxomab (Neovii BsIgG: CD3, HER2 Retargeting of T cells to Phase I/II Advanced solid Biotech, Fresenius Triomab tumor tumors Biotech) Blinatumomab BiTE CD3, CD19 Retargeting of T cells to Approved in Precursor B-cell (Blincyto, AMG 103, tumor USA ALL MT 103, MEDI 538, Phase II and ALL Amgen) III DLBCL Phase II NHL Phase I REGN1979 (Regeneron) BsAb CD3, CD20 Solitomab (AMG 110, BiTE CD3, Retargeting of T cells to Phase I Solid tumors MT110, Amgen) EpCAM tumor MEDI 565 (AMG 211, BiTE CD3, CEA Retargeting of T cells to Phase I Gastrointestinal MedImmune, Amgen) tumor adenocancinoma RO6958688 (Roche) BsAb CD3, CEA BAY2010112 (AMG BiTE CD3, PSMA Retargeting of T cells to Phase I Prostate cancer 212, Bayer; Amgen) tumor MGD006 (Macrogenics) DART CD3, CD123 Retargeting of T cells to Phase I AML tumor MGD007 (Macrogenics) DART CD3, gpA33 Retargeting of T cells to Phase I Colorectal cancer tumor MGD011 (Macrogenics) DART CD19, CD3 SCORPION (Emergent BsAb CD3, CD19 Retargeting of T cells to Biosolutions, Trubion) tumor AFM11 (Affimed TandAb CD3, CD19 Retargeting of T cells to Phase I NHL and ALL Therapeutics) tumor AFM12 (Affimed TandAb CD19, CD16 Retargeting of NK cells Therapeutics) to tumor cells AFM13 (Affimed TandAb CD30, Retargeting of NK cells Phase II Hodgkin's Therapeutics) CD16A to tumor cells Lymphoma GD2 (Barbara Ann T cells CD3, GD2 Retargeting of T cells to Phase I/II Neuroblastoma and Karmanos Cancer preloaded tumor osteosarcoma Institute) with BsAb pGD2 (Barbara Ann T cells CD3, Her2 Retargeting of T cells to Phase II Metastatic breast Karmanos Cancer preloaded tumor cancer Institute) with BsAb EGFRBi-armed T cells CD3, EGFR Autologous activated T Phase I Lung and other autologous activated T preloaded cells to EGFR-positive solid tumors cells (Roger Williams with BsAb tumor Medical Center) Anti-EGFR-armed T cells CD3, EGFR Autologous activated T Phase I Colon and activated T-cells preloaded cells to EGFR-positive pancreatic cancers (Barbara Ann Karmanos with BsAb tumor Cancer Institute) rM28 (University Tandem scFv CD28, Retargeting of T cells to Phase II Metastatic Hospital Tubingen) MAPG tumor melanoma IMCgp100 ImmTAC CD3, peptide Retargeting of T cells to Phase I/II Metastatic (Immunocore) MHC tumor melanoma DT2219ARL (NCI, 2 scFv linked CD19, CD22 Targeting of protein Phase I B cell leukemia University of Minnesota) to diphtheria toxin to tumor or lymphoma toxin XmAb5871 (Xencor) BsAb CD19, CD32b NI-1701 (NovImmune) BsAb CD47, CD19 MM-111 (Merrimack) BsAb ErbB2, ErbB3 MM-141 (Merrimack) BsAb IGF-1R, ErbB3 NA (Merus) BsAb HER2, HER3 NA (Merus) BsAb CD3, CLEC12A NA (Merus) BsAb EGFR, HER3 NA (Merus) BsAb PD1, undisclosed NA (Merus) BsAb CD3, undisclosed Duligotuzumab DAF EGFR, HER3 Blockade of 2 receptors, Phase I and II Head and neck (MEHD7945A, ADCC Phase II cancer Genentech, Roche) Colorectal cancer LY3164530 (Eli Lily) Not disclosed EGFR, MET Blockade of 2 receptors Phase I Advanced or metastatic cancer MM-111 (Merrimack HSA body HER2, HER3 Blockade of 2 receptors Phase II Gastric and Pharmaceuticals) Phase I esophageal cancers Breast cancer MM-141, (Merrimack IgG-scFv IGF-1R, Blockade of 2 receptors Phase I Advanced solid Pharmaceuticals) HER3 tumors RG7221 (RO5520985, CrossMab Ang2, VEGF A Blockade of 2 Phase I Solid tumors Roche) proangiogenics RG7716 (Roche) CrossMab Ang2, VEGF A Blockade of 2 Phase I Wet AMD proangiogenics OMP-305B83 BsAb DLL4/VEGF (OncoMed) TF2 (Immunomedics) Dock and CEA, HSG Pretargeting tumor for Phase II Colorectal, breast lock PET or radioimaging and lung cancers ABT-981 (AbbVie) DVD-Ig IL-1, IL-1 Blockade of 2 Phase II Osteoarthritis proinflammatory cytokines ABT-122 (AbbVie) DVD-Ig TNF, IL-17A Blockade of 2 Phase II Rheumatoid proinflammatory arthritis cytokines COVA322 IgG-fynomer TNF, IL17A Blockade of 2 Phase I/II Plaque psoriasis proinflammatory cytokines SAR156597 (Sanofi) Tetravalent IL-13, IL-4 Blockade of 2 Phase I Idiopathic bispecific proinflammatory pulmonary fibrosis tandem IgG cytokines G5K2434735 Dual- IL-13, IL-4 Blockade of 2 Phase I (Healthy (GSK) targeting proinflammatory volunteers) domain cytokines Ozoralizumab (ATN103, Nanobody TNF, HSA Blockade of Phase II Rheumatoid Ablynx) proinflammatory arthritis cytokine, binds to HSA to increase half-life ALX-0761 (Merck Nanobody IL-17A/F, Blockade of 2 Phase I (Healthy Serono, Ablynx) HSA proinflammatory volunteers) cytokines, binds to HSA to increase half-life ALX-0061 (AbbVie, Nanobody IL-6R, HSA Blockade of Phase I/II Rheumatoid Ablynx; proinflammatory arthritis cytokine, binds to HSA to increase half-life ALX-0141 (Ablynx, Nanobody RANKL, Blockade of bone Phase I Postmenopausal Eddingpharm) HSA resorption, binds to bone loss HSA to increase half- life RG6013/ACE910 ART-Ig Factor IXa, Plasma coagulation Phase II Hemophilia (Chugai, Roche) factor X

(118) In one embodiment, the product differs from a polypeptide from Table 2 or 3 at no more than 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 amino acid residues. In another embodiment, the product differs from a polypeptide from Table 2 or 3 at no more than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, or 15% of its amino acid residues.

(119) In one embodiment, the product is a nucleic acid molecule, e.g., a DNA or RNA molecule, or hybrid thereof. In one embodiment, the product is an origami nucleic acid molecule, e.g., an origami DNA, in which the nucleic acid molecule has a predetermined secondary, tertiary, or quaternary structure. In one embodiment, the origami nucleic acid molecule has functional activity. In one embodiment, the product comprises an origami nucleic acid molecule encapsulated in a lipid membrane. In one embodiment, the lipid membrane comprises the cell membrane or components of the cell membrane of the host cell from which it was produced. In one embodiment, the lipid-encapsulated DNA is as described in Cloaked DNA nanodevices survive pilot mission, Apr. 22, 2014, Wyss Institute for Biologically Inspired Engineering at Harvard University website.

(120) Other recombinant products include non-antibody scaffolds or alternative protein scaffolds, such as, but not limited to: DARPins, affibodies and adnectins.

(121) Other exemplary therapeutic or diagnostic proteins include, but are not limited to any protein described in Tables 1-10 of Leader et al., Protein therapeutics: a summary and pharmacological classification, Nature Reviews Drug Discovery, 2008, 7:21-39 and as described in Walsh, Biopharmaceutical benchmarks 2014, Nature Biotechnology, 2014, 32:992-1000 (each incorporated herein by reference); or any conjugate, variant, analog, or functional fragment of the recombinant polypeptides described herein.

(122) Nucleic Acids

(123) Also provided herein are nucleic acids, e.g., exogenous nucleic acids, that encode the lipid metabolism modulators and the recombinant products described herein. The nucleic acid sequences coding for the desired LMM or recombinant product, e.g., recombinant polypeptides, can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the desired nucleic acid sequence, e.g., gene, by deriving the nucleic acid sequence from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques. Alternatively, the nucleic acid encoding the LMM or recombinant polypeptide can be produced synthetically, rather than cloned. Recombinant DNA techniques and technology are highly advanced and well established in the art. Accordingly, the ordinarily skilled artisan having the knowledge of the amino acid sequence of a recombinant polypeptide described herein can readily envision or generate the nucleic acid sequence that would encode the LMM or the recombinant polypeptide.

(124) Exemplary nucleic acid sequences encoding the LMM SREBF1 and SCD1 are provided as SEQ ID NO: 3 and SEQ ID NO: 4, respectively, herein.

(125) The expression of a desired polypeptide, e.g., a LMM or a recombinant polypeptide, is typically achieved by operably linking a nucleic acid encoding the desired polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector. The vectors can be suitable for replication and integration into eukaryotic or prokaryotic cells. Typical cloning vectors contain other regulatory elements, such as transcription and translation terminators, initiation sequences, promoters, selection markers, or tags useful for regulation or identification of the expression of the desired nucleic acid sequence.

(126) The nucleic acid sequence encoding the LMM or recombinant polypeptide can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors. In embodiments, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1-4, Cold Spring Harbor Press, NY), and in other virology and molecular biology manuals. Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193). Vectors derived from viruses are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.

(127) A vector may also include, in any of the embodiments described herein, one or more of the following: a signal sequence to facilitate secretion, a polyadenylation signal, a transcription terminator (e.g., from Bovine Growth Hormone (BGH) gene), an element allowing episomal replication and replication in prokaryotes (e.g. SV40 origin and ColE1 or others known in the art), and/or elements to allow selection, e.g., a selection marker or a reporter gene.

(128) In one embodiment, the vector comprising a nucleic acid sequence encoding a polypeptide, e.g., a LMM or a recombinant polypeptide, further comprises a promoter sequence responsible for the recruitment of polymerase to enable transcription initiation for expression of the polypeptide, e.g., the LMM or recombinant polypeptide. In one embodiment, promoter sequences suitable for the methods described herein are usually associated with enhancers to drive high amounts of transcription and hence deliver large copies of the target exogenous mRNA. In an embodiment, the promoter comprises cytomegalovirus (CMV) major immediate early promoters (Xia, Bringmann et al. 2006) and the SV40 promoter (Chernajovsky, Mory et al. 1984), both derived from their namesake viruses or promoters derived therefrom. Several other less common viral promoters have been successfully employed to drive transcription upon inclusion in an expression vector in mammalian cells including Rous Sarcoma virus long terminal repeat (RSV-LTR) and Moloney murine leukemia virus (MoMLV) LTR (Papadakis, Nicklin et al. 2004). In another embodiment, specific endogenous mammalian promoters can be utilized to drive constitutive transcription of a gene of interest (Pontiller, Gross et al. 2008). The CHO specific Chinese Hamster elongation factor 1-alpha (CHEF 1a) promoter has provided a high yielding alternative to viral based sequences (Deer, Allison 2004).

(129) Other promoters suitable for expression in non-mammalian cells, e.g., fungi, insect, and plant cells, are also known in the art. Examples of suitable promoters for directing transcription in a fungal or yeast host cell include, but are not limited to, promoters obtained from the fungal genes of Trichoderma Reesei, methanol-inducible alcohol oxidase (AOX promoter), Aspergillus nidulans tryptophan biosynthesis (trpC promoter), Aspergillus niger var. awamori flucoamylase (glaA), Saccharomyces cerevisiae galactokinase (GAL1), Kluyveromyces lactis Plac4-PBI promoter, or those described in PCT Publication WO 2005/100573. Examples of suitable promoters for directing transcription in an insect cell include, but are not limited to, T7 lac promoter and polyhedrin promoter. An example of a suitable promoter for directing transcription in a plant cell includes, but is not limited to, the cauliflower mosaic virus promoter CaMV35S. Examples of suitable promoters for directing transcription of the nucleic acid constructs of the present invention in a prokaryotic host cell, e.g., a bacterial cell, are the promoters obtained from the E. coli lac operon, E. coli tac promoter (hybrid promoter, DeBoer et al, PNAS, 1983, 80:21-25), E. coli rec A, E. coli araBAD, E. coli tetA, and prokaryotic beta-lactamase. Other examples of suitable promoters include viral promoters, such as promoters from bacteriophages, including a T7 promoter, a T5 promoter, a T3 promoter, an M13 promoter, and a SP6 promoter.

(130) In addition to promoters, the vectors described herein may further comprise an enhancer region as described above; a specific nucleotide motif region, proximal to the core promoter, which can recruit transcription factors to upregulate the rate of transcription (Riethoven 2010). Similar to promoter sequences, these regions are often derived from viruses and are encompassed within the promoter sequence such as hCMV and SV40 enhancer sequences, or may be additionally included such as adenovirus derived sequences (Gaillet, Gilbert et al. 2007).

(131) In one embodiment, the vector comprising a nucleic acid sequence encoding a polypeptide, e.g., a LMM or a recombinant product, described herein further comprises a nucleic acid sequence that encodes a selection marker. In one embodiment, the selectable marker comprises glutamine synthetase (GS); dihydrofolate reductase (DHFR) e.g., an enzyme which confers resistance to methotrexate (MTX); or an antibiotic marker, e.g., an enzyme that confers resistance to an antibiotic such as: hygromycin, neomycin (G418), zeocin, puromycin, or blasticidin.

(132) In one embodiment, the vector comprising a nucleic acid sequence encoding a recombinant product described herein comprises a selection marker that is useful in identifying a cell or cells containing the nucleic acid encoding a recombinant product described herein. In another embodiment, the selection marker is useful in identifying or selecting a cell or cells that containing the integration of the nucleic acid sequence encoding the recombinant product into the genome, as described herein. The identification of a cell or cells that have integrated the nucleic acid sequence encoding the recombinant protein can be useful for the selection and engineering of a cell or cell line that stably expresses the product.

(133) In one embodiment, the vector comprising a nucleic acid sequence encoding a LMM described herein comprises a mechanism for site-specific integration of the nucleic acid sequence encoding the LMM. For example, the vector is compatible with the Flp-In system and comprises two FRT sites (comprising a specific nucleotide sequence) that, in the presence of Flp recombinase, directs the recombination and subsequent integration of the desired sequence, e.g., the nucleic acid sequence encoding the LMM, at the desired site, e.g., between the two FRT sites, present in the genome of a Flp-In cell, e.g., a Flp-In CHO cell. Other systems used for site-specific integration of nucleic acids encoding a desired product are known in art, e.g., the Cre-lox recombinase system, or CRISPR/CAS-mediated strategies.

(134) Suitable vectors for use are commercially available, and include vectors associated with the GS Expression System, GS Xceed Gene Expression System, or Potelligent CHOK1SV technology available from Lonza Biologics, Inc, e.g., pCon vectors. Additional vectors include, but are not limited to, other commercially available vectors, such as, pcDNA3.1/Zeo, pcDNA3.1/CAT, pcDNA3.3TOPO (Thermo Fisher, previously Invitrogen); pTarget, HaloTag (Promega); pUC57 (GenScript); pFLAG-CMV (Sigma-Aldrich); pCMV6 (Origene); or pBK-CMV/pCMV-3Tag-7/pCMV-Tag2B (Stratagene).

(135) Cells and Cell Culture

(136) In one aspect, the present disclosure relates to methods and compositions for engineering or making a cell or cell line that produces a product, e.g., a recombinant polypeptide as described herein. In another aspect, the present disclosure relates to methods and compositions for engineering or making a cell or cell line with improved, e.g., increased productivity and product quality. Characteristics associated with improved productivity and product quality are described herein, for example, in the section titled Modulation of Lipid Metabolism.

(137) In embodiments, the cell is a mammalian or non-mammalian cell, e.g., an insect cell, a yeast cell, a fungal cell, a plant cell, an archaeal cell, e.g., a cell from a species of Archaea, or a bacterial cell. In an embodiment, the cell is from human, mouse, rat, Chinese hamster, Syrian hamster, monkey, ape, dog, duck, horse, parrot, ferret, fish or cat. In an embodiment, the cell is an animal cell. In embodiments, the cell is a mammalian cell, e.g., a human cell or a rodent cell, e.g., a hamster cell, a mouse cell, or a rat cell. In an embodiment, the cell is a prokaryotic cel, e.g., a bacterial cell. In an embodiment, the cell is a species of Actinobacteria, e.g., Mycobacterium tuberculosis).

(138) In one embodiment, the cell is a Chinese hamster ovary (CHO) cell. In one embodiment, the cell is a, CHO-K1, CHOK1SV, Potelligent CHOK1SV (FUT8-KO), CHO GS-KO, Exceed (CHOK1SV GS-KO), CHO-S, CHO DG44, CHO DXB11, CHOZN, or a CHO-derived cell. The CHO FUT8 knockout cell is, for example, the Potelligent CHOK1 SV (Lonza Biologics, Inc.).

(139) In another embodiment, the cell is a HeLa, HEK293, HT1080, H9, HepG2, MCF7, Jurkat, NIH3T3, PC12, PER.C6, BHK (baby hamster kidney cell), VERO, SP2/0, NSO, YB2/0, Y0, EB66, C127, L cell, COS, e.g., COS1 and COS7, QC1-3, CHO-K1, CHOK1SV, Potelligent CHOK1SV (FUT8-KO), CHO GS-KO, Exceed (CHOK1SV GS-KO), CHO-S, CHO DG44, CHO DXB11, CHOZN, or a CHO-derived cell, or any cells derived therefrom. In one embodiment, the cell is a stem cell. In one embodiment, the cell is a differentiated form of any of the cells described herein. In one embodiment, the cell is a cell derived from any primary cell in culture.

(140) In an embodiment, the cell is any one of the cells described herein that produces a product, e.g., a product as described herein. In an embodiment, the cell is any one of the cells described herein that comprises an exogenous nucleic acid encoding a recombinant polypeptide, e.g., expresses a recombinant polypeptide, e.g., a recombinant polypeptide selected from Table 2 or 3.

(141) In an embodiment, the cell culture is carried out as a batch culture, fed-batch culture, draw and fill culture, or a continuous culture. In an embodiment, the cell culture is an adherent culture. In an embodiment, the cell culture is a suspension culture. In one embodiment, the cell or cell culture is placed in vivo for expression of the recombinant polypeptide, e.g., placed in a model organism or a human subject.

(142) In one embodiment, the culture medium is free of serum.

(143) Other suitable media and culture methods for mammalian cell lines are well-known in the art, as described in U.S. Pat. No. 5,633,162 for instance. Examples of standard cell culture media for laboratory flask or low density cell culture and being adapted to the needs of particular cell types are for instance: Roswell Park Memorial Institute (RPMI) 1640 medium (Morre, G., The Journal of the American Medical Association, 199, p. 519 f. 1967), L-15 medium (Leibovitz, A. et al., Amer. J. of Hygiene, 78, 1p. 173 ff, 1963), Dulbecco's modified Eagle's medium (DMEM), Eagle's minimal essential medium (MEM), Ham's F12 medium (Ham, R. et al., Proc. Natl. Acad. Sc.53, p288 ff. 1965) or Iscoves' modified DMEM lacking albumin, transferrin and lecithin (Iscoves et al., J. Exp. med. 1, p. 923 ff., 1978). For instance, Ham's F10 or F12 media were specially designed for CHO cell culture. Other media specially adapted to CHO cell culture are described in EP-481 791. Other suitable cultivation methods are known to the skilled artisan and may depend upon the recombinant polypeptide product and the host cell utilized. It is within the skill of an ordinarily skilled artisan to determine or optimize conditions suitable for the expression and production of the product, e.g., the recombinant polypeptide, to be expressed by the cell.

(144) Methods for Engineering a Cell and Producing a Product

(145) The methods and compositions described herein are useful for engineering a cell or cell line with improved productivity and improved product quality. In embodiments, a cell is modified such that the lipid metabolism of the cell is modulated. For example, an exogenous nucleic acid encoding an LMM is introduced into the cell. The cell is subsequently cultured under conditions suitable for the expression of the LMM and LMM-mediated modulation of lipid metabolism. The characteristics of a cell having its lipid metabolism modulated are described herein, e.g., in the section titled Modulation of Lipid Metabolism.

(146) In some embodiments, the cell further comprises an exogenous nucleic acid that encodes a product, e.g., a recombinant polypeptide. In another embodiment, the cell further comprises an exogenous nucleic acid that increases the expression of an endogenous product. In any of such embodiments, the exogenous nucleic acid that encodes a product or increases expression of an endogenous product is introduced prior to the modification of lipid metabolism, e.g., the introduction of an exogenous nucleic acid encoding a LMM described herein. Alternatively, in other embodiments, the exogenous nucleic acid that encodes a product or increases expression of an endogenous product is introduced after the modification of lipid metabolism, e.g., the introduction of an exogenous nucleic acid encoding a LMM described herein. In any of the embodiments, the product is a therapeutic or diagnostic protein. In any of the embodiments, the product is selected from Table 2 or 3.

(147) Methods for genetically modifying or engineering a cell to express a desired polypeptide or protein, e.g., an LMM described herein or a product described herein, are well known in the art, and include, for example, transfection, transduction (e.g., viral transduction), or electroporation.

(148) Physical methods for introducing a nucleic acid, e.g., an exogenous nucleic acid or vector described herein, into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1-4, Cold Spring Harbor Press, NY).

(149) Chemical means for introducing a nucleic acid, e.g., an exogenous nucleic acid or vector described herein, into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle). Other methods of state-of-the-art targeted delivery of nucleic acids are available, such as delivery of polynucleotides with targeted nanoparticles or other suitable sub-micron sized delivery system.

(150) Nucleic acids containing the sequence for a desired polypeptide, e.g., a LMM and/or product described herein, are delivered into a cell and can be integrated into its genome via recombination. The resulting recombinant cells are then capable of stable expression of the desired polypeptide, e.g., a LMM and/or product described herein, thus enabling consistent and efficient protein production over long periods of time. Several advantages accompany stable integration of a gene of interest including the fact that only a single DNA delivery process is required to induce prolonged expression since the gene of interest is simultaneously replicated with host chromosomes; this means that the gene is transferred from one generation to the next without the necessity for additional machinery. This also, in theory, produces a more consistent product and yield across batch-to-batch fermentations. In line with this, stable expression methods are capable of generating high product yields compared to those generated without a modification that modulates lipid metabolism described herein, e.g., introduction of an exogenous nucleic acid encoding a LMM.

(151) Protocols to establish recombinant cell lines that stably overexpress the desired polypeptides, e.g., a LMM and/or product described herein, typically involve integration of linearized DNA (usually plasmid based) at random sites into the host genome facilitated by random recombination. Site specific protocols have also been developed and implemented which promote integration of an expression cassette at specific regions of the host genome (O'Gorman, Fox et al. 1991). These protocols often exploit recombinases capable of site specific recombination, and include, but are not limited to, the Flp-In system (e.g., utilizing Flp-In CHO cells), CHOK1SV Flp cell line (Lonza) (as described in Zhang L. et al. (2015). Biotechnol. Prog. 31:1645-5; incorporated by reference herein in its entirety), or the Cre-lox system.

(152) As described above, in some embodiments, the vector comprising a nucleic acid encoding a product and/or a LMM, further comprises a selection marker to facilitate selection of successfully expressing cells from a transfected pool (Browne, Al-Rubeai 2007). Although numerous selection methods are commercially available, the most commonly used of these are methotrexate (MTX) and Lonza's glutamine synthetase (GS) system (Bebbington, Renner et al. 1992, Lai, Yang et al. 2013). Dihydrofolate reductase (DHFR) is a protein responsible for the conversion of folic acid to tetrahydrofolate and is necessary for essential biosynthetic pathways that produce glycine, purines, and thymidylic acid. MTX can be used to inhibit DHFR activity and inclusion of DHFR in a stably transfected culture can therefore be used to select for stably integrated cells; only those cells successfully expressing sufficient recombinant DHFR will survive selection using MTX (Cacciatore, Chasin et al. 2010). Another selection method commonly employed is the use of GS; an enzyme responsible for the synthesis of glutamine from glutamate and ammonia and, since glutamine is vital for mammalian cell survival, cells lacking sufficient GS will not survive in culture. Initially the addition of methionine sulphoximine (MSX), an inhibitor of GS, ensures that the presence of endogenous GS in CHOK1SV cells is not adequate to maintain cell survival and therefore only cells expressing additional GS brought about through stable integration of a recombinant construct survive the selection process. Lonza and others have now established CHO host cell lines in which the endogenous GS gene has been knocked down/out such that all cells perish that are not successfully integrated with the construct of interest without the presence of exogenous glutamine in the media (Fan, Kadura et al. 2012). Many other selection methods are available which elicit a resistance to a particular selection agent such that only cells harboring the resistance gene will survive the selection process; these include hygromycin, neomycin, blasticidin and zeocin (Browne, Al-Rubeai 2007). In embodiments, the vector comprising an exogenous nucleic acid encoding a LMM and the vector comprising an exogenous nucleic acid encoding a product, e.g., a recombinant polypeptide as described herein, further comprise different selection markers.

(153) Following the successful recovery of stably expressing cell pools, the isolation of individual clones, originating from a single cell, facilitates' the selection of cell lines that are capable of high product yields and quality, or the cell lines with the highest capability of high product yields and high quality product. Differences in cellular properties are likely associated with heterogeneity observed in cells and both the number and specific integration site(s) of recombinant DNA. Clonal screening properties have therefore been developed to rapidly assess multiple clones and subsequently select high expressing cells. Fluorescence Activated Cell Sorting (FACS) is a method which can rapidly sort cells based on fluorescence intensity and therefore can be employed to select for high expressing clones. Several protocols have been established which involve fluorescent tagging of the protein of interest (Powell, Weaver 1990), fluorescent tagging of cell surface molecules co-expressed with the recombinant gene (Holmes, Al-Rubeai 1999) and detection of fluorescence intensity based on eGFP expression co-expressed with the gene of interest (Meng, Liang et al. 2000). A high fluorescence intensity observed with these methods suggests a high level of recombinant protein production and thus these cells can be preferentially selected from a recombinant cell pool. FACS-based selection methods to isolate high expressing recombinant clones are more suited to recombinant products which remain associated with the cell and, since mammalian expressed biotherapeutic recombinant protein products are secreted, methods have been developed which are more appropriate for the selection of clones for secreted recombinant proteins. For example, ClonePix is an automated colony selection method which picks clones grown on a semi-solid media based on secretion of recombinant products into the media surrounding the colony and associating with Fluorescin Isothiocyanante (FITC) therefore creating a fluorescent halo around the colonies (Lee, Ly et al. 2006). Clones are selected based on the fluorescence intensity of the halo surrounding the colony. Many other clone selection protocols have been established which rapidly isolate recombinant cells based on desired biological properties with particular interest on productivity and are reviewed in Browne and Al-Rubeai (Browne, Al-Rubeai 2007). Expansion of a clone selected as described herein results in the production of a cell line.

(154) In one embodiment, the methods described herein produce a cell with improved productivity. Improved productivity or production capacity of a cell includes a higher yield or amount of product that is produced, and/or an increased rate of production (as determined by the yield or amount of product produced over a unit of time). In one embodiment, improvement of the productivity of a cell, e.g., the capacity to produce a product, results in an increase, e.g., a 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% increase; or a 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 50-fold, or 100-fold, or more increase in the amount, level, or quantity of product produced, e.g., compared to the amount, level, or quantity of product produced by a cell that does not have a lipid metabolism pathway modulated. In one embodiment, improvement of the productivity of a cell, e.g., the rate of production of the product, results in an increase, e.g., a 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% increase; or a 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 50-fold, or 100-fold, or more increase in the rate of production of the product, e.g., compared to the rate of production of the product produced by a cell that does not have a lipid metabolism pathway modulated.

(155) The methods described herein for engineering a cell produce a high production cell or a high production cell line. A high production cell or cell line is capable of producing higher yields of a recombinant polypeptide product than compared to a reference cell or a cell that has not been selected or engineered by the methods described herein. In an embodiment, a high production cell line is capable of producing 100 mg/L, 200 mg/L, 300 mg/L, 400 mg/L, 500 mg/L, 600 mg/L, 700 mg/L, 800 mg/L, 900 mg/L, 1 g/L, 2 g/L, 3 g/L, 4 g/L, 5 g/L, 10 g/L, 15 g/L, 20 g/L, 25 g/L, 30 g/L, 35 g/L, 40 g/L, 45 g/L, 50 g/L, 55 g/L, 60 g/L, 65 g/L, 70 g/L, 75 g/L, 80 g/L, 85 g/L, 90 g/L, 95 g/L, or 100 g/L or more of a product, e.g., a recombinant polypeptide product. In an embodiment, a high production cell line is produces 100 mg/L, 200 mg/L, 300 mg/L, 400 mg/L, 500 mg/L, 600 mg/L, 700 mg/L, 800 mg/L, 900 mg/L, 1 g/L, 2 g/L, 3 g/L, 4 g/L, 5 g/L, 10 g/L, 15 g/L, 20 g/L, 25 g/L, 30 g/L, 35 g/L, 40 g/L, 45 g/L, 50 g/L, 55 g/L, 60 g/L, 65 g/L, 70 g/L, 75 g/L, 80 g/L, 85 g/L, 90 g/L, 95 g/L, or 100 g/L or more of a product, e.g., a recombinant polypeptide product. The quantity of product produced may vary depending on the cell type, e.g., species, and the product, e.g., recombinant polypeptide, to be expressed. By way of example, a high production CHO cell that expresses a monoclonal antibody may be capable of producing at least 1 g/L, 2 g/L, 5 g/L, 10 g/L, 15 g/L, 20 g/L, or 25 g/L of a monoclonal antibody.

(156) Described herein are methods and compositions that may be particularly useful for the expression of products that are difficult to express or produce in cells or cell-free systems using the conventional methods presently known in the art. As such, a production cell line producing such difficult to express products, e.g., next generation biologics described herein, may produce at least 1 mg/L, 5 mg/L, 10 mg/L, 15 mg/L, 20 mg/L, 25 mg/L, 30 mg/L, 35 mg/L, 40 mg/L, 45 mg/L, 50 mg/L, 55 mg/L, 60 mg/L, 65 mg/L, 70 mg/L, 75 mg/L, 80 mg/L, 85 mg/L, 90 mg/L, 95 mg/L, or 100 mg/L or more. Production capacity (e.g., yield, amount, or quantity of product or rate of production of product) achieved by the methods and compositions described herein for difficult to express proteins can be increased by 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, or more, or 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 20-fold, 50-fold, or 100-fold or more, in comparison to the production capacity of a cell or system that does not have a modification that modulates lipid metabolism as described herein.

(157) Assays for quantifying the amount, level, or quantity of product produced or secreted, e.g., secreted into the culture media, include protein quantification assays, such as the Bradford protein assay, SDS-PAGE analysis, immunoblotting, e.g., western blot, and automated means, e.g., using a nanodrop device. Other methods for measuring increased protein production are well-known to those skilled in the art. For example, an increase in recombinant protein production might be determined at small-scale by measuring the concentration in tissue culture medium by ELISA (Smales et al. 2004 Biotechnology Bioengineering 88:474-488). It can also be determined quantitatively by the ForteBio Octet, for example for high throughput determination of recombinant monoclonal antibody (mAb) concentration in medium (Mason et al. 2012 Biotechnology Progress 28:846-855) or at a larger-scale by protein A HPLC (Stansfield et al. 2007 Biotechnology Bioengineering 97:410-424). Other methods for determining production of a product, e.g., a recombinant polypeptide described herein, can refer to specific production rate (qP) of the product, in particular the recombinant polypeptide in the cell and/or to a time integral of viable cell concentration (IVC). In an embodiment, the method for determining production includes the combination of determining qP and IVC. Recombinant polypeptide production or productivity, being defined as concentration of the polypeptide in the culture medium, is a function of these two parameters (qP and IVC), calculated according to Porter et al. (Porter et al. 2010 Biotechnology Progress 26:1446-1455). Methods for measuring protein production are also described in further detail in the Examples provided herein.

(158) In one embodiment, the methods described herein produce a cell with improved product quality. In one embodiment, improvement of the quality of the product results in the increase, e.g., a 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99%, or more, increase in product quality; or a 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 50-fold, or 100-fold, or more increase, in product quality, e.g., as compared to the amount, level, or quantity of product produced by a cell that does not have a lipid metabolism pathway modulated. Such increases in product quality can be exemplified, for example, by one or more of the following: i) an increase in the amount or quantity of non-aggregated product (or a decrease in the amount or quantity of aggregated product); ii) an increase in the amount or quantity of properly folded or assembled product (or a decrease in the amount or quantity of misfolded, unfolded, partially assembled, or non-assembled product), or an increase in the ratio of properly folded or assembled product to unfolded, misfolded, partially assembled, or non-assembled product; iii) an increase in the amount or quantity of full-length product (or a decrease in fragmentation of the product); iv) an increase in the desired post-translational modifications (or a decrease in unmodified or incorrectly modified product); v) an increase or decrease in glycan heterogeneity (e.g., for glycosylated products); vi) an increase in the amount or quantity of functional product (or a decrease in the amount or quantity of a nonfunctional or dysfunctional product), or an increase in the ratio of function to nonfunctional or dysfunctional product; and/or vii) an increase or decrease in disulfide bond scrambling (e.g., an increase or decrease the desired isoform or structure as a result to increased or decreased disulfide bond scrambling, e.g., for antibody molecule products).

(159) Methods for measuring product quality, e.g., the improvement of the product quality, of a cell or cell line generated as described herein are known in the art. In one embodiment, methods for determining the fidelity of the primary sequence of the expressed recombinant polypeptide product are known in the art, e.g., mass spectrometry. An increase in the amount or concentration of properly folded product, e.g., expressed recombinant polypeptide, can be determined by circular dichroism or assessing the intrinsic fluorescence of the expressed recombinant polypeptide. An increase in the amount or concentration of functional product can be tested using various functional assays depending on the identity of the recombinant product, e.g., recombinant polypeptide. For example, antibodies can be tested by the ELISA or other immunoaffinity assay. Other methods for determining an increase in product quality, e.g., determining aggregation, post-translational modifications, disulfide bond scrambling, can be assessed by size exclusion chromatography, high performance liquid chromatography, dynamic light scattering (DLS) approaches, and protein electrophoresis (PAGE) methods.

(160) In an embodiment, the methods for producing a product, e.g., as described herein, comprise providing a cell engineered to comprise a modification that modulates lipid metabolism, as described above. In one embodiment, the cell comprising a modification that modulates lipid metabolism further comprises an exogenous nucleic acid encoding a product, e.g., a recombinant polypeptide as described herein. In one embodiment, the exogenous nucleic acid encoding a product, e.g., a recombinant polypeptide described herein is introduced to the engineered cell comprising a modification that modulates lipid metabolism. In another embodiment, the exogenous nucleic acid encoding a product, e.g., a recombinant polypeptide described herein, is introduced to a cell prior to the introduction of an exogenous nucleic acid encoding a LMM as described herein. The exogenous nucleic acid encoding a product further comprises a selection marker, for efficient selection of cells that stably express, e.g., overexpress, the product as described herein.

(161) In some embodiments, additional steps may be performed to improve the expression of the product, e.g., transcription, translation, and/or secretion of the product, or the quality of the product, e.g., proper folding and/or fidelity of the primary sequence. Such additional steps include introducing an agent that improves product expression or product quality. In an embodiment, an agent that improves product expression or product quality can be a small molecule, a polypeptide, or a nucleic acid that encodes a polypeptide that improves protein folding, e.g., a chaperone protein. In an embodiment, the agent that assists in protein folding comprises a nucleic acid that encodes a chaperone protein, e.g., BiP, PD1, or ERO1 (Chakravarthi & Bulleid 2004; Borth et al. 2005; Davis et al. 2000). Other additional steps to improve yield and quality of the product include overexpression of transcription factors such as XBP1 and ATF6 (Tigges & Fussenegger 2006; Cain et al. 2013; Ku et al. 2008) and of lectin binding chaperone proteins such as calnexin and calreticulin (Chung et al. 2004). Overexpression of the agents that assist or improve protein folding, product quality, and product yield described herein can be achieved by introduction of exogenous nucleic acids encoding the agent. In another embodiment, the agent that improves product expression or product quality is a small molecule that can be added to the cell culture to increase expression of the product or quality of the product, e.g., DMSO. In one embodiment, culturing the cells at a lower temperature, e.g., 1 C., 2 C., 3 C., 4 C., 5 C., 6 C., 7 C., 8 C., 9 C., or 10 C. lower, than the temperature that the cells are normally grown can improve productivity.

(162) Any of the methods described herein can further include additional selection steps for identifying cells that have high productivity or produce high quality products. For example, FACS selection can be utilized to select specific cells with desired characteristics, e.g., higher expression of a protein folding proteins, e.g., chaperones.

(163) In one aspect, the disclosure provides methods that include a step for recovering or retrieving the recombinant polypeptide product. In embodiments where the recombinant polypeptide is secreted from the cell, the methods can include a step for retrieving, collecting, or separating the recombinant polypeptide from the cell, cell population, or the culture medium in which the cells were cultured. In embodiments where the recombinant polypeptide is within the cell, the purification of the recombinant polypeptide product comprises separation of the recombinant polypeptide produced by the cell from one or more of any of the following: host cell proteins, host cell nucleic acids, host cell lipids, and/or other debris from the host cell.

(164) In embodiments, the process described herein provides a substantially pure protein product. As used herein, substantially pure is meant substantially free of pyrogenic materials, substantially free of nucleic acids, and/or substantially free of endogenous cellular proteins enzymes and components from the host cell, such as polymerases, ribosomal proteins, and chaperone proteins. A substantially pure protein product contains, for example, less than 25%, 20%, 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1% of contaminating endogenous protein, nucleic acid, or other macromolecule from the host cell.

(165) Methods for recovering and purification of a product, e.g., a recombinant polypeptide, are well established in the art. For recovering the recombinant polypeptide product, a physical or chemical or physical-chemical method is used. The physical or chemical or physical-chemical method can be a filtering method, a centrifugation method, an ultracentrifugation method, an extraction method, a lyophilization method, a precipitation method, a chromatography method or a combination of two or more methods thereof. In an embodiment, the chromatography method comprises one or more of size-exclusion chromatography (or gel filtration), ion exchange chromatography, e.g., anion or cation exchange chromatography, affinity chromatography, hydrophobic interaction chromatography, and/or multimodal chromatography.

EXAMPLES

(166) The invention is further described in detail by reference to the following experimental examples. These examples are provided for purposes of illustration only, and are not intended to be limiting unless otherwise specified. Thus, the invention should in no way be construed as being limited to the following examples, but rather, should be construed to encompass any and all variations which become evident as a result of the teaching provided herein.

(167) Without further description, it is believed that one of ordinary skill in the art can, using the preceding description and the following illustrative examples, make and utilize the compounds of the present invention and practice the claimed methods. The following working examples specifically point out various aspects of the present invention, and are not to be construed as limiting in any way the remainder of the disclosure.

Example 1: Generation of Stable Cells Overexpressing a Lipid Metabolism Modulator

(168) In order to investigate the effect of overexpression of two lipid metabolism modulators, SCD1 and SREBF1, in CHO cells, these genes were successfully cloned and stably integrated into adherent CHO Flp-In cells using a site directed approach, and into suspension GS knockout (GSKO) CHO cells using a random integration approach.

(169) Molecular Cloning of SCD1 and SREBF1 Containing FRT Vectors

(170) Molecular cloning was carried out in order to generate FRT based vectors which facilitate the expression of SCD1 and SREBF1 proteins both with and without a V5/His tag at the C-terminus of each protein. The use of these vectors, in conjunction with Thermo Fisher's commercially available Flp-In host CHO cell pool enabled site specific integration of the genes of interest to generate stable CHO adherent cell pools. The primers described in Table 4 were used in a Phusion Polymerase based PCR reaction to amplify these genes such that double stranded DNA fragments were produced flanked by the restriction sites also detailed in Table 4. SCD1 and SREBF1 genes were amplified from Mouse P19 derived cDNA and Origene mouse cDNA clone (NCBI accession no. NM_011480), respectively.

(171) Following successful amplification of the target genes, double restriction digests were undertaken on FRT-V5 vectors as well as the previously generated PCR products of the genes of interest using the appropriate restriction enzymes. Ligations were incubated overnight before subsequent transformations and miniprep purification was carried out on the resulting colonies.

(172) Generation of SCD1 and SREBF1 Overexpressing Adherent Flp-In CHO Cells

(173) The aforementioned FRT-based constructs were used in conjunction with Thermo Fisher's commercially available adherent Flp-In CHO cells to generate stable cell pools. FRT vectors containing the genes of interest and an empty FRT construct (used to generate a control cell pool) were co-transfected with recombinase containing pOG44 vector into Flp-In cells. Recombinase sites present in the FRT vectors and Flp-In CHO genome initiate site specific recombination and successful clones can be isolated using hygromycin as a selection agent. Stably expressing recombinant CHO adherent cell pools in a site specific manner were generated according to the manufacturer's instructions, e.g., as described in the Thermo Fisher's Flp-In manual, e.g., available from the Thermo Fisher's references and protocols website. This method was used to generate and recover control, SCD1-V5, and SREBF1-V5 Flp-In CHO polyclonal cell pools.

(174) Molecular Cloning of SCD1 and SREBF1 into pcDNA3.1 Vectors

(175) Expression vectors were generated to stably integrate, and therefore overexpress, in industrially relevant CHO suspension cells with one of SCD1, SREBF1 or a truncated SREBF1 gene. The pcDNA3.1V5-His/TOPO vector consists of an appropriate CMV promoter and downstream multiple cloning site, facilitating expression of the gene of interest, while also including elements enabling expression of a neomycin gene which can be utilized for selection of successful clones following integration of DNA into the genome.

(176) Initially, the Phusion PCR protocol was used to amplify SCD1, SREBF1 and a SREBF1 truncation using the primers indicated in Table 4, designed so that restriction sites were simultaneously added to the flanks of the resulting PCR products. The previously generated SCD1-FRT vector was used as a template to amplify the SCD1 genes while Origene mouse cDNA (NCBI accession no. NM_011480) was used to amplify the SREBF1 gene and its truncation. The SREBF1 truncation hereby referred to as SREB410, codes for a 410 amino acid long polypeptide sequence, which includes the helix-loop-helix (HLH) domain of SREBF1. This domain is endogenously cleaved from the full-length protein allowing migration of this fragment to the nucleus and subsequent gene transcription activation as previously outlined. Primers were designed to amplify this region with the aim to express a protein (encoded by this sequence) which is localized directly in the nucleus and thus to carry out its function as a transcriptional activator without the need for endogenous processing.

(177) Double restriction digests were carried out on purified PCR products as appropriate (see Table 4), and pcDNA3.1/V5-His/TOPO, where primers amplified a gene with no stop codon, in order to allow read through into an in-frame sequence encoding a V5 and His tag. The resulting DNA fragments were ligated to yield vectors containing SCD1, SREBF1 or SREB410 genes with a V5-His tag. These reactions were transformed and mini preps were carried out on a number of the resulting colonies. Restriction digests were carried out and the resulting DNA fragments were run on an agarose gel to ascertain which samples were successful.

(178) Generation of SCD1 and SREBF1 Overexpressing Suspension GSKO CHO Cells

(179) Suspension CHOK1SV GS-KO cell pools grown in chemically-defined, protein and serum-free media, stably transfected with the previously synthesized pcDNA3.1V5-His/TOPO derived constructs were generated in order to investigate the effect of constitutive expression of the inserted genes in an industrially relevant cell line. In order to achieve this, stable integration was carried out using Lonza's CHOK1SV GS-KO host cell line. Initially, SCD1-V5, SREBF1-V5, SREB410-V5 and control (empty pcDNA3.1V5-His/TOPO) constructs were linearized by overnight digestion with PvuI restriction enzyme (NEB). Following linearization, DNA was purified using ethanol precipitation and CHOK1SV GS-KO cells were electroporated using 20 g DNA and 110.sup.7 viable cells before immediate transfer to T75 flasks containing CD-CHO medium (Thermo Fisher) at 37 C. to make a final volume of 20 mL. Flasks were placed in a humidified static incubator at 37 C. with a 5% CO.sub.2 in air atmosphere for 24 hours. A concentrated stock of G418 (Melford) selection agent was diluted in CD-CHO medium and 5 mL of this stock was added to the T75 flasks and gently mixed to yield a final concentration of 750 g/mL in a 25 mL total volume. Cell counts were performed every 3-4 days to determine growth and culture viability and 750 g/ml G418 in CD-CHO media was renewed approximately every 6 days by centrifugation and resuspension. Cells were transferred to 125 mL Erlenmeyer flasks and routine suspension cell culture was established once cells had reached a concentration of 210.sup.5 viable cells/mL.

(180) TABLE-US-00019 TABLE 4 Summary of primer sequences Restriction SEQ ID Primer Name Primer Sequence (5-3) Sites NO: eGFP SV40 For TAT GCTAGCGGTACCATGGTGAGCAAGGGCGAGGA NheI, KpnI* 5 SREBF1 For FRT TAT GGTACC ATGGACGAGCT KpnI 6 SREBF1 Rev FRT ATA GGGCCC TTAGCTGGAA ApaI 7 SREBF1 V5 For FRT TAT GCGGCCGC ATGGACGAG NotI 8 SREBF1 V5 Rev ATA CTCGAG CGGCTACTCTT ApaI 9 SCD1 For FRT TAT GGTACC ATGCCGGCC KpnI 10 SCD1 Rev FRT ATA CTCGAG TCAGCTACTCTTGT XhoI 11 SCD1 V5 For FRT TAT GGTACC ATGCCGGCC KpnI 12 SCD1 V5 Rev FRT ATA CTCGAG CGGCTACTCTT XhoI 13 SREBF1 For 3.1 TAT GCGGCCGC ATGGACGAG NotI 14 SREBF1 Rev 3.1 ATA TCTAGA CTAGCTGGAAGTGACGGTGGTTCC XbaI 15 SREBF1 V5 For 3.1 TAT GCGGCCGC ATGGACGAG NotI 16 SREBF1 V5 Rev 3.1 ATA TCTAGA CTGCTGGAAGTGACGGTGGTTC XbaI 17 SREB410 For 3.1 TAT GCGGCCGC ATGGACGAG NotI 18 SREBF410 Rev 3.1 ATA TCTAGA TCACATGCCCTCCATAGACACATCTGTG XbaI 19 SREB410 V5 For TAT GCGGCCGC ATGGACGAG NotI 20 SREB410 V5 Rev ATA TCTAGA CTCATGCCCTCCATAGACACATCTGTG XbaI 21 SCD1 For 3.1 TAT GGTACC ATGCCGGCC KpnI 22 SCD1 Rev 3.1 ATA CTCGAG TCAGCTACTCTTGT XhoI 23 SCD1 V5 For 3.1 TAT GGTACC ATGCCGGCC KpnI 24 SCD1 V5 Rev 3.1 ATA CTCGAG CGGCTACTCTT XhoI 25

Example 2: Expression Analysis of LMM in Stable Cells Overexpressing a LMM

(181) Following the establishment of stable Flp-In CHO cell pools stably integrated with either a control (empty pcDNA5 FRT), SCD1-V5 or SREBF1 V5, immunofluorescence was undertaken to confirm both the expression of the stably exogenous integrated genes and additionally the intracellular location of the expressed proteins. Control, SCD1-V5 and SREBF1-V5 cell lines were seeded at 210.sup.5 viable cells per well in a 24 well plate in Ham Nutrient Mix F12 medium supplemented with 10% FBS. Samples were methanol-fixed and first exposed to anti-V5 antibody (produced in mouse-Sigma V8012) and successively anti-mouse FITC secondary conjugate (raised in goat-Sigma F0257). Furthermore, the cells were exposed to DAPI stain (10 g/mL working stock) in order to stain cellular DNA thus highlighting the nuclei. The resulting immunofluorescent images are shown in FIG. 1.

(182) The presence of the FITC stains in SCD1-V5 and SREBF1-V5 cell lines shows that the exogenous/recombinant genes were successfully expressed and, moreover, the cellular localization of SCD1-V5 and SREBF1-V5 proteins was clearly evident. Constitutively expressed SCD1-V5 protein was present and abundant throughout the cell, with the images showing their localization to be in the cytoplasm and in the ER. Conversely, the SREBF1-V5 protein was expressed to a much lower amount, but it was very prominently located at the peri-nucleus forming a ring around the nuclei. It is important to consider that the V5 epitope sequence was added to the 3 end of the gene and, because of the natural regulation of SREBF1, specific domains are cleaved and relocated within the cell. The mature, cleaved bHLH (basic helix loop helix) region is of particular importance as it is responsible for transcriptional activation of many genes with implications on lipid biosynthesis and conformation. Because this region is encoded at the 5 end of the gene, this region would not be detected upon staining of the 3 V5 tag and thus it is impossible to determine whether any of the constitutively expressed, cleaved portion of the translated protein is present in the imaged cells.

(183) Staining of intracellular V5-tagged stable proteins was carried out to determine the presence of SCD1-V5 and SREBF1-V5 in engineered CHOK1SV GS-KO suspension cell lines. In order to adhere these cells to a coverslip in a 24 well plate, coverslips were first treated with poly-L-lysine and cells were seeded at 210.sup.5 cells per well and left to incubate at 37 C. in a 5% CO.sub.2 environment static humidified incubator overnight. Following methanol fixing and permeablisation, anti-V5 (produced in mouseSigma V8012) was conjugated with anti-mouse TRITC (produced in goat-T5393) secondary antibody. The resulting images are shown in FIG. 2.

(184) Western blots were performed using an anti-V5 antibody, an anti-mouse HRP conjugated secondary antibody, and the appropriate detection system, was used to further confirm expression of the lipid constructs with the V5 tag. Equivalent amounts of total protein (determined using the Bradford assay) were loaded for SDS-PAGE followed by western blotting onto nitrocellulose. The resulting blots are shown in FIGS. 3A, 3B, and 3C with the V5 tag only detected in those cells expressing the SCD1 construct. However, the low levels of expression achieved with the SREBF1 construct may explain the lack of detection of V5 in cell lines expressing this construct.

Example 3: Growth Characteristics of Stable Cells Overexpressing a LMM

(185) In this example, the growth characteristics, such as viable cell counts, cell number, and culture viability were assessed in two different cell lines engineered to overexpress LMMs, a CHO Flp-In and the CHOK1SV GS-KO (Lonza Biologics) cell lines. The LMM-engineered cell lines were generated as described in Example 1. Control cell lines were engineered to express an empty V5 tagged expression vector. An eGFP encoding expression vector was transfected into the LMM-engineered cell lines by electroporation. Electroporations were carried out using 110.sup.7 viable LMM-engineered Flp-In CHO cells or CHOK1SV GS-KO cells and 20 g of plasmid DNA (eGFP encoding expressing vector) and these cells were diluted to a final volume of about 20 or 32 mL in Ham Nutrient Mix F12 medium. Viable cell concentrations were determined using a ViCell cell counter and recorded at 24, 48, 72, and 96 hours post transfection of the eGFP encoding expression vector.

(186) The results for the Flp-In cells engineered to express SCD1 and SREBF1 are shown in FIG. 4. Cells overexpressing SCD1 and SREBF1 generally showed some increase in the viable cell concentration compared to control cells across all time points.

(187) The results for the CHOK1SV GS-KO cells engineered to express SCD1, SREBF1, and SREBF410 are shown in FIGS. 5A and 5B. Viable cell concentration compared to total cell concentration are shown in FIG. 5A, with the viable cell concentration represented by the lower column, and the whole column representing the total number of cells counted. As shown in FIG. 5A, expression of LMM (SCD1 and SREBF1) results in a general increase in viable and total cell numbers across all time points. By 48, 72 and 96 hours, viable and total cell concentration were significantly higher in SCD1 and SREBF1-engineered cells. At 96 hours, viable cell counts for SCD1 and SREBF1-engineered cells were more than 110.sup.6 cells/mL higher than control cells. Culture viability was also calculated and shown in FIG. 5B. The LMM-engineered cells generally showed an increase in culture viability as compared to control cells.

Example 4: Increased eGFP Induced Fluorescence in Stable Cells Overexpressing a LMM

(188) In this example, the production capacity for producing a recombinant protein was assessed in the CHO-Flp-In and the CHOK1SV GS-KO cell lines that were engineered to stably express LMMs, as described in Example 1. The LMM-engineered cells were transfected with an eGFP encoding expression vector as described in Example 3, and production capacity was assessed by measuring the amount of eGFP produced by flow cytometry at 24, 48, 72, and 96 hours after transfection. A FACSCalibur (BD Biosciences) instrument was used to measure the eGFP-mediated fluorescence of the cells and generate the data shown here.

(189) Production of eGFP was measured in Flp-In cells engineered to express V5-tagged SCD1 and SREBF1. FIGS. 6A, 6B, and 6C show the median fluorescence, the geometric mean fluorescence, and the arithmetic mean fluorescence, respectively, of the LMM-engineered Flp-In cells recorded using flow cytometry at the specified time points. These values are increased in SCD1 overexpressing cells for median fluorescence, geometric mean fluorescence, and arithmetic mean fluorescence, thereby demonstrating that cells stably expressing SCD1 are capable of producing more eGFP compared to the control cells.

(190) Production of eGFP was measured in CHOK1SV GS-KO cells engineered to express V5-tagged SCD1, SREBF1, and SREBF410. Median fluorescence is shown in FIG. 7A and geometric mean fluorescence is shown in FIG. 7B. Increased median fluorescence and geometric mean fluorescence was observed for cells engineered to overexpress SREBF1.

(191) In order to account for differences in cell concentration and proliferation properties observed in CHOK1SV GS-KO derived cell lines. Total fluorescence per mL of culture was calculated by multiplying the measured arithmetic mean fluorescence by the total cell concentration (10.sup.6 per mL), and the calculated values are shown in FIG. 7C. As shown in FIG. 7C, SCD1 overexpressing cells produced a significantly increased amount of recombinant protein (eGFP) at 24 hours after transfection as compared to control cells. SREBF1 overexpressing cells generally produced an increased amount of eGFP at all time points tested as compared to control cells, and significantly increased amounts at 72 and 96 hours after transfection.

(192) Collectively, these data show that engineering cells to express an LMM, such as SCD1 and SREBF1, increases production capacity of a transiently expressed recombinant protein such as eGFP. Furthermore, as demonstrated by the fluorescence measured, the cells produced increased correctly folded and functional eGFP as compared to cells that did not have a modification that modulates lipid metabolism, thereby demonstrating that modulation of lipid metabolism increases both production yields and quality.

Example 5: Improved Productivity in Stable Cells Overexpressing an LMM

(193) Similar to the experiments described in Example 4, cell lines that stably express LMMs were assessed for production capacity of different products, such as a model IgG4 antibody molecule (referred to herein as antibody A) and a fusion protein (referred to herein as Fc fusion protein or FP).

(194) Flp-In cells stably expressing V5-tagged SCD1 and SREBF1 (engineered as described in Example 1) were electroporated with expression vectors encoding antibody A or a Fc fusion protein. Following electroporation, the quantity of recombinant antibody A and FP in culture supernatant was determined at 24, 48, 72, and 96 hours after electroporation by western blotting. An anti-heavy chain primary antibody, an anti-rabbit-HRP conjugated secondary antibody, and the appropriate detection reagent were used to detect antibody A (FIG. 8A) and the Fc fusion protein (FIG. 9A). Average fold change in production of the antibody A and Fc fusion protein was determined by Protein A HPLC, and shown in FIGS. 8B and 9B, respectively. Cell lines expressing exogenous SCD1 demonstrated increased productivity compared to the control cell lines with both recombinant proteins. Furthermore, this effect was consistent across the 24, 48, 72, and 96 hour time points analyzed.

(195) Lonza's CHOK1SV GS-KO (Xceed) cells stably expressing the SCD1, SREBF1, and SREBF410 constructs (engineered as described in Example 1) were transiently transfected with two recombinant proteins; a model IgG4 (antibody A) and an Fc fusion protein. Following electroporation, the quantity of recombinant antibody A and FP in culture supernatant was determined every 24 hours up to 96 hours by western blotting using an anti-heavy chain primary antibody, an anti-rabbit-HRP conjugated secondary antibody, and the appropriate detection reagent (FIGS. 10A and 11A). Average fold change in production of the antibody A and Fc fusion protein was determined by Protein A HPLC, and shown in FIGS. 10B and 11B, respectively. CHOK1SV GS-KO cells lines expressing exogenous SCD1, SREBF1, and SREBF410 demonstrated increased productivity compared to the control cell lines with both recombinant proteins (FIGS. 10B and 11B). Furthermore, this effect was consistent across the 48, 72, and 96 hour time points analyzed.

(196) Lonza's CHOK1SV GS-KO (Xceed) cells stably expressing the SCD1, SREBF1, and SREBF410 constructs (engineered as described in Example 1) were stably transfected with two recombinant proteins; a model IgG4 (antibody A) and an Fc fusion protein. FIGS. 15A and 16A show volumetric productivity of antibody A and FC fusion protein respectively at 48, 96, 144 and 192 hours after initial seeding at 0.210.sup.6 viable cells/ml. Results show that the SCD1 overexpressing cell pools improve the absolute yield of both recombinant molecules. Furthermore, upon calculations to include cell numbers, the specific productivity of both recombinant molecules was also greatly increased in SCD1 overexpressing cell pools (FIGS. 15B and 16B).

(197) These results collectively show that engineering cells to express an LMM, such as SCD1, SREBF1, and a functional fragment of SREBF1 (SREBF410) increases production capacity of transiently expressed recombinant proteins, such as antibody molecules and fusion proteins.

Example 6: Improving Established Production Cell Lines

(198) Examples 4 and 5 demonstrate that cell lines stably expressing LMMs have improved production when transiently expressing a recombinant product, such as a GFP, an antibody molecule, or a fusion protein. In this example, analysis was performed to determine the effect of LMMs on the enhancing existing stable yields of a recombinant product in established cell lines.

(199) CHO121 cells that have been previously engineered to stably express a model IgG4 antibody molecule (antibody A) were used. Constructs encoding V5-tagged SCD1, SREBF1 and a truncated SREBF1 (SREBF410) were transiently expressed in the antibody A-stably expressing cells. Control cells were transfected with an empty V5 tag vector. Supernatants from the cells were harvested at 48, 72, and 168 hours. Western blot analysis was performed to determine the amount of antibody A produced by using an anti-heavy chain primary antibody (Sigma 19764), followed by anti-rabbit HRP conjugated secondary antibody (Sigma A6154), and the results are shown in FIG. 12A. As shown, expression of LMMs SCD1 and SREBF410 resulted in an increase in the amount of antibody A produced by the cells as compared to control at both 48 and 72 hours after introduction of the LMMs. Supernatants from cells were subjected to Coomassie analysis to show the amount of antibody A produced after 168 hours after introduction of the LMMs, and demonstrate that LMM transient expression (SCD1 and SREBF410) resulted in improved production of the recombinant protein (FIG. 12B). FIG. 13 shows quantitative analysis of antibody A using protein A HPLC highlighting a marked increase in the average product titre following transient transfections with SCD1 and SREB410 containing plasmids at 48, 72, 96 and 144 hours post transfection. FIG. 14 shows quantitative analysis of the FC fusion protein using protein A analysis to determine product titres and viable cell numbers to determine specific productivity. This data shows an increase in the average specific productivity of cells transiently transfected with vectors containing LMM elements and the SREBF1 containing construct yields the highest average value.

(200) These results show that modulation of the lipid metabolism in established cell lines can further improve production capacity compared to established yields.

Example 7: Improved Productivity by Simultaneous Introduction of Recombinant Genes and LMMs

(201) Plasmids/constructs were generated which comprise of genes for appropriate expression of both an exemplary immunocytokine and either a control (no LMM), SCD1, SREBF1 or SREB411 (SREBF1 derived sequences were CHO specific; NM 001244003, SEQ ID NOs: 34 and 36). These constructs were then used to transiently transfect Lonza's CHOK1SV GS-KO cells. FIG. 17A shows western analysis of supernatants harvested at 48 and 96 hours post transfection. The supernatant samples used were reduced and the transient product was detected by probing with an anti-heavy chain primary antibody and HRP conjugated anti-rabbit secondary to highlight a native heavy chain (lower band) and cytokine fused heavy chain (upper band). Inclusion of SCD1, SREBF1 and SREB411 genes in the transfected construct resulted in an increase in both band intensities at both 48 and 96 hours post transfection. Furthermore, FIG. 17B shows quantitative analysis of samples obtained at 96 hours post transfection using protein A analysis. Relative abundances of the immunocytokine support the data presented in western analysis (FIG. 17A).

(202) These data show that the simultaneous inclusion of an LMM, such as SCD1, SREBF1, and a functional fragment of SREBF1 (SREBF411), with recombinant product genes can improve production capacity.