Enzymes and methods for cleaving N-glycans from glycoproteins
10639357 ยท 2020-05-05
Assignee
Inventors
- Daniel Garrido (Santiago, CL)
- J. Bruce German (Davis, CA)
- Carlito B. Lebrilla (Davis, CA)
- David A. Mills (Davis, CA)
Cpc classification
A61K38/40
HUMAN NECESSITIES
A61K31/715
HUMAN NECESSITIES
Y02P20/52
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61K38/47
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C07K14/79
CHEMISTRY; METALLURGY
C12P19/04
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
C12N9/2402
CHEMISTRY; METALLURGY
C12Y302/01096
CHEMISTRY; METALLURGY
International classification
C12P19/04
CHEMISTRY; METALLURGY
C07K14/79
CHEMISTRY; METALLURGY
A61K38/47
HUMAN NECESSITIES
A61K38/40
HUMAN NECESSITIES
A23C9/12
HUMAN NECESSITIES
Abstract
Provided herein are deglycosylating enzymes that remove a broad range of N-glycans from N-glycosylated proteins. Further provided are methods of recombinantly producing and expressing the deglycosylating enzymes. The presently described deglycosylating enzymes can be used to produce free glycans for characterization, and for prebiotic and immunostimulatory uses. In addition, the presently described deglycosylating enzymes can be used to produce deglycosylated proteins for characterization, to improve digestion, and to reduce immunogenicity.
Claims
1. A method of deglycosylating a glycoprotein comprising a high mannose, complex, or hybrid N-glycan, the method comprising contacting the glycoprotein with a bacterial cell expressing a GH18 endoglycosidase polypeptide comprising a sequence, wherein the sequence is at least 90% identical to SEQ ID NO:4 or SEQ ID NO:5, thereby deglycosylating the glycoprotein and generating deglycosylated protein and released N-glycans.
2. The method of claim 1, wherein the glycoprotein comprises a high mannose N-glycan.
3. The method of claim 1, wherein the glycoprotein comprises a complex N-glycan.
4. The method of claim 1, wherein the glycoprotein comprises a hybrid N-glycan.
5. The method of claim 1, wherein the glycoprotein is selected from the group consisting of: lactoferrin, whey, and immunoglobulin.
6. The method of claim 1, wherein the glycoprotein is a soy glycoprotein.
7. The method of claim 1, wherein the N-glycan comprises core fucosylation, terminal fucosylation, or terminal sialylation.
8. The method of claim 1, wherein the GH18 endoglycosidase polypeptide is a transmembrane protein.
9. The method of claim 1, wherein the bacterial cell is one or more Bifidobacterium selected from the group B. longum bv. infantis, B. longum bv. longum, B. adolescentis, or B. breve.
10. The method of claim 9, wherein the Bifidobacterium is B. longum subsp. infantis.
11. The method of claim 9, wherein the Bifidobacterium is B. breve.
12. The method of claim 9, wherein the Bifidobacterium is administered to an individual and the deglycosylating occurs in the individual.
13. The method of claim 12, wherein the Bifidobacterium is administered at 10.sup.4 to 10.sup.12 colony forming units per dose.
14. The method of claim 12, wherein the individual is a human infant.
15. The method of claim 14, further comprising administering to the human infant, an infant formula comprising bovine milk glycoproteins, wherein the bovine milk glycoproteins are deglycosyated by the GH18 endoglycosidase polypeptide in the human infant.
16. The method of claim 15, wherein the GH18 endoglycosidase polypeptide releases at least 100 g/L N-glycans from the bovine milk glycoproteins.
17. A method stimulating growth of beneficial gut bacteria or reducing pathogens or both, the method comprising administering to the individual (i) a liquid food comprising bovine milk glycoproteins and (ii) a bacterial cell isolate or powdered bacterial cell expressing a GH18 endoglycosidase polypeptide comprising a sequence, wherein the sequence is at least 90% identical to SEQ ID NO:4 or SEQ ID NO:5, wherein the bovine milk glycoproteins are deglycosylated by the GH18 endoglycosidase polypeptide.
18. The method of claim 17, wherein the beneficial gut bacteria is administered at 10.sup.4 to 10.sup.12 colony forming units per dose.
19. The method of claim 18, wherein the beneficial gut bacteria is Bifidobacterium.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
DETAILED DESCRIPTION OF THE INVENTION
I. Introduction
(11) The presently disclosed deglycosylating enzymes have a number of useful properties. In contrast to known deglycosylating enzymes, the present deglycosylating enzymes have at least the following benefits:
(12) Promiscous cleavage of N-glycans, including high mannose, complex, and hybrid N-glycans, and those including fucosylation and/or sialylation;
(13) Heat stability, which is advantageous for large-scale production and laboratory applications;
(14) Bifidobacteria, which express the present deglycosylating enzymes at the cell surface, are considered food grade, or generally recognized as safe (GRAS), thus easing any regulatory hurdles for use in food or consumer products. The presently disclosed deglycosylating enzymes can also be expressed (e.g., heterologously) in other food grade bacteria.
(15) Exemplary applications of the present deglycosylating enzymes:
(16) Inclusion in food products (either as a polypeptide or as a cellular transmembrane protein), e.g.:
(17) To increase digestibility of glycoproteins, such as those found in milk; To stimulate growth of beneficial gut bacteria, e.g., in infants; To reduce allergenic response to food glycoproteins, e.g., in milk, nuts, soy, etc.; To induce satiety, e.g., for weight loss or maintenance.
Inclusion in pharmaceutical products, e.g.: To reduce allergenic potential and improve activity of therapeutic glycoproteins; To improve immune response to free glycans.
Analytical applications, e.g., high-throughput proteomics and glycoproteomics.
Production of deglycosylated proteins for, e.g.: Use in a food or consumer product with reduced allergenic potential; Use in a pharmaceutical composition with reduced allergic potential and more predictable chemical properties; Use in a food product with increased digestibility; Use for protein characterization and proteomic studies.
Production of free glycans for, e.g.: Use in a food product, e.g., as a prebiotic to stimulate growth of beneficial gut bacteria; Use in a pharmaceutical composition, e.g., for immune stimulation or pathogen protection;
Use for glycan characterization and glycoproteomic studies.
II. Definitions
(18) Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by a person of ordinary skill in the art. See, e.g., Lackie, DICTIONARY O
(19) The term N-glycan refers to an oligosaccharide comprising a core pentasaccharide Man.sub.3GlcNAc.sub.2. The N-glycan can be attached to a protein (glycoprotein) via the nitrogen of an asparagine (or occasionally arginine) residue, or free in solution. In the context of the present disclosure, the term glycan refers to an N-glycan unless otherwise specified. The terms free glycan, free N-glycan, and oligosaccharide refer to a glycan that is not covalently bound to a protein. A useful reference for glycan, glycoprotein, and oligosaccharide nomenclature can be found at the website chem.qmul.ac.uk/iupac/misc/glycp.html.
(20) Unless specified, the term deglycosylating enzyme refers to the presently disclosed endoglycosidases with broad substrate range, as well as enzymes with more limited substrate specificities. The term deglycosylating generally refers to removing N-glycans from a protein. The term deglycosylated protein or deglycosylated polypeptide refers to a polypeptide that was at one point glycosylated (N-glycosylated), but has been exposed to a deglycosylating enzyme under appropriate conditions to reduce the number of or completely eliminate attached glycans.
(21) The term lacks a transmembrane domain that spans a cell membrane, with reference to a protein, indicates that the protein does not span a cell membrane as it would in its native state. The protein may include a domain with the characteristics of a transmembrane domain (e.g., hydrophobic residues).
(22) The terms isolating, separating, and purifying are not intended to be absolute terms, but refer to separation of a polynucleotide, protein, glycan, cell, or other component from other materials in a sample, thereby substantially enriching the component. For example, in the context of a deglycosylation reaction, isolating the free glycans would entail separating the free glycans from the deglycosylated protein and the deglycosylating enzyme, e.g., using size or affinity based methods, or other methods familiar in the art.
(23) The term characterizing can refer to determination of any characteristic of a polynucleotide, protein, glycan, cell, or other component. For example, characterizing a protein could entail determining the sequence, size, or function of the protein. Characterizing a glycan could entail determining, e.g., size or saccharide composition of the glycan using known methods, e.g., mass spectrometry.
(24) The term Bifidobacteria and its synonyms refer to a genus of anaerobic bacteria having beneficial properties for humans. Bifidobacteria is one of the major strains of bacteria that make up the gut flora, the bacteria that reside in the gastrointestinal tract and have health benefits for their hosts. See, e.g., Guarner F and Malagelada J R. Lancet (2003) 361, 512-519, for a further description of Bifidobacteria in the normal gut flora.
(25) A prebiotic or prebiotic nutrient is generally a non-digestible food ingredient that beneficially affects a host when ingested by selectively stimulating the growth and/or the activity of one or a limited number of bacteria in the gastrointestinal tract. As used herein, the term prebiotic refers to the above described non-digestible food ingredients in their non-naturally occurring states, e.g., after purification, chemical or enzymatic synthesis as opposed to, for instance, in whole human milk.
(26) A probiotic refers to live microorganisms that when administered in adequate amounts confer a health benefit on the host.
(27) A polynucleotide or polypeptide sequence is heterologous to an organism or a second sequence if it originates from a different species, or, if from the same species, it is modified from its original form. For example, a promoter operably linked to a heterologous coding sequence refers to a coding sequence from a species different from that from which the promoter was derived, or, if from the same species, a coding sequence which is not naturally associated with the promoter (e.g. a genetically engineered coding sequence or an allele from a different ecotype or variety). Similarly, a heterologous expression cassette includes sequence(s) that are from a different species than the cell into which the expression cassette is introduced, or if from the same species, is genetically modified.
(28) Recombinant refers to a genetically modified polynucleotide, polypeptide, cell, tissue, or organism. When used with reference, e.g., to a cell, nucleic acid, protein, or vector, the term indicates that the cell, nucleic acid, protein or vector has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all. For example, a recombinant polynucleotide (or a copy or complement of a recombinant polynucleotide) is one that has been manipulated to be different from its natural form. A recombinant expression cassette comprising a promoter operably linked to a second polynucleotide (e.g., a coding sequence) can include a promoter that is heterologous to the second polynucleotide as the result of human manipulation (e.g., by methods described in Sambrook et al., Molecular CloningA Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y., (1989) or Current Protocols in Molecular Biology Volumes 1-3, John Wiley & Sons, Inc. (1994-1998)). A recombinant expression cassette (or expression vector) typically comprises polynucleotides combinations that are not found in nature. For instance, human manipulated restriction sites or plasmid vector sequences can flank or separate the promoter from other sequences. A recombinant protein is one that is expressed from a recombinant polynucleotide, and recombinant cells, tissues, and organisms are those that comprise recombinant sequences (polynucleotide and/or polypeptide).
(29) The terms nucleic acid, oligonucleotide, polynucleotide, and like terms typically refer to polymers of deoxyribonucleotides or ribonucleotides in either single- or double-stranded form, and complements thereof. The term nucleotide typically refers to a monomer. The terms encompass nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides. Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs).
(30) Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19: 5081 (1991); Ohtsuka et al., J. Biol. Chem. 260: 2605-2608 (1985); Rossolini et al., Mol. Cell. Probes 8: 91-98 (1994)). The term nucleic acid is used interchangeably with gene, cDNA, mRNA, oligonucleotide, and polynucleotide.
(31) The term gene refers to a segment of DNA involved in producing a protein; it includes regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons). The leader, the trailer as well as the introns include regulatory elements that are necessary during the transcription and the translation of a gene (e.g., promoters, enhancers, etc.). A gene product can refer to either the mRNA or protein expressed from a particular gene.
(32) The words complementary or complementarity refer to the ability of a nucleic acid in a polynucleotide to form a base pair with another nucleic acid in a second polynucleotide. For example, the sequence A-G-T is complementary to the sequence T-C-A. Complementarity may be partial, in which only some of the nucleic acids match according to base pairing, or complete, where all the nucleic acids match according to base pairing.
(33) The terms transfection or transfected refer to introduction of a nucleic acid into a cell by non-viral or viral-based methods. The nucleic acid molecules may be gene sequences encoding complete proteins or functional portions thereof. See, e.g., Sambrook et al., 1989, Molecular Cloning: A Laboratory Manual, 18.1-18.88.
(34) The word expression or expressed as used herein in reference to a gene means the transcriptional and/or translational product of that gene. The level of expression of a DNA molecule in a cell may be determined on the basis of either the amount of corresponding mRNA that is present within the cell or the amount of protein encoded by that DNA produced by the cell.
(35) Expression of a transfected gene can occur transiently or stably in a cell. During transient expression the transfected gene is not transferred to the daughter cell during cell division. Since its expression is restricted to the transfected cell, expression of the gene is lost over time. In contrast, stable expression of a transfected gene can occur when the gene is co-transfected with another gene that confers a selection advantage to the transfected cell. Such a selection advantage may be a resistance towards a certain toxin that is presented to the cell.
(36) An expression vector refers to a nucleic acid that includes a coding sequence and sequences necessary for expression of the coding sequence. The expression vector can be viral or non-viral. A plasmid is a non-viral expression vector, e.g., a nucleic acid molecule that encodes for genes and/or regulatory elements necessary for the expression of genes. A viral vector is a viral-derived nucleic acid that is capable of transporting another nucleic acid into a cell. A viral vector is capable of directing expression of a protein or proteins encoded by one or more genes carried by the vector when it is present in the appropriate environment. Examples for viral vectors include, but are not limited to retroviral, adenoviral, lentiviral and adeno-associated viral vectors.
(37) The terms protein, peptide, and polypeptide are used interchangeably to denote an amino acid polymer or a set of two or more interacting or bound amino acid polymers. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
(38) The term amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, -carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid. The terms non-naturally occurring amino acid and unnatural amino acid refer to amino acid analogs, synthetic amino acids, and amino acid mimetics which are not found in nature.
(39) Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
(40) Conservatively modified variants applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are silent variations, which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence with respect to the expression product, but not with respect to actual probe sequences.
(41) As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a conservatively modified variant where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Conservatively modified variants can include polymorphic variants, interspecies homologs (orthologs), intraspecies homologs (paralogs), and allelic variants.
(42) Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
(43) The terms identical or percent identity, in the context of two or more nucleic acids or proteins, refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acids that are the same (i.e., about 60% identity, preferably 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters, or by manual alignment and visual inspection. See e.g., the NCBI web site at ncbi.nlm.nih.gov/BLAST/. Such sequences are then said to be substantially identical. This definition also refers to, or may be applied to, the compliment of a test sequence. The definition also includes sequences that have deletions and/or additions, as well as those that have substitutions. Preferred algorithms can account for gaps and the like. Identity is typically calculated over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides in length, or over the entire length of a given sequence.
(44) A control sample or value refers to a sample that serves as a reference, usually a known reference, for comparison to a test sample. For example, a test sample can include a solution comprising glycoprotein exposed to a polypeptide with an endoglycosidase domain (e.g., SEQ ID NO:1 or SEQ ID NO:2), while the control sample does not include the polypeptide, or includes a different, known glycan-cleaving domain. In another example, a test sample can be taken from a patient sensitive to a particular glycoprotein, and compared to samples from a known normal (non-sensitive) individual. A control can also represent an average value gathered from a population of similar individuals, e.g., patients or healthy individuals with a similar medical background, same age, weight, etc. A control value can also be obtained from the same individual, e.g., from an earlier-obtained sample, prior to onset of the targeted condition or symptom, or prior to treatment. One of skill will recognize that controls can be designed for assessment of any number of parameters.
(45) One of skill in the art will understand which controls are valuable in a given situation and be able to analyze data based on comparisons to control values. Controls are also valuable for determining the significance of data. For example, if values for a given parameter are widely variant in controls, variation in test samples will not be considered as significant.
(46) As used herein, the terms pharmaceutical composition is used synonymously with physiologically acceptable and pharmacologically acceptable. A pharmaceutical composition will generally comprise agents for buffering and preservation in storage, and can include buffers and carriers for appropriate delivery, depending on the route of administration.
(47) The terms dose and dosage are used interchangeably herein. A dose refers to the amount of active ingredient given to an individual at each administration. For the present invention, the dose will generally refer to the amount of antibiotic or anti-inflammatory agent, though dosage can also be expressed in terms of bacterial concentration. The dose will vary depending on a number of factors, including frequency of administration; size and tolerance of the individual; severity of the condition; risk of side effects; and the route of administration. One of skill will recognize that the dose can be modified depending on the above factors or based on therapeutic progress. The term dosage form refers to the particular format of the pharmaceutical, and depends on the route of administration. For example, a dosage form can be in a liquid form for nebulization, e.g., for inhalants, in a tablet or liquid, e.g., for oral delivery, or a saline solution, e.g., for injection.
(48) As used herein, the terms treat, therapeutic, prevent, and prophylactic are not intended to be absolute terms. The terms can refer to any delay in onset, reduction in the frequency or severity of adverse symptoms, improvement in patient comfort, etc. The effect of treatment can be compared to an individual or pool of individuals not receiving a given treatment, or to the same patient prior to, or after cessation of, treatment.
(49) The term therapeutically effective amount, as used herein, refers to that amount of the therapeutic agent sufficient to ameliorate the targeted condition or symptoms. For example, for the given parameter, a therapeutically effective amount will show an increase or decrease of at least 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%. Therapeutic efficacy can also be expressed as -fold increase or decrease. For example, a therapeutically effective amount can have at least a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a control.
III. Deglycosylating Enzymes
(50) The presently disclosed deglycosylating enzymes belong to the GH18 and GH85 families of endoglycosidases. These enzymes are capable of cleaving a much broader range of N-glycans from N-glycosylated proteins than previously characterized deglycosylating enzymes.
(51) N-glycosylation of proteins is common in eukaryotes, but also observed in bacteria. N-glycosylation is involved in protein folding, targeting of the glycoprotein to the membrane or for secretion, resistance to proteolysis, cell adhesion, intracellular signaling, and antigen presentation. N-glycoproteins include milk proteins (e.g., lactoferrin, IgA, and whey), immunoglobulins, and plant proteins (e.g., soy protein).
(52) N-glycans are divided into three classes: high (or oligo) mannose, complex, and hybrid. All three share a core molecule of two N-acetylglucosamines and three mannose residues (Man.sub.3GlcNAc.sub.2), which form two branches. High mannose N-glycans comprise mannose saccharides in both branches. Complex N-glycans include additional types of saccharides, e.g., D-glucose (Glc), D-galactose (Gal), Mannose, L-fucose (Fuc), sialic acid (e.g., N-acetylneuraminic acid (NeuAc)), N-acetylgalactosamine, and additional N-acetylglucosamines (GlcNAC), in both branches. Additional saccharides are in less complex organisms. Hybrid N-glycans have a mannose branch and a complex branch.
(53) The presently disclosed deglycosylating enzymes are unique in that they remove all three types of N-glycans. In some embodiments, the present deglycosylating enzymes cleave N-glycans with terminal fucosylation and/or sialylation, and/or core fucosylation.
(54) Accordingly, provided herein are deglycosylating enzymes with a broad N-glycan substrate range, i.e., capable of cleaving high mannose, complex, and hybrid N-glycans from a protein. In some embodiments, the deglycosylating enzyme is a GH18 endoglycosidase polypeptide comprising a sequence of GLDIDME (SEQ ID NO:1). In some embodiments, the polypeptide lacks a transmembrane domain that spans a cell membrane (i.e., the polypeptide is not present in its natural form spanning a membrane of a cell). In some embodiments, the polypeptide comprises a sequence having greater than 85% identity, e.g., 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%, to a sequence selected from the group consisting of SEQ ID NO:7-20. In some embodiments, the polypeptide comprises a sequence having greater than 85% identity to SEQ ID NO:7 or SEQ ID NO:15. In some embodiments the polypeptide comprises SEQ ID NO:7. In some embodiments, the polypeptide comprises SEQ ID NO:15. In some embodiments, the polypeptide comprises a sequence having greater than 85% identity, e.g., 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%, to SEQ ID NO:4 or SEQ ID NO:5. In some embodiments, the polypeptide comprises SEQ ID NO:4. In some embodiments, the polypeptide comprises SEQ ID NO:5.
(55) In some embodiments, the deglycosylating enzyme with a broad N-glycan substrate range is a GH85 endoglycosidase polypeptide comprising a sequence of FINQET (SEQ ID NO:2). In some embodiments, the polypeptide lacks a transmembrane domain that spans a cell membrane (i.e., the polypeptide is not present in its natural form spanning a membrane of a cell). In some embodiments, the polypeptide comprises a sequence having greater than 85% identity, e.g., 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%, to a sequence selected from the group consisting of SEQ ID NO:21-31. In some embodiments, the polypeptide comprises a sequence having greater than 85% identity to SEQ ID NO:29. In some embodiments the polypeptide comprises SEQ ID NO:29. In some embodiments, the polypeptide comprises a sequence having greater than 85% identity, e.g., 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%, to SEQ ID NO:6. In some embodiments, the polypeptide comprises SEQ ID NO:6.
(56) In some embodiments, the polypeptide is in an in vitro solution with an N-glycoprotein, wherein the N-glycoprotein comprises a high mannose, complex, and/or hybrid N-glycan. For example, a GH18 or GH85 endoglycosidase as described herein can be used in a laboratory or industrial setting to cleave N-glycans from N-glycoproteins, creating over time a solution of endoglycosidase, a decreasing amount of N-glycoproteins, and increasing amounts of free glycans and deglycosylated proteins. In some embodiments, the N-glycan comprises core fucosylation, terminal fucosylation, or terminal sialylation. The polypeptide, while not spanning a cell membrane in its natural form, can include a transmembrane domain. In some embodiments, the polypeptide can be linked to a substrate, e.g. a bead or plate surface.
(57) In some embodiments, the deglycosylating enzyme with a broad N-glycan substrate range is a GH18 endoglycosidase polypeptide comprising a sequence of GLDIDME (SEQ ID NO:1) and is recombinantly expressed in a cell. In some embodiments, the polypeptide spans the membrane of the cell. In some embodiments, the polypeptide comprises a sequence having substantial identity (e.g., greater than 85% identity, e.g., 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%) to a sequence selected from the group consisting of SEQ ID NO:7-20. In some embodiments, the polypeptide comprises a sequence having greater than 85% identity to SEQ ID NO:7 or SEQ ID NO:15. In some embodiments the polypeptide comprises SEQ ID NO:7. In some embodiments, the polypeptide comprises SEQ ID NO:15. In some embodiments, the polypeptide comprises a sequence having greater than substantial identity (e.g., greater than 85% identity, e.g., 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%) to SEQ ID NO:4 or SEQ ID NO:5. In some embodiments, the polypeptide comprises SEQ ID NO:4. In some embodiments, the polypeptide comprises SEQ ID NO:5. In some embodiments, the polypeptide comprises a sequence having substantial identity (e.g., greater than 85% identity, e.g., 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%) to the full length mature polypeptide sequence of EndoBI-1 or EndoBI-2.
(58) In some embodiments, the deglycosylating enzyme with a broad N-glycan substrate range is a GH85 endoglycosidase polypeptide comprising a sequence of FINQET (SEQ ID NO:2) and is recombinantly expressed in a cell. In some embodiments, the polypeptide spans the membrane of the cell. In some embodiments, the polypeptide comprises a sequence having substantial identity (e.g., greater than 85% identity, e.g., 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%) to a sequence selected from the group consisting of SEQ ID NO:21-31. In some embodiments, the polypeptide comprises a sequence having greater than 85% identity to SEQ ID NO:29. In some embodiments the polypeptide comprises SEQ ID NO:29. In some embodiments, the polypeptide comprises a sequence having substantial identity (e.g., greater than 85% identity, e.g., 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%) to SEQ ID NO:6. In some embodiments, the polypeptide comprises SEQ ID NO:6.
(59) In some embodiments, the polypeptide recombinantly expressed in a cell is in an in vitro solution with an N-glycoprotein, wherein the N-glycoprotein comprises a high mannose, complex, and/or hybrid N-glycan. For example, recombinant cells expressing a GH18 or GH85 endoglycosidase as described herein can be used in a laboratory or industrial setting to cleave N-glycans from N-glycoproteins, creating over time a solution of cells, a decreasing amount of N-glycoproteins, and increasing amounts of free glycans and deglycosylated proteins. In some embodiments, the N-glycan comprises core fucosylation, terminal fucosylation, or terminal sialylation.
(60) The deglycosylating enzymes described herein can be used for generating free glycans, generating deglycosylated polypeptides for use in nutritional, prophylactic, or therapeutic applications. The deglycosylating enzymes can also be used for proteomic or glycoproteomic studies, providing a one-step deglycosylation that facilitates characterization of proteins or glycans that are normally inaccessible or that normally require multiple enzymatic or chemical treatments before study.
IV. Methods of Making Recombinant Enzymes
(61) The deglycosylating enzymes described herein can be recombinantly expressed and produced using methods well known in the art. Routine techniques in the field of recombinant protein expression and production can be found, e.g., in Sambrook & Russell, Molecular Cloning, A Laboratory Manual (3rd Ed, 2001); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al., eds., 1994-1999).
(62) Bifidobacteria are designated GRAS, and thus can be used for recombinant expression of the presently described deglycosylating enzymes. Exemplary Bifidobacteria (e.g., Bifidobacteria recombinantly expressing a deglycosylating enzyme) can include, but are not limited to, B. longum bv infantis, B. longum bv longum, B. breve, and B. adolescentis.
(63) One of skill will recognize, however, that many eukaryotic and prokaryotic cells can be used for routine cloning, expression, and production of the deglycosylating enzymes disclosed herein. These include animal cells, insect cells, bacteria, fungi, and yeasts, many of which are commercially available. For example, common laboratory strains of E. coli, yeast, or mammalian cells can be used to produce the recombinant deglycosylating enzymes. Methods for introduction and expression of isolated or heterologous nucleic acids in a cell are well-known, and can be found, for example, in the general reference, supra. Accordingly, this invention also provides for host cells and expression vectors comprising the nucleic acid sequences described herein.
(64) Nucleic acids encoding the presently described deglycosylating enzymes can be made using standard recombinant or synthetic techniques. Nucleic acids may be RNA, DNA, or hybrids thereof. One of skill can construct a variety of clones containing functionally equivalent nucleic acids, such as nucleic acids that encode the same polypeptide. Cloning methodologies to accomplish these ends, and sequencing methods to verify the sequence of nucleic acids are well known in the art.
(65) In some embodiments, the nucleic acids are synthesized in vitro. Deoxynucleotides may be synthesized chemically according to the solid phase phosphoramidite triester method described by Beaucage & Caruthers, Tetrahedron Letts. 22(20): 1859-1862 (1981), using an automated synthesizer, e.g., as described in Needham-VanDevanter, et al., Nucleic Acids Res. 12: 6159-6168 (1984). In other embodiments, the desired nucleic acid sequence may be obtained by an amplification reaction, e.g., PCR.
(66) One of skill will be familiar with methods for generating alterations or variants of a given polynucleotide or polypeptide sequence, e.g., for optimal expression in a given cell.
(67) To obtain high level expression of a desired sequence (e.g., a sequence that results in ablation of PGCs), an expression vector is constructed that includes such elements as a promoter to direct transcription, a transcription/translation terminator, a ribosome binding site for translational initiation, and the like. Suitable bacterial promoters are well known in the art and described, e.g., in the references providing expression cloning methods and protocols cited hereinabove. Kits for such expression systems are commercially available. Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available.
(68) In addition to the promoter, the expression vector typically contains a transcription unit or expression cassette that contains all the additional elements required for expression of the nucleic acid in host cells. A typical expression cassette thus contains a promoter operably linked to the nucleic acid sequence encoding the protein or inhibitory polynucleotide, and signals required for efficient polyadenylation of the transcript, ribosome binding sites, and translation termination.
(69) The expression cassette can contain a transcription termination region downstream of the structural gene to provide for efficient termination. The termination region may be obtained from the same gene as the promoter sequence or may be obtained from different genes.
(70) The particular expression vector used to transport the genetic information into the cell is not particularly critical. Any of the conventional vectors used for expression in eukaryotic or prokaryotic cells may be used. Standard bacterial expression vectors include plasmids such as pBR322 based plasmids, pSKF, pET15b, pET23D, pET-22b(+), and fusion expression systems such as GST and LacZ. Epitope tags can also be added to recombinant proteins to provide convenient methods of isolation, e.g., 6-his. These vectors comprise, in addition to the expression cassette containing the coding sequence, the T7 promoter, transcription initiator and terminator, the pBR322 ori site, a bla coding sequence and a lacl operator.
(71) The expression vectors or plasmids of the invention can be transferred into the chosen host cell by well-known methods such as calcium chloride transformation for E. coli and calcium phosphate treatment, liposomal fusion or electroporation for mammalian cells. Cells transformed by the plasmids can be selected by resistance to antibiotics conferred by genes contained on the plasmids, such as the amp, gpt, neo and hyg genes.
(72) The expression level of a gene can be determined by detecting mRNA, protein, or activity according to techniques known in the art. For example, mRNA levels can be detected using Northern blots, reverse transcription PCR (RTPCR), or quantitative RTPCR (sometimes called real time PCR). Such techniques are reviewed, e.g., in VanGuilder et al. (2008) Biotechniques 44: 619 and Real-Time PCR: Current Technology and Applications, Caister Academic Press (2009). Protein levels can be detected using antibody-based assays, e.g., Western blots or ELISAs. In some embodiments, protein expression can be detected by detecting an operably-linked protein label, e.g., GFP, 6-histine, or biotin.
(73) In some embodiments, the recombinantly produced deglycosylating enzyme can be purified from the cell, e.g., separated from other cellular components, using known techniques. For example, where the deglycosylating enzyme lacks a transmembrane domain, the enzyme is typically isolated and used separately from the recombinant cell. In some embodiments, the recombinantly produced deglycosylating enzyme includes a transmembrane domain, and the deglycosylating enzyme-expressing cell is used.
V. Prebiotic and Probiotic Compositions and Applications
(74) As indicated above, the presently described deglycosylating enzymes, as well as the free glycans and/or deglycosylated proteins released by the enzymes, can be used for nutritional, prophylactic and therapeutic purposes.
(75) The deglycosylating enzymes described herein can be involved in modulating protein stability and immune recognition of N-glycosylated proteins, e.g., in a host organism. For example, recognition of Gram-positive bacteria by IgA is dependent on its glycosylation (Mathias & Corthesy, J Biol Chem 286: 17239-17247 (2011)). Intracellular signaling and NF-kB activation of the toll-like receptor 3 (Sun et al., J Biol Chem 281: 11144-11151 (2006)) is modulated by N-glycans. C-type lectins, galectins and sialic-acid-binding Ig-like lectins are immune and cell response mediators that specifically recognize different epitopes in N-glycans (Varki, Essentials of glycobiology (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.) 2nd Ed pp xxix, 784 p. (2009)). Accordingly, the presently described deglycosylating enzymes can be administered to an individual, either in isolated form, or recombinantly expressed in a cell to modulate immune recognition and/or signaling and/or processing of glycosylated proteins.
(76) In some embodiments, the compositions of the invention are administered to those in need stimulation of the immune system and/or for promotion of resistance to bacterial or yeast infections, e.g., Candidiasis or diseases induced by sulfate reducing bacteria.
(77) Glycans produced by the presently described deglycosylating enzymes can be administered as a prebiotic formulation (i.e., without bacteria) or as a probiotic formulation (i.e., with desirable bacteria such as Bifidobacteria or other food grade bacteria). In addition, a probiotic formulation can include recombinant cells (e.g., Bifidobacteria or other food grade bacteria) expressing a deglycosylating enzyme as described herein.
(78) Glycans (or oligosaccharides) produced by the presently described deglycosylating enzymes can be isolated and used separately or individually. N-glycans come in a wide variety of structures and sizes, and can include complex oligosaccharide structures. Deglycosylating enzymes isolated from beneficial gut bacteria, such as Bifidobacteria, typically produce N-glycans that stimulate growth of the beneficial bacteria, as well as deglycosylated proteins that can be more readily digested by the host.
(79) Examples of free N-glycans that can be used individually or in any combination are those listed in the Tables in Example 8, which describes the composition of N-glycans freed from bovine milk glycoproteins by the EndoBI-1 enzyme. Additional examples of free N-glycans that can be used individually or in any combination are those shown in
(80) In some embodiments, provided herein are prebiotic or probiotic compositions comprising at least one of the free N-glycans generated by the presently described deglycosylating enzymes, e.g.,
(81) an oligosaccharide consisting of 3 Hex (glucose, galactose, or mannose) moieties and 5 HexNAc (GlcNac or GalNAc) moieties;
(82) an oligosaccharide consisting of 4 Hex moieties, 4 HexNAc moieties;
(83) an oligosaccharide consisting of 4 Hex moieties, 4 HexNAc moieties, and 1 NeuAc (N-acetylneuraminic acid) moiety;
(84) an oligosaccharide consisting of 5 Hex moieties, 3 HexNAc moieties, and 1 NeuAc moiety;
(85) an oligosaccharide consisting of 4 Hex moieties, 3 HexNAc moieties, and 1 NeuAc moiety;
(86) an oligosaccharide consisting of 3 Hex moieties, 5 HexNAc moieties, and 1 NeuAc moiety;
(87) an oligosaccharide consisting of 5 Hex moieties, 1 Fuc (fucose) moiety, 3 HexNAc moieties, and 1 NeuGc (N-glycolylneuraminic acid) moiety; and
(88) an oligosaccharide consisting of 5 Hex moieties, 3 HexNAc moieties, and 2 NeuAc moieties.
(89) In some embodiments the prebiotic or probiotic composition comprises at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 of the free N-glycans generated by the presently described deglycosylating enzymes. In some embodiments, provided herein is a composition comprising free N-glycans, wherein said free N-glycans are produced by contacting a deglycosylating enzyme (e.g., a GH18a, GH18b, or GH85 enzyme) with milk. In some embodiments, the composition comprises the free N-glycans separated from the remaining milk components. In some embodiments, the composition comprises free N-glycans and deglycosylated milk proteins.
(90) In general, any food or beverage that can be consumed by human infants or adults or animals can be used to make formulations containing such prebiotic and probiotic compositions. Exemplary foods include those with a semi-liquid consistency to allow easy and uniform dispersal of the prebiotic and probiotic compositions of the invention. However, other consistencies (e.g., powders, liquids, etc.) can also be used without limitation. Accordingly, such food items include, without limitation, dairy-based products such as cheese, cottage cheese, yogurt, and ice cream, nut-containing formulations such as peanut butter, plant-based products such as tofu or other soy products, and egg-containing formulations, e.g., custards and processed egg products. Processed fruits and vegetables, including those targeted for infants/toddlers, such as apple sauce or strained peas and carrots, are also suitable for use in combination with the prebiotic and probiotic formulations. In addition to foods targeted for human consumption, animal feeds may also be supplemented with the prebiotic and probiotic compositions of the invention.
(91) The prebiotic and probiotic compositions can also be used to supplement a beverage. Examples of such beverages include, without limitation, infant formula, follow-on formula, toddler's beverage, milk, soy milk, fermented milk, fruit juice, fruit-based drinks, and sports drinks. Many infant and toddler formulas are known in the art and are commercially available, including, for example, Carnation Good Start (Nestle Nutrition Division; Glendale, Calif.) and Nutrish AB produced by Mayfield Dairy Farms (Athens, Tenn.). Other examples of infant or baby formula include those disclosed in U.S. Pat. No. 5,902,617. Other beneficial formulations of the compositions of the present invention include the supplementation of animal milks, such as cow's milk.
(92) The prebiotic and probiotic compositions can be formulated into pills or tablets or encapsulated in capsules, such as gelatin capsules. Tablet forms can optionally include, for example, one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, microcrystalline cellulose, gelatin, colloidal silicon dioxide, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes, disintegrating agents, and pharmaceutically compatible carriers. Lozenge or candy forms can comprise the compositions in a flavor, e.g., sucrose, as well as pastilles comprising the compositions in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art. The inventive prebiotic or probiotic formulations can also contain conventional food supplement fillers and extenders such as, for example, rice flour. Suitable formulations can be found, e.g., in Remington's Pharmaceutical Sciences, Mack Publishing Company, Philadelphia, Pa., 17.sup.th Ed. (1985).
(93) The dosages of the prebiotic and probiotic compositions of the present invention will be varied depending upon the requirements of the individual and will take into account factors such as age (infant versus adult), weight, and reasons for loss of beneficial gut bacteria (e.g., antibiotic therapy, chemotherapy, disease, or age). In some embodiments, the amount administered to an individual should be sufficient to establish colonization of the gut with beneficial bacteria over time. The size of the dose also will be determined by the existence, nature, and extent of any adverse side-effects that may accompany the administration of a prebiotic or probiotic composition described herein. In some embodiments, the dosage range will be effective as a food supplement and for reestablishing beneficial bacteria in the intestinal tract.
(94) In some embodiments, the dose of free N-glycans can range from about 1 micrograms/L to about 25 grams/L of galacto-oligosaccharides. In some embodiments, the dose of free N-glycans is about 100 micrograms/L to about 15 grams/L. In some embodiments, the dose of free N-glycans is 1 gram/L to 10 grams/L. Exemplary dosages of recombinant cells (e.g., Bifidobacteria) expressing the deglycosylating enzymes described herein include, but are not limited to, 10.sup.4 to 10.sup.12 colony forming units (CFU) per dose, e.g., 10.sup.6 to 10.sup.10 CFU per dose. Examples of N-glycans are milk oligosaccharides, e.g., from a human (HMO), bovine, or ovine.
(95) The prebiotic or probiotic formulations of the invention can be administered to any individual in need thereof. In some embodiments, the individual is an infant or toddler. For example, in some embodiments, the individual is less than, e.g., 3 months, 6 months, 9 months, one year, two years or three years old. In some embodiments, the individual is an adult. For example, in some embodiments, the individual is over 50, 55, 60, 65, 70, or 75 years old. In some embodiments, the individual is immuno-deficient (e.g., the individual has AIDS or is taking chemotherapy).
(96) Exemplary Bifidobacteria (e.g., Bifidobacteria recombinantly expressing a deglycosylating enzyme) that can be included in the probiotic compositions of the invention include, but are not limited to, B. longum bv infantis, B. longum bv longum, B. breve, and B. adolescentis. The Bifidobacterium used can depend in part on the target consumer. For example, a B. longum bv infantis probiotic is typically administered to an infant or young child (e.g., under 5 years old). In some embodiments, B. longum bv infantis is included in, or in conjunction with, an infant formula or follow-on formula. In some embodiments, the probiotic composition administered to an adult or an elderly person. In some embodiments, the person is at least 50, 60, 70, or 80 years old. One of skill will recognize that the bacterial strain is not crucial as long as it expresses a deglycosylating enzyme as described herein.
(97) It will be appreciated that it may be advantageous for some applications to include other Bifidogenic factors in the formulations of the present invention. Such additional components may include, but are not limited to, fructoligosaccharides such as Raftilose (Rhone-Poulenc, Cranbury, N.J.), inulin (Imperial Holly Corp., Sugar Land, Tex.), and Nutraflora (Golden Technologies, Westminister, Colo.), as well as lactose, xylooligosaccharides, soyoligosaccharides, lactulose/lactitol, among others.
(98) In some embodiments, the compositions of the invention are administered to a human or animal in need thereof. For example, in some embodiments, the compositions of the invention are administered to a person or animal having at least one condition selected from the group consisting of inflammatory bowel syndrome, constipation, diarrhea, colitis, Crohn's disease, colon cancer, functional bowel disorder (FBD), irritable bowel syndrome (MS), excess sulfate reducing bacteria, inflammatory bowel disease (IBD), and ulcerative colitis. Irritable bowel syndrome (IBS) is characterized by abdominal pain and discomfort, bloating, and altered bowel function, constipation and/or diarrhea. There are three groups of IBS: Constipation predominant IBS (C-IBS), Alternating IBS (A-IBS) and Diarrhea predominant IBS (D-IBS).
VI. Kits
(99) The deglycosylating enzymes described herein can be included as part of a kit, e.g., for generating free glycans and/or deglycosylated polypeptides. In some embodiments, the kit includes an expression vector comprising a coding sequence for a deglycosylating enzyme described herein (e.g., an endoglycosidase comprising an amino acid sequence of SEQ ID NO:1 or 2 with broad substrate specificity). In some embodiments, the kit includes a recombinant cell comprising such an expression vector. In some embodiments, the kit includes the deglycosylating enzyme, e.g., in a buffer or lyophilized form.
(100) In some embodiments, the kit includes a control, e.g., a set of standard free glycans, standard glycoproteins, standard deglycosylated proteins, or another deglycosylating enzyme (e.g., one with a limited substrate specificity).
(101) In some embodiments, the kit can include components for separating free glycans and deglycosylated proteins, e.g., affinity based or size based separation components such as spin columns or chromatography reagents. Where the presently disclosed enzymes are to be used to generate free glycans and/or deglycosylated proteins for further characterization, the kit can further include buffers for the free glycans and/or deglycosylated proteins. In some embodiments, the kit can include reagents for further characterization, e.g., gel or reagents for size determination, reagents for preparation of a sample for MALDI analysis, etc.
(102) In some embodiments, the kit can be used for generating free glycans and/or deglycosylated proteins for administration (e.g., as a food product, prophylactic or therapeutic agent). In such cases, the kit can include pharmaceutically acceptable excipients and/or buffers.
(103) Such kits can also include standard reagents for recombinant techniques, e.g., expression vector, media, buffers, etc. Kits often also include instructions for using components of the kits, e.g., for optimal application-dependent deglycosylating conditions. The kit can also include consumables, such as tubes, pipettes, and/or glassware for carrying out the methods of the invention.
(104) It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, sequence database entries, internet sites, patents, and patent applications cited herein are incorporated by reference in their entireties for all purposes.
VII. Examples
A. Example 1. Infant Isolates of Bifidobacteria Display Endo-N-Acetylglucosaminidase Activity
(105) Bovine ribonuclease B (RNAseB) is a 17 kDa glycoprotein that contains one glycosylation site, composed of high mannose N-linked glycans. Cleavage by endoglycosidases results in a molecule of 14 kDa. Overnight incubations of bifidobacterial isolates with RNAseB suggested that endoglycosidase activity is present in only some isolates. None of the B. bifidum strains examined displayed this phenotype, and B. infantis strains degraded RNAseB weakly. Incubation of B. infantis ATCC 15697 with 5 mg/ml of RNAseB led to a gradual deglycosylation of this glycoprotein over time (
(106) Distribution of endo-N-acetylglucosaminidase gene sequences in bifidobacteria. Protein sequences of endo-N-acetylglucosaminidases found in the sequenced genomes of Bifidobacterium were aligned and degenerated primers designed to amplify conserved regions (see Tables 1-3). PCR products from 77 isolates of Bifidobacteria (Table 4) were sequenced, and full gene sequences were determined using a DNA-walking approach. Several isolates encoded proteins belonging to glycohydroase family 18 (GH18) or 85 (GH85). All strains containing one of these sequences also cleaved RNAseB in vitro, and strains lacking such genes did not show endoglycosidase activity, indicating that the GH18 or GH85 type enzymes were responsible for the observed RNaseB cleavage.
(107) A phylogenetic tree (
B. Example 2: Enzymatic Properties of Bifidobacterial Endo-N-Acetylglucosaminidases
(108) Based on the sequence alignments (
(109) Properties of EndoBI-1, EndoBI-2 and EndoBB
(110) TABLE-US-00001 EndoBI-1 EndoBI-2 EndoBB Family GH18 GH18 GH85 Calculated MW 47 kDa 47 kDa 98 kDa (recombinant protein) Transmembrane 2 2 1 domains Optimum pH 5.0 5.0 5.0 Optimum temperature 37-45 C. 37-45 C. 30-45 C. Heat resistance Yes Yes No
(111) Human lactoferrin (hLF) contains core fucosylated complex N-glycans, predominantly in two glycosites (Yu et al., Glycobiology 21: 206-224 (2011)). Bovine lactoferrin (bLF) represents a minor fraction of bovine milk, and it contains high mannose and hybrid N-linked glycans at five glycosites (Nwosu et al., J Proteome Res 10: 2612-2624 (2011)). Overnight incubations of bLF and hLF with the three Bifidobacterium endoglycosidases indicated that all of them were able to cleave bLF, as observed by discrete changes in MW on SDS-PAGE gels (
C. Example 3: EndoBI-1 Cleaves the Chitobase Core in High Mannose and Complex N-Glycans
(112)
D. Example 4: EndoBI-1 Binds Specifically the Core of N-Linked Glycans
(113) The conserved active site in GH18 enzymes includes a D-X-E motif, where D and E have been reported to be necessary for activity. Asp184 in EndoBI-1 was mutated by site-directed mutagenesis to Asn184 (EndoBI-1 mut or EndoBI-1 D184N). The mutant enzyme specifically bound to the core of N-glycans, Man.sub.3GlcNAc.sub.2 on a mammalian glycan array (
E. Example 5: EndoBI-1 has Activity on Human Milk Glycoproteins
(114) Breast milk is a complex fluid, characterized by diverse types and high amounts of N-linked, O-linked and non-glycosylated proteins. Overnight incubation of a fresh human milk sample with EndoBI-1 or PNGaseF produced a shift in the molecular weight of primarily lactoferrin (
F. Example 6: Impact of hLF and bLF on B. infantis Gene Expression
(115) B. infantis ATCC 15697 in the presence of bLF or hLF revealed increased expression of Blon_2468 (EndoBI-1), compared to cells cultured with glucose. The level of expression was, however, similar to that from cells grown on lactose (
G. Example 7: Utilization of Released Glycans
(116) GH18 enzyme-expressing bacteria such as E. faecalis, S. pyogenes, and Capnocytophaga canimorsus can use various glycoproteins as a carbon source. In addition, EndoS from S. pyogenes, specifically deglycosylates IgG, severely impairing immune reaction to the bacteria and increasing its survival in blood. Bifidobacterium isolates can grow well on N-linked glycans as a main carbon source. As shown in
H. Example 8: EndoBI-1 has Activity on Bovine Milk Glycoproteins
(117) EndoBI-1, the GH18 enzyme expressed by B. infantis ATCC 15697 (Blon_2468), was tested for its activity on bovine milk glycoproteins using samples from a local dairy. The composition of released N-glycans was determined by Nano-LC (liquid chromatography) Q-TOF (quadrupole time-of-flight), and is shown in the tables below. N-glycans were characterized as follows:
(118) Hex: Glucose, galactose, or mannose
(119) Fuc: Fucose
(120) NeuAc: N-acetylneuraminic acid
(121) NeuGc: N-glycolylneuraminic acid
(122) Bovine Milk Sample 1
(123) TABLE-US-00002 Reten- Vol- Com- tion ume pound Mass time (peak) Hex Fuc HexNAc NeuAc NeuGc 1 1437.51 11.547 31856 5 0 3 0 0 2 1437.51 12.212 57092 5 0 3 0 0 3 1031.35 14.304 63882 5 0 1 0 0 4 1519.57 14.913 160198 3 0 5 0 0 5 1478.54 15.505 73266 4 0 4 0 0 6 1519.57 15.727 276803 3 0 5 0 0 7 1728.61 15.907 24540 5 0 3 1 0 8 1478.54 16.345 203480 4 0 4 0 0 9 1687.58 16.809 57655 6 0 2 1 0 10 1437.52 16.956 88016 5 0 3 0 0 11 1810.67 18.249 59921 3 0 5 1 0 12 1810.67 19.062 166554 3 0 5 1 0 13 1769.64 19.492 255565 4 0 4 1 0 14 1769.64 19.823 48888 4 0 4 1 0 15 1728.61 20.047 194087 5 0 3 1 0 16 1769.64 20.163 429713 4 0 4 1 0 17 1728.61 20.792 551414 5 0 3 1 0 18 1421.55 28.295 127956 4 1 3 0 0 19 1745.64 28.445 76358 6 1 3 0 0 20 1728.67 33.518 79818 5 0 3 1 0 21 1566.61 49.239 285443 4 0 3 1 0
Bovine Milk Sample 2
(124) TABLE-US-00003 Reten- Vol- Com- tion ume pound Mass time (peak) Hex Fuc HexNAc NeuAc NeuGc 1 1519.58 14.817 44196 3 0 5 0 0 2 1478.55 15.4 19365 4 0 4 0 0 3 1519.58 15.644 122126 3 0 5 0 0 4 1478.55 16.233 68580 4 0 4 0 0 5 1437.53 16.833 44391 5 0 3 0 0 6 1687.59 16.988 26907 6 0 2 1 0 7 1810.68 18.351 136099 3 0 5 1 0 8 1769.65 18.894 57851 4 0 4 1 0 9 1810.68 19.075 243243 3 0 5 1 0 10 1769.65 19.453 570306 4 0 4 1 0 11 1728.62 20.006 391845 5 0 3 1 0 12 1769.65 20.115 2E+06 4 0 4 1 0 13 1744.62 20.729 82204 5 0 3 0 1 14 1728.62 20.761 3E+06 5 0 3 1 0 15 1890.68 22.574 54025 5 1 3 0 1 16 1890.68 23.261 249499 5 1 3 0 1 17 1769.65 23.571 152940 4 0 4 1 0 18 2051.71 24.02 167688 5 0 3 0 2 19 2035.71 24.096 157601 5 0 3 1 1 20 2019.72 24.227 296020 5 0 3 2 0 21 2051.71 24.364 200140 5 0 3 0 2 22 2035.72 24.432 115802 5 0 3 1 1 23 2019.72 24.47 104626 5 0 3 2 0 24 2019.72 24.743 246864 5 0 3 2 0
(125) The results show that the primary N-glycan produced in samples 1 and 2 comprises 5 Hex moieties, 3 HexNac moieties, and 1 NeuAc moiety (compounds 17 and 14, respectively). However, each of the free glycans produced by the deglycosylating enzyme can be used alone or in combination for prebiotic or probiotic compositions, e.g., to improve gut health or increase growth of bifidobacteria. The deglycosylation reaction results in a wealth of free glycans, as well as deglycosylated milk proteins that can be more easily digested. The results show that an enzyme produced by B. infantis can act on milk from multiple organisms to produce free glycans.
I. Summary
(126) GH18 and GH85 endoglycosidases specifically cleave the NN-diacetylchitobiose core of N-linked glycans. EndoBI-1 and EndoBI-2 are representatives of two clades of GH18 sequences found in bifidobacteria (
(127) The specificity of most known endoglycosidases is limited to high mannose glycans (e.g., EndoH). EndoS acts solely on IgG. Endoglycosidases F1, F2 and F3 show a preference for either high mannose or complex oligosaccharides, but not both. In contrast, EndoBI-1 showed broad substrate specificity, releasing N-glycans from human IgA, IgG, RNase B and bovine fetuin, as well as human milk (
(128) The presently disclosed deglycosylating enzymes retained activity after incubation at 95 C. for 5 minutes. This property allows for the denaturing of glycoprotein substrate for greater access to glycosylated sites, and higher activity. In addition, Bifidobacteria are already designated GRAS by the FDA, so the enzymes can be recombinantly expressed in these bacteria for probiotic applications. Unlike PNGaseF, EndoBI-1 leaves a residual GlcNAc attached to the asparagine of the protein, which can be useful for glycosite determination in glycoproteomic applications.
(129) Several bifidobacteria in this study possessed a GH85 enzyme. EndoBB (BLD_0197) from B. longum DJO10A cleaved high mannose glycans, cleaving RNAseB and bLF, but not hLF. The function of GH85 endoglycosidases in these B. breve isolates may be associated to -galactosidases, -hexosaminidases and -sialidases. The presence of -mannosidases and an ABC importer for oligosaccharides near these genes indicate related function, and that these clusters may be active on plant-derived oligosaccharides.
(130) Endoglycosidase EndoBI-1 in B. infantis ATCC 15697 was constitutively expressed during coincubation with bovine and human lactoferrin. Strains of B. infantis can use HMO as a sole carbon source (Locascio et al., Microb Biotechnol 2: 333-342 (2009)). Genes induced by HMO in B. infantis, such as solute binding proteins and -fucosidases (Garrido et al., PLoS One 6:e17315 (2011); Sela et al., Applied and Environmental Microbiology (2011)), were also up-regulated by hLF and bLF (
J. Materials and Methods
(131) Bacteria and Media.
(132) Bifidobacterium strains used in this study are listed in Table 4. For routine experiments, bifidobacteria were grown on de Mann-Rogose-Sharp broth with no carbon source (mMRS), supplemented with 0.05% w/v L-cysteine (Sigma-Aldrich, St. Louis, Mo.) and 2% lactose. Zhang-Mills-Block (ZMB-1) media was used for evaluation of bacterial growth on glycoproteins or transcriptional analyses. Cells were anaerobically grown in a vinyl chamber (Coy Laboratory Products, Grass Lake, Mich.) at 37 C. for 24 h. Competent Escherichia coli BL21 Star and Top10 cells were from Invitrogen (Carlsbad, Calif.). Transformant E. coli cells were grown in Luria Broth with 50 g/ml Carbenicillin (Teknova, Hollister Calif.) when necessary at 37 C.
(133) Incubations of Bifidobacteria with Glycoproteins.
(134) Bifidobacterial isolates were grown on 2 ml mMRS with 2% lactose to mid-late exponential phase. Cultures were centrifuged for 1 min at 12000 rpm, and resuspended in 2 ml of mMRS supplemented with 5 mg/ml of ribonuclease B from bovine pancreas (Sigma-Aldrich, St. Louis, Mo.). Incubations were run for 18 hours, and supernatants were recovered after centrifugation 1 min at 12000 rpm. A 1:10 dilution of each supernatant was denatured in glycoprotein denaturing buffer (0.5% SDS and 40 mM DTT) and analyzed on 4-15% precast SDS-PAGE gels (Bio-Rad, Carlsbad Calif.). Growth of specific bacteria was also analyzed on 96 well plates containing 200 l of ZMB-1 media and 10 mg/ml of RNAseB, or 5 mg/ml of lactoferrin from human milk (Sigma) and lactoferrin from bovine milk (Sigma). Cultures were inoculated at 2% and grown for 72 h in a PowerWave microplate reader (BioTek Instruments, Inc., Winoosky, Vt.), under anaerobic conditions. Growth was monitored using Gen5 1.10 (BioTek). Cultures were grown in triplicate, and controls containing no glycoprotein and no bacteria were included and subtracted from OD600 values.
(135) Endoglycosidase Sequence Determinations.
(136) Protein coding sequences belonging to GH18 found in the genomes in B. infantis ATCC 15697 (Blon_2468), B. infantis 157F (BLIF_1310, and Enterococcus faecalis OG1RF (EndoE) were aligned using MUSCLE. Conserved regions were selected and converted to DNA to design degenerate primers (Table S2). A similar approach was used with sequences encoding GH85 enzymes, found in the published genome sequences of B. longum DJO10A (BLD_0197), B. longum NCC2703 (BL1335) and B. breve UCC2003.
(137) Genomic DNA was prepared from overnight cultures on MRS for each strain used in this study using the DNeasy Blood & Tissue Kit (Qiagen, Valencia Calif.). 50 l PCR reactions contained 1 U of Phusion DNA polymerase (Finnzymes, Vantaa, Finland), 1 ng of DNA, 0.2 mM of dNTPs and 0.5 M of each degenerate primers (Table S2), and were run in a PTC200 Thermo Cycler (MJ Research, Ramsey, Minn.). The PCR program included an initial denaturation at 98 C. for 2 min, 30 cycles of denaturation at 98 C. 30 s, annealing at 55 C. for 90 s, extension at 72 C. 2 min, and a final extension at 72 C. for 7 min. PCR products were purified using the Qiaquick PCR product purification kit (Qiagen), and sequenced at the UC Davis DNA sequencing facility. GH18 sequences were analyzed using BioEdit 7.1.3, and later expanded and fully determined using the DNA Walking SpeedUp Premix Kit (Seegene, Rockville Md.), and the TSP142 primers listed in Table 3. GH85 sequences were directly determined using primers GH85cF and GH85cR.
(138) Bioinformatic Analyses.
(139) The Integrated Microbial Genomes (IMG) (Markowitz et al. (2006) Nuc. Acid Res. 34: 344-388) database was used to find GH18 and GH85 protein sequences in Bifidobacterium genomes and to determine genetic landscapes for GH18-type and GH85-type genes found in the genomes of B. infantis ATCC 15697, B. infantis 157F and B. longum DJO10A. Multiple sequence alignments were performed using MUSCLE, using the Maximum Likelihood algorithm in MEGA v 5.0.
(140) Gene Cloning and Expression.
(141) Genomic DNA from B. infantis ATCC 15697, B. infantis SC142 and B. longum DJO10A was amplified with the cloning primers indicated in Table 3, targeting GH18 or GH85 sequences. Signal peptides and transmembrane domains were omitted in this amplification to facilitate protein expression in, and purification from, E. coli. PCR reactions contained 0.5 M of each primer, 1 ng DNA, 0.2 mM dNTPs (Fermentas, Glen Burnie, Md.), and 2 U of Phusion DNA Polymerase (Finnzymes, Vantaa, Finland) in a 150 l final volume. PCR was performed in a PTC200 Thermo Cycler, using the following program: initial denaturation at 98 C. for 2 min, 35 cycles of denaturation at 98 C. 30 s, annealing at 58 C. for 90 s, extension at 72 C. 2 min, and a final extension at 72 C. for 7 min. PCR products were gel-purified (Qiaquick Gel Extraction Kit, Qiagen). Induction was performed with 0.5 mM IPTG at 28 C. (EndoBI-1, EndoBI-2 and EndoBI-lmut), or with 1 mM IPTG at 37 C. (EndoBB). Proteins were concentrated using Amicon Ultra 30 kDa 4 ml columns, and buffer was exchanged for saline sodium citrate 1 using Bio-Gel P-30 in SSC Buffer columns.
(142) Glycoprotein Digestion by Bifidobacterial Endoglycosidases.
(143) Optimal reaction conditions for endoglycosidases EndoBI-1, EndoBI-2 and EndoBB were determined by incubation with RNAseB. Reactions were performed in a 10 l volume and included 4 g of RNAse B, 1 g of each enzyme and 4 l of 0.2 M Na.sub.2HPO.sub.4 with pH values between 5.0 and 7.0 at 37 C. Reactions were run for 1 h, stopped with 1 M Na.sub.2CO.sub.3, treated with the denaturing buffer as above and loaded into 4-15% precast polyacrylamide SDS gels. Optimum temperature reaction was determined at each respective optimum pH, and reactions were performed at 4, 30, 37, 45, 55 and 65 C. for 1 h. Heat resistance was evaluated by incubating each glycosidase at 95 C. for 1, 5 and 30 min, and enzyme reactions were then carried out under optimal conditions. Digestions of human and bovine lactoferrin (Sigma) were performed under optimal conditions using 4 g of each glycoprotein and incubated for 18 h with 1 g of each endoglycosidase, or 1 l of glycerol-free peptide:N-glycosidase F (PNGaseF 500 U/l; New England Biolabs, Ipswich, Mass.). Finally 20 l of a fresh breast milk sample in 20 mM Na.sub.2HPO.sub.4 pH 5.0 were incubated for 18 h with 10 g of EndoBI-1, 10 g of EndoBI-1 mut or 1 l of PNGaseF under optimal conditions. Lactoferrin and human milk digestions were evaluated in 7.5% precast SDS-PAGE gels under denaturing conditions. All experiments were performed at least in duplicates.
(144) Mass Spectrometry
(145) Site Directed Mutagenesis.
(146) A plasmid containing Blon_2468 (with signal sequence and transmembrane domains deleted) was resynthesized with mutagenic primers AmpR and 2468mutF (Table S2) using the Change-IT multiple mutation site directed mutagenesis kit (USB Corporation, Santa Clara Calif.) and following manufacturer instructions. Mutated plasmids were cloned into Top10 competent cells (Invitrogen), and after verifying the proper mutation were transformed into BL21 competent cells. EndoBI-lmut was purified as described in the previous section, with induction carried on with 0.5 mM IPTG at 28 C. for 6 h.
(147) Glycan Array Analysis.
(148) Purified EndoBI-1 D184N (100 g/ml, 200 l), was analyzed for glycan binding by the Consortium for Functional Glycomics using the Mammalian Printed Array v5.0. Protocols are available at the website of functionalglycomics.org. Detection was performed using an Anti-His-FITC antibody (Invitrogen).
(149) B. infantis Gene Expression.
(150) B. infantis cells were grown on ZMB-1 media with 2% lactose as describe above. Six ml of an exponential culture (OD.sub.405 0.8-1) were centrifuged for 1 min at 12000 g, and immediately resuspended in 5 ml of prewarmed ZMB-1 supplemented with either human lactoferrin or bovine lactoferrin (5 mg/ml). Cultures were rapidly returned to anaerobic conditions, and 1 ml of each culture was taken anaerobically every hour. One ml of the original culture grown on lactose (t=0), and hourly time points of incubations with bLF or hLF (t=1-3 h), were centrifuged at 12000 g for 1 min, and the pellet was resuspended in 1 ml of RNAlater (Ambion, Austin, Tex.). The experiment was done in duplicate. Cell suspensions were stored overnight at 4 C. and then at 80 C. until use. RNA extraction, quality check and cDNA conversion were performed as in Garrido et al. (2011) PLoS One e17315. Relative quantification for genes listed in Table 3 was performed in a 7500 Fast Real-Time PCR System (Applied Biosystems, Foster City, Calif.) and using the Fast Sybr Green Master Mix (Applied Biosystems). Reaction conditions were as recommended by manufacturer using 0.5 M of each primer. Primers for qPCR were designed using the NCBI primer design tool, checking for specificity along the B. infantis ATCC 15697 genome (Table 3).
(151) Fluorescence Assays.
(152) Binding of EndoBI-1 and EndoBI-1 D184N to glycoproteins was determined after overnight coating in microtiter 96 well plates of 20 moles of RNAseB, bLF, hLF or BSA in PBS buffer at room temperature. The experiment was performed in triplicate. Wells were washed with PBS three times, and blocked after incubation with BSA 3% at RT for 1 h. Ten moles of EndoBI-1, EndoBI-1 D184N and BSA were added to the wells and incubated for 2 h at 37 C. in PBS buffer adjusted to pH 5.0. Wells were washed three times with PBS-Tween 20 0.05%, and incubated for 1 h with a 1:500 dilution of FITC-Anti-His(C-term) antibody (Invitrogen). After 4 washes with PBS-Tween, fluorescence was monitored in a Synergy2 Microplate reader (Biotek), at 485/530 nm emission/excitation. In another set of experiments, fresh milk samples incubated overnight with EndoBI-1, EndoBI-1 D184N or PNGaseF as described above were coated overnight in a microtiter 96-well plate. After washing three times with PBS buffer, wells were incubated with a 1:500 dilution of 5 mg/ml of fluorescein labeled Concavalin A (Vector labs, Burlingame Calif.) for 1 h at 37 C. Wells were washed four times with PBS-Tween 20 0.05%, and fluorescence was read as described above. Experiment was repeated twice.
(153) TABLE-US-00004 TABLE1 AlignmentofextracellulardomainsubsequencesforGH18enzymes(SEQIDNOs:7-20) B.infantisATCC15697 150 TESEATEADYDAYAKQVIDKYMISVGLDGLDIDMEAHPNDADVKISDNVI (EndoBI-1) 199 B.infantisATCC15702 150 TESEATEADYDAYAKQVIDKYMISVGLDGLDIDMEAHPNDADVKISDNVI 199 B.infantisATCC17930 150 TESEATEADYDAYAKQVIDKYMISVGLDGLDIDMEAHPNDADVKISDNVI 199 B.infantisJCM11346 150 TESEATEADYDAYAKQVIDKYMISVGLDGLDIDMEAHPNDADVKISDNVI 199 B.infantisJCM7007 150 TESEATEADYDAYAKQVIDKYMISVGLDGLDIDMEAHPNDADVKISDNVI 199 B.infantisJCM7009 150 TESEATEADYDAYAKQVIDKYMISVGLDGLDIDMEAHPNDADVKISDNVI 199 B.infantisJCM7011 150 TESEATEADYDAYAKQVIDKYMISVGLDGLDIDMEAHPNDADVKISDNVI 199 B.infantis157F 120 NVDSATESDYDAYADHVIETYMTSVGLDGLDIDMETFPDAAQVAISDQVI 169 B.infantisSC142 120 NVDSATESDYDAYADHVIETYMTSVGLDGLDIDMETFPDAAQVAISDQVI (EndoBI-2) 169 B.infantisSC143 120 NVDSATESDYDAYADHVIETYMTSVGLDGLDIDMETFPDAAQVAISDQVI 169 B.longumSC116 120 NVDSATESDYDAYADHVIETYMTSVGLDGLDIDMETFPDAAQVAISDQVI 169 B.longumSC630 120 NVDSATESDYDAYADHVIETYMTSVGLDGLDIDMETFPDAAQVAISDQVI 169 B.longumSC706 120 NVDSATESDYDAYADHVIETYMTSVGLDGLDIDMETFPDAAQVAISDQVI 169 EndoE 152 AGTTPTEAEFDAYAKELLTKFVDDLGIDGLDIDMETRPSEKDIVLSNGVI 201
(154) TABLE-US-00005 TABLE2 AlignmentofextracellulardomainsubsequencesforGH85enzymes(SEQIDNOs:21-31) B.breveSC95 150 SDGSFPVADKLIEVATTYGFDGWFINQETEGENETSLGADYATKMQAFIAYLKK 199 B.breveJCM1273 150 SDGSFPVADKLIEVATTYGFDGWFINQETEGENETSLGADYATKMQAFIAYLKK 199 B.breveJCM7019 150 SDGSFPVADKLIEVATTYGFDGWFINQETEGENETSLGADYATKMQAFIAYLKK 199 B.breveJCM7020 150 SDGSFPVADKLIEVATTYGFDGWFINQETEGENETSLGADYATKMQAFIAYLKK 199 B.breveKA179 150 SDGSFPVADKLIEVATTYGFDGWFINQETEGENETSLGADYATKMQAFIAYLKK 199 B.breveSC139 150 SDGSFPVADKLIEVATTYGFDGWFINQETEGENETSLGADYATKMQAFIAYLKK 199 B.breveSC506 150 SDGSFPVADKLIEVATTYGFDGWFINQETEGENETSLGADYATKMQAFIAYLKK 199 B.breveSC568 120 SDGSFPVADKLIEVATTYGFDGWFINQETEGENETSLGADYATKMQAFIAYLKK 169 B.longumDJ010A 120 SDGSFPVADKLIEVATTYGFDGWFINQETEGENETSLGADYATKMQAFIAYLKK (EndoBB) 169 B.breveUCC2003 120 SDGSFPVADKLIEVATTYGFDGWFINQETEGENETSLGADYATKMQAFIAYLKK 169 EndoD 287 ADGSFPIARKLVDMAKYYGYDGYFINQETTGDLVKPLGE----KMRQFMLYSKE 336
(155) TABLE-US-00006 TABLE3 Primers Primername Primersequence(5-3) a)Degenerateprimers(SEQIDNOs:32-35) GH85degF TAYTGGCARTAYGTNGAY GH85degr CCAYTTYTCRTCRTCYTC GH18degF CTNGAYATHGAYATGGAR GH18degR NGANCCRTAYTGYTGRTA b)DNAwalking(SEQIDNOs:36-41) TSP142-5F1 CAACCGAGGTCATGTACGTT TSP142-5F2 CGTAATCGCTCTTGAGCTTGTC TSP142-5F3 ACTGGGAACGTAGCTGAACA TSP142-5R1 AACGTACATGACCTCGGTTG TSP142-5R2 CACGATGTTCCTTTACGACACC TSP142-5R3 GACACCAATGGCAGCTACACTG c)Cloningofbifidobacterialendoglycosidases (SEQIDNOs:42-47) 2468F11 CACCATGAATGCGGACGCCGTTTCTCCGAC 2468R11 GCCGGTCGCACTCAGTTGCTTCGG 142cF CACCATGGTTGCGAACGCCCAGGAGGGGGA 142cR CGCCGCGTTTCTGGCCGTGGTCA GH85cF CACCATGACCAAGTACACGATCACACCGGAG GH85cR GGTACGTGGCGCAGACGGCGCGATCCTC d)Sitedirectedmutagenesis(SEQIDNO:48) 2468mutP (PO4)-GATATCGACATGCAGGCGCACCCGAAT e)qPCR(SEQIDNOs:49-72) Blon0393qF TTCACCGAGGCGTACAACA Blon0393qR CGCATCCGTGACCACATAG Blon2468qF ACAGAGCCACCCCTGCGATG Blon2468qR GCCGGTTCCGACGCCAGATT Blon2470qF CACGATGCTGGTGAGTGC Blon2470qR CCGGAACCGGTAAGATCC Blon2471qF ACAACCGTTTCAGCAAGACC Blon2471qR GAGCAGACGGTTGAAGAAGG Blon2472qF ATGATCGCCGTCACGATATT Blon2472qR GAACATCAGCAGGGAGAAGC Blon0177qF TCCGGTCGGCATTCACGCAC Blon0177qR GGCAACGGTCTCGGCGTTGT Blon0178qF TGGTCTGCGCACGCTGAAGG Blon0178qR GGCACCTCGGCCATCACACC Blon0881qF GGCCACGTCGGCTTCAACGA Blon0881qR GAACGCCAGCAGCACGAGGT Blon0882qF TCGTTTCCCGCGTGACCACG Blon0882qR CCACGTAGCCGGGGGTCAGA Blon0883qF ATCGAAGCCGTGTGGATT Blon0883qR CCTCGTTGTAGGCGTCGTA Blon0868qF ACAGCTCGCGGTGGAGTCCT Blon0868qR TCCAGCGGCTTGCCTTTCGG Blon0869qF GCAGCAGCGTGTCAAACCGC Blon0869qR GCCGGGAACGCGGAAAGGTT Blon2335qF CCTGTTCAACCAGGATGAGTC Blon2335qR CCGTCCACGACGAAGTAG Blon2336qF ATCACGCTCACCCTCCC Blon2336qR ACATCGTCGAAGCGGAGT Blon2177qF GGTTCCTGAGGTCTTCACCA Blon2177qR GCCGAGCTTCTCAAATTCA Blon2344qF TCAAGAAGCTCGACCCGTTG Blon2344qR TTGGCGTAGAAGCCGTATGT Blon2347qF AAGCCGATAGGTTCTCCCT Blon2347qR TCGCCTTGGTGTACTTGTCT
(156) TABLE-US-00007 TABLE 4 Bacterial strains Additional strain GH gene Endoglyco- Code Identification information Source present.sup. sidase acitivity.sup. ATCC15697 B. longum subsp. JCM1222; Intestine of GH18a Yes infantis DSM20088 infant ATCC25962 B. longum subsp. JCM1210; Intestine of No infantis DSM20223 infant ATCC17930 B. longum subsp. JCM1260; Infant feces GH18a Yes infantis DSM20218 ATCC15702 B. longum subsp. JCM1272; Intestine of GH18a Yes infantis DSM20090 infant JCM7007 B. longum subsp. LMG18901 Infant feces GH18a Yes infantis JCM7009 B. longum subsp. LMG18902 Infant feces GH18a No infantis JCM7011 B. longum subsp. Infant feces GH18a No infantis JCM11346 B. longum subsp. Isolates Infant feces GH18a No infantis 157F B. longum subsp. Infant feces GH18b ND infantis SC30 B. longum subsp. Isolates Infant feces ND infantis SC97 B. longum subsp. Isolates Infant feces ND infantis SC117 B. longum subsp. Isolates Infant feces ND infantis SC142 B. longum subsp. Isolates Infant feces GH18b Yes infantis SC143 B. longum subsp. Isolates Infant feces GH18b Yes infantis SC145 B. longum subsp. Isolates Infant feces ND infantis SC268 B. longum subsp. Isolates Infant feces ND infantis SC417 B. longum subsp. Isolates Infant feces ND infantis SC523 B. longum subsp. Isolates Infant feces ND infantis SC569 B. longum subsp. Isolates Infant feces ND infantis SC600 B. longum subsp. Isolates Infant feces ND infantis SC605 B. longum subsp. Isolates Infant feces ND infantis SC638 B. longum subsp. Isolates Infant feces ND infantis SC638 B. longum subsp. Isolates Infant feces ND infantis DJO10A B. longum subsp. Isolates Infant feces GH85 Yes longum SC91 B. longum subsp. Isolates Infant feces No longum SC116 B. longum subsp. Isolates Infant feces GH18b Yes longum SC156 B. longum subsp. Isolates Infant feces No longum SC215 B. longum subsp. Isolates Infant feces ND longum SC249 B. longum subsp. Isolates Infant feces ND longum SC280 B. longum subsp. Isolates Infant feces ND longum SC513 B. longum subsp. Isolates Infant feces ND longum SC536 B. longum subsp. Isolates Infant feces ND longum SC558 B. longum subsp. Isolates Infant feces No longum SC592 B. longum subsp. Isolates Infant feces ND longum SC596 B. longum subsp. Isolates Infant feces ND longum SC618 B. longum subsp. Isolates Infant feces No longum SC630 B. longum subsp. Isolates Infant feces GH18b Yes longum SC633 B. longum subsp. Isolates Infant feces ND longum SC657 B. longum subsp. Isolates Infant feces ND longum SC662 B. longum subsp. Isolates Infant feces ND longum SC700 B. longum subsp. Isolates Infant feces ND longum SC706 B. longum subsp. Isolates Infant feces GH18b Yes longum UCC2003 B. breve Isolates Infant nursing GH85 ND stool ATCC15698 B. breve JCM1273; Intestine of GH85 Yes DSM20091 infant ATCC15700 B. breve JCM1192; Intestine of No DSM20213 infant ATCC15701 B. breve JCM7016 Intestine of No infant JCM7017 B. breve Human feces No JCM7019 B. breve Infant feces GH85 Yes JCM7020 B. breve Infant feces GH85 Yes S-17c B. breve Roy et al. 1996 (Int. Infant feces No J. Food Microbiol., 29, 11-29 S-46 B. breve Roy et al. 1996 (Int. Infant feces No J. Food Microbiol., 29, 11-29 SC81 B. breve Isolates Infant feces No SC95 B. breve Isolates Infant feces GH85 Yes SC139 B. breve Isolates Infant feces GH85 Yes SC154 B. breve Isolates Infant feces No SC500 B. breve Isolates Infant feces ND SC506 B. breve Isolates Infant feces GH85 Yes SC522 B. breve Isolates Infant feces No SC559 B. breve Isolates Infant feces Yes SC567 B. breve Isolates Infant feces No SC568 B. breve Isolates Infant feces GH85 Yes SC573 B. breve Isolates Infant feces No SC580 B. breve Isolates Infant feces No KA179 B. breve Isolates Infant feces GH85 Yes JCM1254 B. bifidum DSM20082 Intestine of adult No ATCC29521 B. bifidum JCM1255; Infant feces No DSM20456 ATCC11863 B. bifidum JCM1209; No DSM20082 JCM7002 B. bifidum Human feces No JCM7003 B. bifidum Human feces No JCM7004 B. bifidum Intestine of No infant ATCC29521 B. bifidum JCM1255 Infant feces No KA75 B. bifidum Starter culture Probioplus No SC112 B. bifidum Isolates Infant feces No SC126 B. bifidum Isolates Infant feces No SC555 B. bifidum Isolates Infant feces No SC572 B. bifidum Isolates Infant feces No SC583 B. bifidum Isolates Infant feces No
(157) TABLE-US-00008 VIII.InformalSequenceListing SEQIDNO:1-ActivesiteforGH18enzymes GLDIDME SEQIDNO:2-ActivesiteforGH85enzymes FINQET SEQIDNO:3-FulllengthEndoBI-1(Blon_2468 fromB.infantisATCC15697) Signalsequencesunderlinedandtransmembrane domainsitalicized MTFIKQMMPRYVASMTAGIVAAAMAATCAFAPVANADAVSPTQETIQSTG RHFMVYYRAWRDVTMKGVNTDLPDDNWISMYDIPYGVDVVNIFSYVPSGQ EEQAQPFYDKLKSDYAPYLHSRGIKLVRGIDYTGVAVNGFRTFMKEQNKT ESEATEADYDAYAKQVIDKYMISVGLDGLDIDMEAHPNDADVKISDNVIR ALSKHIGPKSAKPDTTMFLYDTNGSYLNPFKNVAECFDYVAYQQYGSSSD RTARAAADYQPYIGNEFVPGLTFPEEGDMNNRWYDATEPYEESHFYQVAS YVREHNLGGMFVYALDRDGRNYDEDLRRIVPSNLLWTKTAIAESEGMALD TAKTAANHYLDRMSLRQVIDDNAASADKARDMVGKAANLYETNKAVLGGD YGEGFSNTYDPTLEAGLLGIDISVLQQQIDKSSEIIGADTAESDAKTALR MARDAAIDGLTGKIYTADQVSAWSQALKAALDATVPVPTPDSTDQNGNRD KVTNHKVQGQPKQLSATGISTDIIVAVGVTLAIAGVALSLSRKLS SEQIDNO:4-ExtracellulardomainofEndoBI-1 NADAVSPTQETIQSTGRHFMVYYRAWRDVTMKGVNTDLPDDNWISMYDIP YGVDVVNIFSYVPSGQEEQAQPFYDKLKSDYAPYLHSRGIKLVRGIDYTG VAVNGFRTFMKEQNKTESEATEADYDAYAKQVIDKYMISVGLDGLDIDME AHPNDADVKISDNVIRALSKHIGPKSAKPDTTMFLYDTNGSYLNPFKNVA ECFDYVAYQQYGSSSDRTARAAADYQPYIGNEFVPGLTEPEEGDMNNRWY DATEPYEESHFYQVASYVREHNLGGMFVYALDRDGRNYDEDLRRIVPSNL LWTKTAIAESEGMALDTAKTAANHYLDRMSLRQVIDDNAASADKARDMVG KAANLYETNKAVLGGDYGEGESNTYDPTLEAGLLGIDISVLQQQIDKSSE IIGADTAESDAKTALRMARDAAIDGLTGKIYTADQVSAWSQALKAALDAT VPVPTPDSTDQNGNRDKVTNHKVQGQPKQLSAT SEQIDNO:5-ExtracellulardomainofEndoBI-2 (BLIF_1310fromB.infantisSC142) VANAQEGDSPVAASQEGNGNKHFMVYYRAWRDVTMKGVNTDLPDDNWISM YDIPYGIDVVNVFSYVPSGQEAAAQPFYDKLKSDYAPYLHARGVKLVRGL DYSGVMVDGFKTWIAQQGKNVDSATESDYDAYADHVIETYMTSVGLDGLD IDMETFPDAAQVAISDQVITALAKRIGPKSDNPEGTMFLYDTNGSYTAPF KNVSDCFDYVAYQQYGSDSNRTAKAAATYEQFIDSTKFVPGLTFPEEGDM NNRWNDATEPYLDSHFYDVASYSYDHNLGGMFVYALDRDGRTYSDDDLAH IKPSNLIWTKTAIAQSQGMSLENAKQAANHFLDRMSYTKDVPAETRQTVA AATNLYEVNKAVLGADWNDGYSNTYDPTLELSLASIDTTALTGAIAKADA LLADGATDTDVRTTLTTARNAA SEQIDNO:6-ExtracellulardomainofEndoBB (BLD_0197fromB.longumDJO10A) CSGGTSATKYTITPENENEELVLGNRPEASYWFPEDLLKWNADKDPNLAY NVSTVPLAKRVDKADLKPVNDTQNTDTKVMAISIMNSSTSGNAPHGLNTA NANTFSYWQYVDELVYWGGSSGEGIIVPPSPDVTDMGHTNGVPVLGTVFF PQNVSGGKVEWLDQTLAQKSDGSFPVADKLIEVATTYGFDGWFINQETEG ENETSLGADYATKMQAFIAYLKKQAPDLRVVYYDSMTKDGSIDWQNALTD ENSMYMTDGDHPIADEMFLNFWWTEDKLAGDDLLAASATKAKELGIDPYS LYAGIDVQADGYDTPVKWNLFAGKDGKTHTSLGLYCPSWAYWSAGNPTTF RKNESRLWVNDEGNPSVSTPYEDDEKWTGVSNYVAEQSAVTSLPFVTNFN NGSGYSFFREGKQISKMDWNNRSVSDIQPTYRWIVADEGGNKTKADYSDA DAWYGGSSLKFSGKVAKDGKTMVKLYSASVKTGAKPTLSIAAKANVDTDL KAVLTFADGSVETVNGKKKVGNDWGVIDYDIAKLSNKTLTGIDFTYQSSE DKTGYELLLGNITLKDGSEETELGKVTEVKVDDSEFDDDALYAGARISWK TDGKAPAYEIYQINEDKSRSFLGVSNVENFYANALTRVGETNNTTFEIVP VDRYGTQGTSAKADMDWPDNSKPKAGATASRTLLNVGDEVTFTSASSKNT AEVAWSLPGSSKEHATGKSVTVTYDKEGVYDVEITAKNKSGEATATLKGQ IVVSADVMDLVLLSQGAQVSADGFTNGNEKPEFAVDGDVKTKWCVTGPAP HELVVDLGAPKTVSQVDISHAQAGGEDASMNTQEYAIEVSEDGTEYTQVA LVKGNTEGATSNAFAPVNARYVKLVVNKPTQGSDTAARIYEMQVRGADGA IL