TARGET DETECTION USING A MONOVALENT ANTIBODY
20200064341 · 2020-02-27
Assignee
Inventors
Cpc classification
C07K2317/569
CHEMISTRY; METALLURGY
G01N33/5306
PHYSICS
International classification
Abstract
The invention relates to methods of detecting a target antigen by optical detection, isotopic detection, or detection by electron microscopy, comprising contacting a first or second antibody with at least one monovalent antibody that specifically binds said first or second antibody, wherein the monovalent antibody has one or more fluorescent label(s), chromophore label(s), isotope label(s), or metal label(s) attached to it. The invention also relates to complexes formed by the methods of the invention, kits for performing the method of the invention, monovalent antibodies useful for conducting the methods of the invention, as well as uses of the monovalent antibody according to the methods of the invention.
Claims
1. A method of detecting a target antigen by optical detection, isotopic detection, or detection by electron microscopy, comprising: contacting a first antibody with a target antigen that said first antibody specifically binds, or with a sample suspected to comprise said target antigen contacting the first antibody with at least one second antibody that specifically binds the first antibody, wherein the second antibody is a monovalent antibody having one or more fluorescent label(s), chromophore label(s), isotope label(s), or metal label(s) attached to it.
2. The method of claim 1, wherein the second monovalent antibody has one or more fluorescent label(s) attached to it.
3. The method of claim 1, wherein the contacting of the at least one second monovalent antibody with the first antibody is conducted prior to contacting the first antibody with the target antigen.
4. The method of claim 1, wherein the contacting of first antibody with a target antigen and the contacting of the at least one second monovalent antibody with the first antibody are conducted in one single step.
5. The method of claim 1, wherein the second monovalent antibody is a single domain antibody.
6. The method of claim 1, wherein the second monovalent antibody is a camelid or shark antibody.
7. The method of claim 1, wherein the second monovalent antibody is a camelid single domain antibody.
8. The method of claim 1, wherein the first antibody is an immunoglobulin from a mammalian or avian species.
9-33. (canceled)
34. A complex comprising a first antibody; and at least one second antibody, wherein the at least one second antibody is bound to the first antibody via the antigen binding site of the second antibody, wherein the second antibody is a monovalent antibody having one or more fluorescent label(s), a chromophore label(s), an isotope label(s), or a metal label(s) attached to it.
35. The complex of claim 34, wherein the third monovalent antibody has one or more fluorescent label(s) attached to it.
36. The complex of claim 34, wherein the second monovalent antibody is a single domain antibody.
37. The complex of claim 34, wherein the second monovalent antibody is a camelid or shark antibody.
38. The complex of claim 34, wherein the second monovalent antibody is a camelid single domain antibody.
39. The complex of claim 34, wherein the second monovalent antibody specifically binds the first antibody.
40. The complex of claim 34, wherein the first antibody is bound to an antigen via an antigen binding site of the first antibody.
41-61. (canceled)
62. A method of detecting a target antigen by optical detection, isotopic detection, or detection by electron microscopy, comprising: contacting a first antibody with a target antigen that said first antibody specifically binds, or with a sample suspected to comprise said target antigen contacting a first antibody with a second antibody that specifically binds the first antibody; contacting at least one third antibody that specifically binds the second antibody with the second antibody, wherein the third antibody is a monovalent antibody having one or more fluorescent label(s), chromophore label(s), isotope label(s), or metal label(s) attached to it.
63. The method of claim 62, wherein the third monovalent antibody has one or more fluorescent label(s) attached to it.
64. The method of claim 62, wherein the contacting of at least one third monovalent antibody with the second antibody is conducted prior to the contacting of first antibody with a second antibody.
65. The method of claim 62, wherein the contacting of first antibody with a second antibody and the contacting of the at least one third monovalent antibody with the second antibody is conducted in one single step.
66. The method of claim 62, wherein the third monovalent antibody is a single domain antibody.
67-172. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
DETAILED DESCRIPTION OF THE INVENTION
[0034] The inventors of the present application have found that conventional methods of detecting a target antigen using a primary antibody that binds to the target antigen and a second antibody to which a detectable label is attached, suffers from several drawbacks.
[0035] In conventional methods, the secondary antibody is typically a divalent antibody, which tends to aggregate the primary antibody and thus the target. This aggregation problem is a major artifact generator for many immunofluorescence (IF) applications, especially if a high level of details and/or resolution is desired. Such artifacts are, for example, problematic when studying the quarternary structure (e.g. the multimeric state) of cellular components (e.g. of a cellular receptor). In this case, artifacts are likely to be introduced if affinity probes are used that induce dimerization or clustering of the receptor under study. This problem becomes even more evident if polyclonal secondary antibodies, which are common in the art, are used, since every primary antibody might be recognized by more than one secondary antibody, thus generating a large mesh of antibodies.
[0036] The inventors of the present application have surprisingly found that detection of target antigens can be substantially improved, if a monovalent antibody is used for detection of the primary antibody. Additionally, using a monovalent antibody as a secondary antibody avoids the clustering effect that is typically generated by conventional secondary antibodies. This is especially advantageous for applications that require high spatial resolution, e.g. for microscopy applications. Using small monovalent antibodies to detect non-labeled primary antibodies is also advantageous over using labeled primary antibodies for detection, because this completely avoids the risk of functionally inactivating the primary antibody during random conjugation to chemical fluorophores.
[0037] The inventors of the present application have further surprisingly found that spatial resolution of the detection method can further improved if a single domain antibody is used as a secondary antibody. In conventional methods, the large size of an antibody package of conventional primary and secondary antibodies, which are typically divalent full-length antibodies, displace the fluorophore from the target molecule between 15-25 nm, which is much higher than the resolution power of microscopes at the time the invention was made, which will result in an estimated error of about 10-20 nm in three-dimensional space. Using a single domain antibody as a secondary antibody may result in accuracy improvements when using high-end microscopes.
[0038] The inventors have further surprisingly found that incubation times for the detection methods can be significantly shortened by using monovalent antibodies. Current protocols, e.g. for immunofluorescence, must apply the primary antibody for a particular time (typically ranging from 0.5 to 24 h) and then wash off the excess of primary antibodies that did not find any target. After washing, the secondary antibody can be incubated for a particular time (typically ranging from 0.5 to 18 h), followed by several washing steps (typically 10 to 30 min each) to make sure no free fluorescently labeled secondary are left in the preparation. The washing steps, however, critically influence the quality of the resulting detection, which may lead to a strong background signal that hampers the detection method.
[0039] A monovalent secondary antibody can however be co-incubated with the primary antibody prior or directly on the sample. Accordingly, incubation time can be reduced to the same time needed for the conventional primary antibody step. There is no need of a further step for incubating the secondary antibody and further washing steps. This feature will hold true for various applications including immunofluorescence microscopy, immunostainings, fluorescent western blots, and cell sorting (FACS). As an illustrative example, Manning & Doe, 2017, Nature Protocols, 12(1):1-14, discloses a method that follows conventional antibody staining protocols. In FIG. 1 of Manning and Doe, it can be seen that the new larval protocol comprises steps of incubating the primary antibody for 3 days, rinsing for 1 day, incubating the secondary antibody for 2 days, and a final rinse for 1-3 days. Following methods of the present invention, where the monovalent secondary antibody is co-incubated with the primary antibody prior to contacting the primary antibody to the target, the incubation step of the second antibody and a second rinsing step can possibly be omitted, which may reduce incubation times of the protocol by about 4 days.
[0040] It needs to be noted that pre-incubating or co-incubating primary antibodies with conventional secondary antibodies is hardly feasible because conventional secondary antibodies will agglutinate the primary antibodies due to the conventional secondary antibodies' divalent and/or polyclonal nature.
[0041] Following the same inventive concept, the inventors of the present application have further found that a labeled monovalent antibody can also be used for improving conventional detection methods using conventional primary and secondary antibodies. Labeling of conventional secondary antibodies with e.g. fluorescent molecules is typically performed by with non-directed chemistry (i.e. random). This results in that the number of label molecules attached to each single secondary antibody is not precisely known. Typically, it follows an average distribution between 0.5 to 3.5 label molecules per secondary antibody. This will vary from distributor-to-distributor and batch-to-batch, which makes detection methods, especially quantitative methods, not always reproducible. An average distribution of 0.5 to 3.5 fluorophores per secondary antibody means that some secondary antibodies have no label (meaning the target of interest will not be detected) and some have up to 5 (which will result in an overestimation of the quantity of the target). This aspect is especially important when detection and/or quantification of a low number of molecules are desired.
[0042] Labeled monovalent antibodies specific for the secondary antibody, in particular single domain antibodies, however, can be used to enhance the signal of the label of the secondary antibody or to stoichiometrically couple label (de novo) to secondary antibodies. As traditional antibodies display two-fold rotational symmetry, typically two monovalent antibodies will bind one secondary antibody, and each monovalent antibody can be specifically labeled with a defined number of labels such as one, two, three, or even more. Therefore at least 2 label molecules, sometimes even four, six or even more, will be added per secondary antibody in a very controlled manner. Single domain antibodies are particularly advantageous for this application, as their small size facilitates their accommodation in the crowded package of primary-secondary antibodies.
[0043] The present invention relates to a method of detecting a target antigen by optical detection, isotopic detection, or detection by electron microscopy. The method comprises: contacting a first antibody with a target antigen that said first antibody specifically binds, or with a sample suspected to comprise said target antigen, contacting the first antibody with at least one second antibody that specifically binds the first antibody, wherein the second antibody is a monovalent antibody having one or more fluorescent label(s) chromophore label(s), isotope label(s), or metal label(s) attached to it. It is understood that the second antibody preferably has a defined number of labels attached to it.
[0044] The term optical, as used herein, preferably refers to visible light but is generally not limited to it. The term may also refer to infrared, ultraviolet and other regions of the electromagnetic spectrum. The term detection as used herein includes both, direct detection of a target (i.e. wherein the target is detected by a signal deriving from a target) and indirect detection of a target (i.e. wherein the target is detected by a signal that does not directly derive from the target, e.g. by a signal that derives from another molecule attached to the target).
[0045] As used herein, isotopic detection relates to the detection of a molecule in which one or more atoms have been replaced (i.e. labeled) with another isotope that commonly has a detectable variation. The isotopic label can be detected by multiple means, such as their mass (e.g. by mass spectrometry, matrix-assisted laser desorption/ionization (MALDI), desorption electrospray ionization (DESI), laser-ablation inductively coupled plasma mass spectrometry (LA-ICP-MS), or secondary-ion mass spectrometry (SIMS), vibrational mode (e.g. by infrared spectroscopy), gyromagnetic ratios (e.g. by nuclear magnetic resonance), or radioactive decay (e.g. an ionization chamber or autoradiographs of gels).
[0046] Electron microscopy relates to a method of detection using an electron microscope. Types of electron microscopes include transmission electron microscope (TEM), scanning electron microscope (SEM), reflection electron microscope (REM), scanning transmission electron microscope (STEM), and Correlative Light and Electron Microscopy (CLEM).
[0047] The term antibody generally refers to a proteinaceous binding molecule with immunoglobulin-like functions. Typical examples of an antibody are immunoglobulins, as well as derivatives or functional fragments thereof which still retain the binding specificity. Techniques for the production of antibodies are well known in the art. The term antibody also includes immunoglobulins (Ig's) of different classes (i.e. IgA, IgG, IgM, IgD, IgE, IgY etc.) and subclasses (such as IgG1, lgG2 etc.), even if recombinantly produced in foreign hosts using techniques known to those skilled in the arts. Illustrative examples of an antibody are full length immunoglobulins, F.sub.ab fragments, F(ab).sub.2, F.sub.v fragments, single-chain F.sub.v fragments (scF.sub.v), diabodies or domain antibodies (Holt L J et al., Trends Biotechnol. 21(11), 2003, 484-490). Domain antibodies may be single domain antibodies, single variable domain antibodies or immunoglobulin single variable domain having only one variable domain, which may be VH or VL, that specifically bind an antigen or epitope independently of other V regions or domains. A particularly preferred single domain antibody is a VHH domain heavy chain only antibody. Such an immunoglobulin single variable domain may not only encompass an isolated antibody single variable domain polypeptide, but also a larger polypeptide that includes or consists of one or more monomers of an antibody single variable domain polypeptide sequence. It is understood that a single domain antibody may comprise a VHH domain and a fusion partner, such as a protein or peptide tag. The definition of the term antibody thus also includes embodiments such as chimeric, single chain and humanized antibodies. The term antibody may also include fragments of antibodies.
[0048] Single domain antibodies are antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of the art, or any future single domain antibodies. Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, goat, rabbit, cattle. According to the invention, a single domain antibody as used herein is preferably derived from a naturally occurring antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 94/04678 for example. For clarity reasons, this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH to distinguish it from the conventional VH of four chain immunoglobulins. Such a VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, dromedary, llama, vicuna, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain. As an illustrative example, it is known that sharks produce heavy chain antibodies naturally devoid of light chains (commonly named IgNAR), which also comprise a VHH domain. In addition, VHHs may be obtained from synthetic libraries. All such VHHs are within the scope of the invention.
[0049] VHHs, according to the present invention, and as known to the skilled addressee are preferably heavy chain variable domains derived from immunoglobulins naturally devoid of light chains such as those derived from Camelidae as described in WO 94/04678 (and referred to hereinafter as VHH domains or nanobodies). VHH molecules are about 10 smaller than IgG molecules. They are single polypeptides and very stable, resisting extreme pH and temperature conditions. Moreover, they are highly resistant to the action of proteases, which is not the case for conventional antibodies. Furthermore, in vitro expression of VHHs or expression in prokaryotic or eukaryotic organisms suited for recombinant protein expression produces high yield, properly folded functional VHHs. It is understood that single domain antibody according to the invention is preferably a VHH.
[0050] An antibody according to the invention may carry one or more domains that have a sequence with at least about 60%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 92%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% sequence identity with a corresponding naturally occurring domain of an immunoglobulin M, an immunoglobulin G, an immunoglobulin A, an immunoglobulin D, an immunoglobulin E, or a immunoglobulin Y. It is noted in this regard, the term about or approximately as used herein means within a deviation of 20%, such as within a deviation of 10% or within 5% of a given value or range.
[0051] Accordingly, the main chain (longer polypeptide chain) of an antibody may include, including consist of, domains with the above sequence identity with a corresponding domain of an immunoglobulin mu heavy chain, of an immunoglobulin gamma heavy chain, of an immunoglobulin alpha heavy chain, of an immunoglobulin delta heavy chain or of an immunoglobulin epsilon heavy chain. Further, an antibody molecule of the invention may include, including consist of, domains with the above sequence identity with a corresponding domain of an immunoglobulin lambda light chain or of an immunoglobulin kappa light chain. The entire heavy chain domains of an antibody molecule may have at least about 60%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 92%, at least about 95%, at least about 97%, at least about 98% or at least about 99% sequence identity with the corresponding regions of an immunoglobulin mu heavy chain, of an immunoglobulin gamma heavy chain (such as gamma 1, gamma 2, gamma 3 or gamma 4 heavy chains), of an immunoglobulin alpha heavy chain (such as alpha 1 or alpha 2 heavy chains), of an immunoglobulin delta heavy chain or of an immunoglobulin epsilon heavy chain. A light chain domains present in an antibody may have at least about 60%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 92%, at least about 95%, at least about 97%, at least about 98% or at least about 99% sequence identity with the corresponding regions of an immunoglobulin lambda light chain (such as lambda 1, lambda 2, lambda 3 or lambda 4 light chains) or of an immunoglobulin kappa light chain.
[0052] Percent (%) sequence identity with respect to amino acid sequences disclosed herein is defined as the percentage of amino acid residues in a candidate sequence that are pair-wise identical with the amino acid residues in a reference sequence, i.e. an antibody molecule of the present disclosure, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publically available computer software such as BLAST, ALIGN, or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximum alignment over the full length of the sequences being compared. The same is true for nucleotide sequences disclosed herein.
[0053] The term variable refers to the portions of the immunoglobulin domains that exhibit variability in their sequence and that are involved in determining the specificity and binding affinity of a particular antibody (i.e., the variable domain(s)). Variability is not evenly distributed throughout the variable domains of antibodies; it is concentrated in sub-domains of each of the heavy and light chain variable regions. These sub-domains are called hypervariable regions, HVR, or HV, or complementarity determining regions (CDRs). The more conserved (i.e., non-hypervariable) portions of the variable domains are called the framework regions (FR). The variable domains of naturally occurring heavy and light chains each include four FR regions, largely adopting a -sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the -sheet structure. The hypervariable regions in each chain are held together in close proximity by the FR and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site (see Kabat et al., see below). Generally, naturally occurring immunoglobulins include six CDRs (see below); three in the VH (H1, H2, H3), and three in the VL (L1, L2, L3). In naturally occurring immunoglobulins, H3 and L3 display the most diversity of the six CDRs, and H3 in particular is believed to play a unique role in conferring fine specificity to immunoglobulins. The constant domains are not directly involved in antigen binding, but exhibit various effector functions, such as, for example, antibody-dependent, cell-mediated cytotoxicity and complement activation.
[0054] The corresponding immunoglobulin mu heavy chain, gamma heavy chain, alpha heavy chain, delta heavy chain, epsilon heavy chain, lambda light chain or kappa light chain may be of any species, such as a mammalian species, including a rodent species, an avian species, an amphibian species, or an invertebrate species. Examples of mammals include, but are not limited to, a rat, a mouse, a rabbit, a guinea pig, a donkey, a sheep, a squirrel, a hamster, a hedgehog, a platypus, an American pika, an armadillo, a dog, a lemur, a goat, a pig, a cattle, an opossum, a horse, a bat, a woodchuck, an orang-utan, a rhesus monkey, a woolly monkey, a macaque, a chimpanzee, a tamarin (saguinus oedipus), a marmoset or a human. Examples of avians include, but are not limited to, a chicken.
[0055] The term immunoglobulin refers to a glycoprotein that may include at least two heavy (H) chains and two light (L) chains linked by disulfide bonds, or an antigen binding portion thereof. Each heavy chain has a heavy chain variable region (abbreviated herein as V.sub.H) and a heavy chain constant region. The heavy chain constant region may include three domains, C.sub.H1, C.sub.H2 and C.sub.H3. Each light chain has a light chain variable region (abbreviated herein as V.sub.L) and a light chain constant region. The light chain constant region includes one domain, C.sub.L. The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). The CDRs contain most of the residues responsible for specific interactions of the antibody with the antigen. Each V.sub.H and V.sub.L has three CDRs and four FRs, arranged from amino-terminus (N-terminus) to carboxy-terminus (C-terminus) in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an epitope of an antigen. The term immunoglobulin may also include two heavy chains without light chains, such as e.g. an antibody devoid of light chains.
[0056] Each light chain of an immunoglobulin includes an N-terminal variable (V) domain (VL) and a constant (C) domain (CL). Each heavy chain includes an N-terminal V domain (VH), three or four C domains (CHs), and a hinge region.
[0057] An immunoglobulin when used herein, may be a tetrameric glycosylated protein composed of two light (L) chains of approximately 25 kDa each and two heavy (H) chains of approximately 50 kDa each. Two types of light chain, termed lambda and kappa, may be found in immunoglobulins. Depending on the amino acid sequence of the constant domain of heavy chains, immunoglobulins can be assigned to five major classes: A, D, E, G, M, and Y, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, lgG2, IgG3, IgG4, IgA1, and IgA2. An IgM immunoglobulin consists of 5 of the basic heterotetramer unit along with an additional polypeptide called a J chain, and contains 10 antigen binding sites, while IgA immunoglobulins contain from 2-5 of the basic 4-chain units which can polymerize to form polyvalent assemblages in combination with the J chain. In the case of IgGs, the 4-chain unit is generally about 150,000 daltons. The term amino acid or amino acid residue refers to an - or -amino carboxylic acid. An immunoglobulin when used herein may also be a dimeric gylcosylated protein composed of two heavy chains such as a camelid heavy chain only IgG (hcIgG) or a shark IgNAR.
[0058] When used in connection with a protein or peptide, the term amino acid or amino acid residue typically refers to an -amino carboxylic acid having its art recognized definition such as an amino acid selected from the group consisting of: L-alanine (Ala or A); L-arginine (Arg or R); L-asparagine (Asn or N); L-aspartic acid (Asp or D); L-cysteine (Cys or C); L-glutamine (Gln or Q); L-glutamic acid (Glu or E); glycine (Gly or G); L-histidine (His or H); L-isoleucine (Ile or I): L-leucine (Leu or L); L-lysine (Lys or K); L-methionine (Met or M); L-phenylalanine (Phe or F); L-proline (Pro or P); L-serine (Ser or S); L-threonine (Thr or T); L-tryptophan (Trp or W); L-tyrosine (Tyr or Y); and L-valine (Val or V), although modified, synthetic, or rare amino acids such as e.g. taurine, ornithine, selenocysteine, homocystine, hydroxyproline, thioproline, iodo-tyrosine, 3-nitro-tyrosine, ornithine, citrulline, canavanine, 5-hydroxytryptophane, carnosine, cyclo leucine, 3,4-dihydroxy phenylalanine, N-acetylcysteine, prolinol, allylglycine or acetidine-2-carboxylic acid may be used as desired. Generally, amino acids can be grouped as having a nonpolar side chain (e.g., Ala, Cys, Ile, Leu, Met, Phe, Pro, Val); a negatively charged side chain (e.g., Asp, Glu); a positively charged sidechain (e.g., Arg, His, Lys); or an uncharged polar side chain (e.g., Asn, Cys, Gln, Gly, His, Met, Phe, Ser, Thr, Trp, and Tyr).
[0059] A target according to the invention is any substance of biological or chemical origin to which an antibody of the invention is capable to detect directly or indirectly. Targets may be, for example, proteins, peptides, nucleic acids, oligonucleic acids, saccharides, polysaccharides, glycoproteins. Examples include, but are not limited to therapeutic targets, diagnostic targets, receptors, receptor ligands, viral coat proteins, immune system proteins, hormones, enzymes, antigens, cell signaling proteins, or a fragment thereof. Targets may be native protein or a fragment thereof, a homologous sequence thereof, a functional portion thereof, or a functional portion of a homologous sequence.
[0060] The term epitope, also known as the antigenic determinant, refers to the portion of an antigen to which an antibody specifically binds, thereby forming a complex. Thus, the term epitope includes any molecule or protein determinant capable of specific binding to an immunoglobulin or T-cell receptor. The binding site(s) (paratope) of an antibody molecule described herein may specifically bind to/interact with conformational or continuous epitopes, which are unique for the target structure. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Epitope determinants may include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain embodiments, may have specific three dimensional structural characteristics, and/or specific charge characteristics. With regard to polypeptide antigens a conformational or discontinuous epitope is characterized by the presence of two or more discrete amino acid residues, separated in the primary sequence, but assembling to a consistent structure on the surface of the molecule when the polypeptide folds into the native protein/antigen (Sela, M., Science (1969) 166, 1365-1374; Laver, W. G., et al. Cell (1990) 61, 553-556). The two or more discrete amino acid residues contributing to the epitope may be present on separate sections of one or more polypeptide chain(s). These residues come together on the surface of the molecule when the polypeptide chain(s) fold(s) into a three-dimensional structure to constitute the epitope. In contrast, a continuous or linear epitope consists of two or more discrete amino acid residues, which are present in a single linear segment of a polypeptide chain. As an illustrative example, a context-dependent CD3 epitope refers to the conformation of said epitope. Such a context-dependent epitope, localized on the epsilon chain of CD3, can only develop its correct conformation if it is embedded within the rest of the epsilon chain and held in the right position by heterodimerization of the epsilon chain with either CD3 gamma or delta chain. In contrast thereto, a context-independent CD3 epitope may be an N-terminal 1-27 amino acid residue polypeptide or a functional fragment thereof of CD3 epsilon. Generally, epitopes can be linear in nature or can be a discontinuous epitope. Thus, as used herein, the term conformational epitope refers to a discontinuous epitope formed by a spatial relationship between amino acids of an antigen other than an unbroken series of amino acids. The term epitope also includes an antigenic determinant of a hapten, which is known as a small molecule that can serve as an antigen by displaying one or more immunologically recognized epitopes upon binding to larger matter such as a larger molecule e.g. a protein.
[0061] An antibody or antibody molecule/fragment is said to specifically bind to an antigen when it recognizes its target antigen within a complex mixture of proteins and/or macromolecules. Typically, the antibody is capable of specifically interacting with and/or binding to its target but does not essentially bind to another epitope or antigen. Antibodies are said to bind to the same epitope if the antibodies cross-compete so that only one antibody can bind to the epitope at a given point of time, i.e. one antibody prevents the binding or modulating effect of the other.
[0062] Typically, binding that is considered specific may also have a high affinity, e.g. when the binding affinity is higher than 10.sup.6 M (in terms of K.sub.D). In particular, the binding affinity may be about 10.sup.8 to 10.sup.11 M (K.sub.D), or of about 10.sup.9 to 10.sup.11 M or even higher. Thus, antibody molecules with an affinity in the picomolar range (with a K.sub.D of 9.910.sup.1 M to 10.sup.12 M) are also encompassed in the present invention. If necessary, nonspecific binding of a binding site can be reduced without substantially affecting specific binding by varying the binding conditions.
[0063] An antigen to which an antibody according to the invention binds may be an antigen that is included in the extracellular matrix or it may a cell surface antigen, or it may be an antigen located inside a cell. An antigen to which an antibody according to the invention binds may also be an immunoglobulin.
[0064] An antibody according to the invention may be an isolated antibody molecule. The term isolated antibody molecule as used herein refers to an antibody molecule that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are matter that would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. In some embodiments the antibody molecule is purified to greater than 95% by weight of antibody as determined by the Lowry method, such as more than 99% by weight. In some embodiments the antibody molecule is purified to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator. In some embodiments the antibody is purified to homogeneity as judged by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain. An isolated antibody molecule may in some embodiments be present within foreign host cells with one or more component(s) of the antibody's natural environment not being present. Typically an isolated antibody is prepared by at least one purification step.
[0065] Unless otherwise indicated CDRs sequences of the disclosure follow the definition by Maass 2007 (Journal of Immunological Methods 324 (2007) 13-25). Other standards for defining CDRs exist as well, such as the definition according to Kabat CDRs, as described in Sequences of Proteins of immunological Interest, US Department of Health and Human Services (1991), eds. Kabat et al. Another standard for characterizing the antigen binding site is to refer to the hypervariable loops as described by Chothia (see, e.g., Chothia, et al. (1992); J. MoI. Biol. 227:799-817; and Tomlinson et al. (1995) EMBO J. 14:4628-4638). Still another standard is the AbM definition used by Oxford Molecular's AbM antibody modelling software. See, generally, e.g., Protein Sequence and Structure Analysis of Antibody Variable Domains. In: Antibody Engineering Lab Manual (Ed.: Duebel, S. and Kontermann, R., Springer-Verlag, Heidelberg). It is understood that embodiments described with respect to the CDR definition of Maass, can alternatively be implemented using similar described relationships such as with respect to Kabat CDRs, Chothia hypervariable loops or to the AbM-defined loops.
[0066] The valence of an antibody is generally an expression of the number of antigen-binding sites for one molecule of any given antibody or the number of antibody-binding sites for any given antigen. Most antibody molecules, and those belonging to the IgG, IgA, IgD and IgE immunoglobulin classes, have two antigen-binding sites per molecule. In general, a monovalent antibody comprises a single antigen binding site. Examples for a monovalent antibody are a single domain antibody, a VHH domain, a single Fab fragment, a Fv fragment, a scFv fragment, or a single VH or VL domain.
[0067] The terms Fab, Fab region, Fab portion or Fab fragment are understood to define a polypeptide that includes a V.sub.H, a C.sub.H1, a V.sub.L, and a C.sub.L immunoglobulin domain. Fab may refer to this region in isolation, or this region in the context of an antibody molecule according to the invention, as well as a full-length immunoglobulin or immunoglobulin fragment. Typically a Fab region contains an entire light chain of an antibody. A Fab region can be taken to define an arm of an immunoglobulin molecule. It contains the epitope-binding portion of that Ig. The Fab region of a naturally occurring immunoglobulin can be obtained as a proteolytic fragment by a partial papain-digestion. A F(ab).sub.2 portion is the proteolytic fragment of a partially pepsin-digested immunoglobulin. A Fab portion is the product resulting from reducing the disulfide bonds of an F(ab).sub.2 portion. As used herein the terms Fab, Fab region, Fab portion or Fab fragment may further include a hinge region that defines the C-terminal end of the antibody arm (cf. above). This hinge region corresponds to the hinge region found C-terminally of the C.sub.H1 domain within a full length immunoglobulin at which the arms of the antibody molecule can be taken to define a Y. The term hinge region is used in the art because an immunoglobulin has some flexibility at this region.
[0068] An Fv or Fv fragment consists of only the V.sub.L and V.sub.H domains of a single arm of an immunoglobulin. Thus an Fv is the minimum antibody fragment which contains a complete antigen-recognition and binding site. A two-chain Fv fragment consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. A single-chain Fv species (scFv) includes a V.sub.H and a V.sub.L domain of an immunoglobulin, with these domains being present in a single polypeptide chain in which they are covalently linked to each other by a flexible peptide linker. Typically, in a scFv fragment the variable domains of the light and heavy chain associate in a dimeric structure analogous to that in a two-chain Fv species. In single chain Fv fragments, it is possible to either have the variable domain of the light chain arranged at the N-terminus of the single polypeptide chain, followed by the linker and the variable domain of the heavy chain arranged at the C-terminus of the polypeptide chain or vice versa, having the variable domain of the heavy chain arranged on the N-terminus and the variable domain of the light chain at the C-terminus with the peptide linker arranged in between. The peptide linker can be any flexible linker known in the art, for example, made from glycine and serine residues. It is also possible to additionally stabilize the domain association between the V.sub.H and the V.sub.L domain by introducing disulfide bonds into conserved framework regions (see Reiter et al. Stabilization of the Fv fragments in recombinant immunotoxins by disulfide bonds engineered into conserved framework regions, Biochemistry 1994, 33, 6551-5459). Such scFv fragments are also known as disulfide-stabilized scFv fragments (ds-scFv).
[0069] The term Fc region or Fc fragment is used herein to define a C-terminal region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions. The Fc part mediates the effector function of antibodies, e.g. the activation of the complement system and of Fc-receptor bearing immune effector cells, such as NK cells. In human IgG molecules, the Fc region is generated by papain cleavage N-terminal to Cys226. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. The C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody molecule, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody molecule. Accordingly, a composition of intact antibodies may include antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue. Suitable native-sequence Fc regions for use in the antibodies of the invention include mammalian, e.g. human or murine, IgG1, IgG2 (IgG2A, IgG2B), IgG3 and IgG4. The Fc region contains two or three constant domains, depending on the class of the antibody. In embodiments where the immunoglobulin is an IgG the Fc region has a C.sub.H2 and a C.sub.H3 domain.
[0070] An antibody according to the invention may be produced using any known and well-established expression system and recombinant cell culturing technology, for example, by expression in bacterial hosts (prokaryotic systems), or eukaryotic systems such as yeasts, fungi, insect cells or mammalian cells. An antibody molecule of the present invention may be produced in transgenic organisms such as a goat or a plant. An antibody may also be produced by chemical synthesis.
[0071] It is also possible to equip one of the chains of an antibody according to the invention with an affinity tag. Affinity tags such as Strep-Tag or Strep-Tag II (Schmidt, T. G. M. et al. (1996) J. Mol. Biol. 255, 753-766), myc-tag, FLAG-tag, His6-tag, HA-tag, MBP-tag, GST-tag, SUMO-tag, and fluorescent tags such as GFP tag (and derivatives), or dsRed (and derivatives) allow easy detection and also simple purification of the recombinant antibody molecule.
[0072] A method of the invention may comprise the use of two antibodies for the detection of a target antigen. The first (primary), preferably unlabeled, antibody specifically binds to the target antigen. The second (secondary) antibody, which preferably carries a detectable label, recognizes the primary antibody and binds to it. Here, one or more secondary antibodies can bind a single primary antibody. According to the invention, two identical monovalent secondary antibodies typically bind to one first antibody. This provides signal amplification by increasing the number of detectable labels per antigen.
[0073] First antibodies with different constant regions may typically be generated by raising the antibody in different species. For example, it is possible to use a first antibody that has been created in one species and recognizes the target antigen, and then employ a secondary antibody that carries the detectable label and recognizes the first antibody, preferably at the constant region. Optionally, it is possible to use one or more further primary antibodies that have been created in one or more further (different) species that recognize one or more further target antigens, and then employ further one or more secondary antibodies that carry one or more further detectable labels that are distinguishable from the first (or further) detectable labels that recognize the antibody constant region of the one or more further first antibodies.
[0074] One or more of the antibodies of the invention may have a detectable label attached to it. There are many types of detectable labels, including a fluorescent label, a chromophore label, an isotope label, or a metal label, with a fluorescent label being preferred. The presence of the target antigen can be detected by detecting the signal of the detectable label. For a fluorescent label, this means detection of emitted light upon excitation of the fluorescent label. Nonexhaustive examples for suitable fluorescent labels are green emitters (Atto488, Alexa488, Cy2, etc), orange emitters (Atto542, alexa555, Cy3, etc), Red-far-Red emitters (Alexa633, Atto 647N, Cy5, etc), infrared emitters (Atto700, LiCor IRDye700, LiCor IRDye800, etc.), ultra-violet absorbing fluorescent dyes (Atto390 or Alexa405). Non-exhausive examples for a suitable chromophore label are alkaline phosphatase or peroxidase exposed to TMB (3,3,5,5 tetramethylbenzidine), DAB (3,3,4,4 diaminobenzidine), and 4CN (4-chloro-1-naphthol). ABTS (2,2-azino-di [3-ethyl-benzthiazoline] sulfonate), OPD (o-phenylenediamine), and to BCIP/NBT (5-bromo-4-chloro-3-indolyl-phosphate/nitroblue tetrazolium). Non-exhaustive examples for isotope labels are 13C, 15N, 19F, 27A1, 11B, 1271 or different Lanthanides isotopes. Non-exhaustive examples for a metal label are Au, Pd, Pb, Pt Ag, Hg and Os.
[0075] According to the methods of the present invention, the steps of contacting the first antibody with the target antigen and contacting the second monovalent antibody with the first antibody can be carried out in any order. Here, contacting the second monovalent antibody with the first antibody in a first step will have several advantages and is thus preferred, since the resulting complex of first antibody and second antibody can be directly applied onto the sample comprising or suspected to comprise the target antigen. The step of contacting first and second antibody can be conducted prior to or at the same time as preparation of the sample comprising or suspected to comprise the target antigen, which means that the time spanning from sample preparation to detection of the target antigen can be significantly reduced. This is possible only because a monovalent second antibody is used, as a divalent or multivalent second antibody would form aggregates with the first antibody. Following this inventive concept, it is also possible to premix one first antibody with one second antibody, which will result in one complex of the one first antibody and the one second antibody, and to premix another first antibody with another second antibody, which will result in another complex of the another first antibody and the another second antibody. The one complex of the one first antibody and the one second antibody may then be mixed with the another complex of the another first antibody and the another second antibody, and the mixture may then be applied on the sample. In cases where the one first antibody and the another first antibody have different specificities and both specific targets are present in the sample, two different targets can be stained and/or labeled in one single step. In such a case, the label of the one second antibody and the another second antibody are preferably distinguishable. It is also possible to add one or more further (preferably premixed) complex(es) of first and second antibody to the mixture of the one first and second antibody complex and the another first and second antibody complex. The resulting mixture preferably comprises all three or more complexes of first and second antibodies and may be applied onto the target. By doing so, three or even more targets can be stained and/or labeled in one step.
[0076] Alternatively, contacting the first antibody with the target antigen and contacting the second monovalent antibody with the first antibody can preferably be carried out in one single step. Here again, the time spanning from sample preparation to detection of the target antigen can be significantly reduced since residual primary and secondary antibodies can be washed off simultaneously, thereby reducing washing steps. This is only possible because a monovalent second antibody is used, as a divalent or multivalent second antibody would again form aggregates with the first antibody.
[0077] The second monovalent antibody may preferably be or comprise a single domain antibody. It may typically be a single-domain antibody from a camelid or a shark, with a camelid single domain antibody being preferred. It is understood single domain antibody from a camelid or a shark or a camelid or shark single domain antibody as used herein typically refers to a VHH fragment of a camelid or shark antibody devoid of light chains. Said VHH fragments are typically obtained by recombinant expression. The second monovalent antibody may be polyclonal or monoclonal with monoclonal being preferred. It is also possible to employ two or more different second monovalent antibodies that specifically recognize the same first antibody but that do not cross-compete with each other. This can be achieved if the two or more second antibodies bind to different epitopes of the first antibody. For example, if two of said second antibodies are used, up to four second antibodies can bind in total to one first antibody. If both said second antibodies are labeled with the same or a similar detectable label, e.g. four, six, eight, or even more detectable labels will be attached to one first antibody (depending on the number of detectable labels attached to each second monovalent antibody), which provides stronger signal amplification as compared to methods, where only one second antibody is employed. It is understood that said two or more second antibodies are preferably monoclonal antibodies.
[0078] The first antibody may be any type of antibody, including an immunoglobulin, such as an immunoglobulin G (IgG), immunoglobulin A (IgA), immunoglobulin D (IgD), immunoglobulin E (IgE), immunoglobulin M (IgM), or immunoglobulin Y (IgY). It may be derived from any species, preferably a mammalian or avian species. Preferred species are e.g. rabbit, goat, donkey, guinea pig, rat, chicken, and mouse, cattle, hamster, sheep, and human. The first antibody can be polyclonal or monoclonal. It is understood that the second monovalent antibody specifically binds to an antibody of the same species as the first antibody, e.g. specifically bind to an antibody selected from the group consisting of rabbit, goat, donkey, guinea pig, rat, chicken, and mouse, cattle, hamster, sheep, and human, depending on the species of the first antibody. It is also possible that the second antibody specifically binds to the class of immunoglobulins of the first antibody, such as e.g. IgG, IgA, IgD, IgE, IgM, or IgY. Although not essential, it is in most cases preferred that the second monovalent antibody is not cross-reactive with an immunoglobulin of at least one second species, such as an immunoglobulin of another species selected from the group consisting of rabbit, goat, donkey, guinea pig, rat, chicken, and mouse, cattle, hamster, sheep, and human.
[0079] An exemplary second monovalent antibody according to the invention is a camelid single domain antibody specific for guinea pig IgG. Such a second monovalent antibody may have a CDR1 sequence of GLTFSEYV (SEQ ID NO: 01), a CDR2 sequence of VAAMNSRT (SEQ ID NO: 02), and a CDR3 sequence of AVGAYGDYAGPSHFHS (SEQ ID NO: 03). As an illustrative example, such a second monovalent antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00001 (SEQIDNO:04) VQLLESGGGLVQAGGSLTLSCEASGLTFSEYVMGWFRQTPGKEREFVAAV AAMNSRTYYTDSVKGRFTISRDNAKNTVFLQMNSLKPEDTAVYYCAVGAY GDYAGPSHFHSWGQGTQVTVS.
[0080] Another exemplary second monovalent antibody according to the invention is a camelid single domain antibody specific for chicken IgY. Such a second monovalent antibody may have a CDR1 sequence of GNISNILS (SEQ ID NO: 05), a CDR2 sequence of ITNDGNT (SEQ ID NO: 06), and a CDR3 sequence of NAARWTQPRPS (SEQ ID NO: 07). As an illustrative example, such a second monovalent antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00002 (SEQIDNO:08) VQLEESGGGLVEPGGSLRLSCAASGNISNILSMGWFRQAPGKRRELVATI TNDGNTEYRDSVKDRFTISRDNAEKTYYLQMDRLKLEDTAVYYCNAARWT QPRPSWGQGTQVTVS.
[0081] Another exemplary second monovalent antibody according to the invention is a camelid single domain antibody specific for mouse and/or rat IgG. Such a second monovalent antibody may have a CDR1 sequence of GRTDSLYA (SEQ ID NO: 09), a CDR2 sequence of ITWIGGAV (SEQ ID NO: 10), and a CDR3 sequence of ASTFRRIWDAEESIFDT (SEQ ID NO: 11). As an illustrative example, such a second monovalent antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00003 (SEQIDNO:12) VQLLESGGGLVQAGDSLRLSCAASGRTDSLYAVGWVRQAPGKDREFVAAI TWIGGAVLYADSVKGRFTISKKFGGNTVYLQMNNLAPEDTAVYSCASTFR RIWDAEESIFDTWGQGTQVTVS.
[0082] Another exemplary second monovalent antibody according to the invention is a camelid single domain antibody specific for human IgM, which may also recognize human IgG with a lower affinity. Such a second monovalent antibody may have a CDR1 sequence of GNSFSISN (SEQ ID NO: 13), a CDR2 sequence of ITSGGVA (SEQ ID NO: 14), and a CDR3 sequence of HCESGFPTLIAY (SEQ ID NO: 15). As an illustrative example, such a second monovalent antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00004 (SEQIDNO:16) VQLLESGGGLVQFGGSLRLSCAASGNSFSISNMGWYHQAPGKERELVAII TSGGVAEYAASVKGRFTISRDYAKNTVYLQMNSLQPEDTAVYYCHCESGF PTLIAYWGQGTQVTVS.
[0083] Further exemplary second monovalent antibodies can be generated by methods known in the art. As an illustrative example, antigen-specific camelid single domain antibodies (sdAbs) can be obtained following established protocols (see e.g. Pleiner et al. Elife. 2015 Dec. 3; 4:e11349. doi: 10.7554/eLife.11349 or Pardon et al. Nat Protoc. 2014 March; 9(3):674-93. doi: 10.1038/nprot.2014.039.). In general, in some exemplary methods, generation of camelid single domain antibodies can be divided in successive phases. In phase I (immunization), as an illustrative example, camelids are immunized 4-6 times with the respective antigen in a suitable adjuvant (e.g. Gerbu Fama or Freunds adjuvants) over a period of several weeks. Phase II (library generation): As an illustrative example, after the last immunization, peripheral blood is withdrawn, from which B-lymphocytes are extracted using established techniques. After RNA extraction and cDNA synthesis, single-domain antibody-encoding regions are selectively amplified by polymerase chain reaction (PCR) and cloned into established vectors suitably for phage display (phagemids). Phase III (screening): As an illustrative example, Escherichia coli with intact F pili are transformed with the resulting phagemid library and infected with suitable m13 helper phage to produce an infective phage library carrying sdAbs on their surface. Phages specifically binding the target protein are selected by iterative cycles of affinity purification, infection of E. coli and phage amplification. It is also possible to include negative selection steps, in which phages that bind to a non-desired second target are excluded. Phase IV (expression): Selected sdAbs are expressed in a suitable host following established protocols (see e.g. Pleiner et al. Elife. 2015 Dec. 3; 4:e11349. doi: 10.7554/eLife.11349).
[0084] The present invention also relates to a method of optically detecting a target antigen comprising: contacting a first antibody with a target antigen that said first antibody specifically binds, or with a sample suspected to comprise said target antigen contacting a first antibody with a second antibody that specifically binds the first antibody; contacting at least one third antibody that specifically binds the second antibody with the second antibody, wherein the third antibody is a monovalent antibody having one or more fluorescent label(s), chromophore label(s), an isotope label(s), or a metal label(s) attached to it, with fluorescent label(s) being preferred. It is understood that the third antibody preferably has a defined number of labels attached to it.
[0085] A method of the invention may thus also comprise the use of three antibodies for the detection of a target antigen. A first (primary), preferably unlabeled, antibody specifically binds to the target antigen. A second (secondary), preferably non-monovalent, antibody, which preferably carries a detectable label, recognizes the primary antibody and binds to it. The third antibody is a monovalent antibody that binds to the second, preferably non-monovalent, antibody but preferably does not bind to the first antibody. The third antibody, which may also be referred to as the booster antibody, preferably carries a detectable label. Here, one or more booster antibodies can bind a single secondary antibody. It is also possible to use two or more different booster antibodies for binding a single secondary antibody. According to the invention, two identical third antibodies typically bind to one second antibody, respectively. The first, second and third antibodies are preferably generated by raising the antibodies in different species. For example, the first antibody that recognizes the target antigen has been created in a one species, and secondary antibody that recognize the first antibody, has been created in a second species. The third antibody may optionally be generated in a third species or may be recombinant or synthetic and recognizes the second antibody but preferably does not recognize the first antibody.
[0086] The method may further comprise contacting the first antibody with a fourth antibody that specifically binds the first antibody, wherein the fourth antibody is a monovalent antibody having one or more fluorescent label(s), chromophore label(s), isotope label(s), or metal label(s) attached to it. The detectable label of the fourth monovalent antibody and the third monovalent antibody may be the same or different. If the detectable labels are different, they may be similar or non-similar. The detectable labels of both the third monovalent antibody and the fourth monovalent antibody may preferably be fluorescent labels.
[0087] The detectable label of the second, preferably non-monovalent, antibody and the third (booster) antibody may be any type of detectable label disclosed herein, including a fluorescent label, a chromophore label, an isotope label, or a metal label, with fluorescent labels being preferred. The detectable labels of the second, preferably non-monovalent, antibody and the third (booster) antibody may be different from each other. However, it is preferred that the detectable labels are the same or similar. For example, the labels of the second, preferably non-monovalent, antibody and the third (booster) antibody may be the same chromophore label or the same fluorescent label. A similar label, as used herein refers to a label that has a similar absorption spectrum, or a similar maximum absorption and emission wavelength. In case of a fluorescent label, two similar labels may also have a similar emission spectrum or maximum emission wavelength. An illustrative example for two labels that are similar are Atto647N (ATTO-TEC, Germany), which has an absorption maximum at 646 nm and an emission maximum at 664 nm, and Cy5 dye, which has an absorption maximum at 649 nm an emission maximum at 670 nm. Ideally, adsorption maximum and/or emission maximum of two similar labels should differ in not more than about 20 nm, preferably not more than about 15 nm, preferably not more than about 10 nm, preferably not more than about 7 nm, preferably not more than about 5 nm.
[0088] The presence of the target antigen can be detected by detecting the signal of the detectable label. For a fluorescent label, this means detection of emitted light upon excitation of the fluorescent label. Examples for suitable fluorescent labels are disclosed herein.
[0089] According to the methods of the present invention, the steps of contacting the second, preferably non-monovalent, antibody with the first antibody and contacting the third monovalent antibody with the second, preferably non-monovalent, antibody can be carried out in any order. Here, contacting the third monovalent antibody with the second, preferably non-monovalent, antibody in a first step will have several advantages and is thus preferred, since the resulting complex of second, preferably non-monovalent, antibody and third monovalent antibody can then be directly applied onto a sample comprising or suspected to comprise the target antigen that ideally comprises a first antibody bound to the target antigen. The step of contacting second and third antibody can be conducted prior to or at the same time as preparation of the sample comprising or suspected to comprise the target antigen and comprising a first antibody bound to the target antigen, which means that the time spanning from sample preparation to detection of the target antigen can be significantly reduced compared to methods, in which the second antibody is contacted with a sample comprising the first antibody bound to the target antigen prior to contacting the second antibody with the third antibody. The step of contacting the first antibody with a target antigen that the first antibody specifically binds, or with a sample suspected to comprise said target antigen should however be conducted prior to contacting the first antibody with the second, preferably non-monovalent, antibody that specifically binds the first antibody.
[0090] Alternatively, contacting the second, preferably non-monovalent, antibody with the first antibody that is bound to the target antigen and contacting the third monovalent antibody with the second antibody can preferably be carried out in one single step. Here again, compared to methods, in which the second antibody is contacted with a sample comprising the first antibody bound to the target antigen prior to contacting the second antibody with the third antibody, the time spanning from sample preparation to detection of the target antigen can be significantly reduced since residual second and third antibodies can be washed off simultaneously, thereby reducing washing steps. Again, the step of contacting the first antibody with a target antigen that the first antibody specifically binds, or with a sample suspected to comprise said target antigen should be conducted prior to contacting the first antibody with the second, preferably non-monovalent, antibody that specifically binds the first antibody.
[0091] The third monovalent antibody may preferably be or comprise a single domain antibody. It may typically be an antibody from a camelid or a shark, with a camelid single domain antibody being preferred. The third monovalent antibody may be polyclonal or monoclonal with monoclonal being preferred. It is also possible to employ two or more different third antibodies that specifically recognize the same second, preferably non-monovalent, antibody but that do not cross-compete with each other. This can be achieved if the two or more third antibodies bind to different epitopes of the second, preferably non-monovalent, antibody. For example, if two of said third antibodies are used, up to four molecules of the two third antibodies can bind to one second, preferably non-monomeric, antibody. If both said third antibodies are labeled with the one or more of the same or a similar detectable label, four, six, eight, or even more (additional) detectable labels will be attached to one second, preferably non-monovalent, antibody, which provides stronger signal amplification as compared to methods, where only one third monovalent antibody is employed. It is understood that said two or more third monovalent antibodies are preferably monoclonal antibodies.
[0092] The first antibody may be any type of antibody, including an immunoglobulin, such as an immunoglobulin G (IgG), immunoglobulin A (IgA), immunoglobulin D (IgD), immunoglobulin E (IgE), immunoglobulin M (IgM), or immunoglobulin Y (IgY). It may be derived from any species, preferably a mammalian or avian species. Preferred species are e.g. rabbit, goat, donkey, guinea pig, rat, chicken, and mouse, cattle, hamster, sheep, and human. The first antibody can be polyclonal or monoclonal, with monoclonal being preferred. It is understood that the second, preferably non-monovalent, antibody specifically binds to an antibody of the same species as the first antibody, e.g. specifically bind to an antibody selected from the group consisting of rabbit, goat, donkey, guinea pig, rat, chicken, and mouse, cattle, hamster, sheep, and human, depending on the species of the first antibody. It is also possible that the second antibody specifically binds to the class of immunoglobulins of the first antibody, such as e.g. IgG, IgA, IgD, IgE, IgM, or IgY. Although not essential, it is also preferred that the second, preferably non-monovalent, antibody is not cross-reactive with an immunoglobulin of at least one second species, such as an immunoglobulin of another species selected from the group consisting of rabbit, goat, donkey, guinea pig, rat, chicken, and mouse, cattle, hamster, sheep, and human.
[0093] The second antibody may also be any type of antibody, including an immunoglobulin, such as an immunoglobulin G (IgG), immunoglobulin A (IgA), immunoglobulin D (IgD), immunoglobulin E (IgE), immunoglobulin M (IgM), or immunoglobulin Y (IgY). It may be derived from any species, preferably a mammalian or avian species. Preferred species are e.g. rabbit, goat, donkey, guinea pig, rat, chicken, and mouse, cattle, hamster, sheep, and human, depending on the species of the first antibody. However, it is envisioned by the present invention that the second, preferably non-monovalent, antibody is preferably derived from a species different than the species of the first antibody. The second antibody can be polyclonal or monoclonal. It is understood that the third monovalent antibody specifically binds to an antibody of the same species as the second antibody is derived from, e.g. specifically bind to an antibody selected from the group consisting of rabbit, goat, donkey, guinea pig, rat, chicken, and mouse, cattle, hamster, sheep, and human, depending on the species of the second antibody, but preferably does not bind to the an antibody of the species that the first antibody is derived from. It is also possible that the second antibody specifically binds to the class of immunoglobulins of the second, preferably non-monovalent, antibody, such as e.g. IgG, IgA, IgD, IgE, IgM, or IgY. Although not essential, it is also preferred that the third monovalent is not cross-reactive with an immunoglobulin of at least one second species, such as an immunoglobulin of another species selected from the group consisting of rabbit, goat, donkey, guinea pig, rat, chicken, and mouse, cattle, hamster, sheep, and human.
[0094] As an illustrative example, the first antibody may be a rabbit IgG, the second, preferably non-monovalent, antibody may be a goat IgG that specifically binds rabbit IgG, and the third monovalent antibody may be a camelid single domain antibody that specifically binds goat IgG. A second typical situation can be first antibody may be a mouse IgG, the second, preferably non-monovalent, antibody may be a donkey IgG that specifically binds mouse IgG, and the third monovalent antibody may be a camelid single domain antibody that specifically binds donkey IgG. More generally, the first antibody may be selected from the group consisting of a rabbit antibody, a mouse antibody, a guinea pig antibody, a hamster antibody, a goat antibody, and chicken antibody, the second antibody may specifically bind the first antibody and may be selected from the group consisting of a goat antibody, a sheep antibody, a donkey antibody, and a rabbit antibody, and the third monovalent antibody may be a camelid single domain antibody that specifically binds the second antibody
[0095] An exemplary third monovalent antibody according to the invention is a camelid single domain antibody specific for guinea pig IgG. Such a third monovalent antibody may have a CDR1 sequence of GLTFSEYV (SEQ ID NO: 01), a CDR2 sequence of VAAMNSRT (SEQ ID NO: 02), and a CDR3 sequence of AVGAYGDYAGPSHFHS (SEQ ID NO: 03). As an illustrative example, such a third monovalent antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00005 (SEQIDNO:04) VQLLESGGGLVQAGGSLTLSCEASGLTFSEYVMGWFRQTPGKEREFVAAV AAMNSRTYYTDSVKGRFTISRDNAKNTVFLQMNSLKPEDTAVYYCAVGAY GDYAGPSHFHSWGQGTQVTVS.
[0096] Another exemplary third monovalent antibody according to the invention is a camelid single domain antibody specific for chicken IgY. Such a third monovalent antibody may have a CDR1 sequence of GNISNILS (SEQ ID NO: 05), a CDR2 sequence of ITNDGNT (SEQ ID NO: 06), and a CDR3 sequence of NAARWTQPRPS (SEQ ID NO: 07). As an illustrative example, such a third monovalent antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00006 (SEQIDNO:08) VQLEESGGGLVEPGGSLRLSCAASGNISNILSMGWFRQAPGKRRELVATI TNDGNTEYRDSVKDRFTISRDNAEKTYYLQMDRLKLEDTAVYYCNAARWT QPRPSWGQGTQVTVS.
[0097] Another exemplary third monovalent antibody according to the invention is a camelid single domain antibody specific for mouse and/or rat IgG. Such a third monovalent antibody may have a CDR1 sequence of GRTDSLYA (SEQ ID NO: 09), a CDR2 sequence of ITWIGGAV (SEQ ID NO: 10), and a CDR3 sequence of ASTFRRIWDAEESIFDT (SEQ ID NO: 11). As an illustrative example, such a third monovalent antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00007 (SEQIDNO:12) VQLLESGGGLVQAGDSLRLSCAASGRTDSLYAVGWVRQAPGKDREFVAAI TWIGGAVLYADSVKGRFTISKKFGGNTVYLQMNNLAPEDTAVYSCASTFR RIWDAEESIFDTWGQGTQVTVS.
[0098] Another exemplary third monovalent antibody according to the invention is a camelid single domain antibody specific for human IgM. Such a third monovalent antibody may have a CDR1 sequence of GNSFSISN (SEQ ID NO: 13), a CDR2 sequence of ITSGGVA (SEQ ID NO: 14), and a CDR3 sequence of HCESGFPTLIAY (SEQ ID NO: 15). As an illustrative example, such a third monovalent antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00008 (SEQIDNO:16) VQLLESGGGLVQFGGSLRLSCAASGNSFSISNMGWYHQAPGKERELVAII TSGGVAEYAASVKGRFTISRDYAKNTVYLQMNSLQPEDTAVYYCHCESGF PTLIAYWGQGTQVTVS.
[0099] The present invention also relates to the use of such a third (monovalent) antibody as defined herein for enhancing an detectable signal of a fluorescent label or chromophore label of a second (preferably non-monovalent) antibody as defined herein that is bound or capable of binding to a first antibody as defined herein. It is understood that the third (monovalent) antibody is preferably a camelid single domain antibody having one or more fluorescent label(s), chromophore label(s), isotope label(s), or metal label(s) attached to it, with fluorescent label(s) being preferred.
[0100] The present invention also relates to the use of a monovalent antibody having one or more fluorescent label(s), chromophore label(s), isotope label(s), or metal label(s) attached to it in the methods of the invention. It is understood that the monovalent antibody can be any monovalent antibody according to the methods of the invention.
[0101] The present invention also relates to the use of a monovalent antibody having one or more fluorescent label(s), chromophore label(s), isotope label(s), or metal label(s) attached to it as a secondary antibody for detecting a target antigen by optical detection, isotopic detection, or detection by electron microscopy. The monovalent antibody can be any monovalent antibody according to the invention, where the monovalent antibody is used as a secondary antibody. It is understood that the use of the monovalent antibody can be according to any method of the invention that encompasses the use of the monovalent antibody as a secondary antibody.
[0102] The methods of the present invention may be used for detecting a target antigen in a sample, which may be a biological or a non-biological sample. The non-biological sample may be of chemical origin. Such a sample may comprise a protein or DNA molecule, which may be immobilized, e.g. on on a glass surface or a similar surface. The sample may preferably be a biological sample. As used herein, biological sample may refer to any sample comprising a biological material. It may comprise a compound, cellular or sub-cellular component, which is associated with biological functions. Preferred biological samples are tissue samples, such as a biopsy or a tissue section, a blood sample, a PBMC sample, or a sample comprising a cultured cell. The biological sample may a living sample, such as e.g. a living cell, or a fixed sample, such as e.g. a fixed tissue slice or a fixed cell. Accordingly, the target antigen can be comprised and/or detected in any biological sample according to the invention. The target antigen may therefore be detected in a living cell, a fixed cell, or a fixed tissue sample etc., or in a sample comprising such a living cell, a fixed cell, or a fixed tissue sample.
[0103] The methods of the present invention are particularly advantageous, since they can be used for detection of a target antigen in a sub-cellular resolution. A sub-cellular resolution as used herein generally refers to a spatial resolution of the detection method that allows distinguishing between at least two molecules that are localized on or within the same, preferably mammalian, cell. A sub-cellular resolution preferably refers to a resolution that allows for distinguishing two points in space that are separated by a distance of about 20 m, preferably of about 10 m, preferably of about 5 m, preferably of about 2 m, preferably of about 1 m, preferably of about 0.5 m, preferably of about 0.2 m, preferably of about 0.1 m, preferably of about 0.05 m, preferably of about 0.02 m, preferably of about 0.01 m.
[0104] The methods of the present invention can generally be any method that comprises the detection of a target antigen by optical detection, isotopic detection, or detection by electron microscopy. Accordingly, the methods of the invention may preferably be a microscopy method, such as a fluorescent microscopy method, such as a immuno fluorescence method. The methods of the invention may also preferably be a flow cytometry or a fluorescence-activated cell sorting (FACS) method. The methods of the invention may also preferably be a Western Blot, Southern Blot or Northern Blot method. The methods of the invention may also be an immunohistochemistry method. Where the method of the invention encompasses contacting a third monovalent antibody with a second antibody, the methods of the invention may also be an ELISA method.
[0105] The present invention also relates to a complex that can be used or formed according to the methods of the invention.
[0106] Accordingly, the present invention also relates to a complex comprising a first antibody and at least one second antibody, wherein the at least one second antibody is bound to the first antibody via the antigen binding site of the second antibody, wherein the second antibody is a monovalent antibody having one or more fluorescent label(s), chromophore label(s), isotope label(s), or metal label(s) attached to it. It is understood that the first antibody and the second (monovalent) antibody can be any first and second (monovalent) antibodies according to the methods of the invention.
[0107] The present invention also relates to a complex comprising a second (preferably non-monovalent) antibody, wherein the second antibody capable of binding a first antibody via an antigen binding site of the second antibody; and at least one third antibody, wherein the at least one third antibody is bound to the second antibody via the antigen binding site of the third antibody, wherein the third antibody is a monovalent antibody having one or more fluorescent label(s), chromophore label(s), isotope label(s), or metal label(s) attached to it. The complex may further comprise the first antibody, wherein the second antibody is bound to the first antibody via an antigen binding site of the second antibody. It is understood that the first antibody, the second (preferably non-monovalent) antibody, and the third (monovalent) antibody can be any first, second (preferably non-monovalent), and third (monovalent) antibodies according to the methods of the invention.
[0108] The present invention also relates to kits that comprise components for conducting the method of the invention and/or forming the complexes of the invention
[0109] Accordingly, the present invention also relates to a kit comprising a first antibody; and at least one second antibody, wherein the at least one second antibody is capable of specifically binding to the first antibody via the antigen binding site of the second antibody, wherein the second antibody is a monovalent antibody having one or more fluorescent label(s), chromophore label(s), isotope label(s), or metal label(s) attached to it. It is understood that the first antibody and the second (monovalent) antibody can be any first and second (monovalent) antibodies according to the methods of the invention. In the kit, the second monovalent antibody can already be bound to the first antibody via the antigen binding site of the second antibody, such that the complex of first and (monovalent) second antibody can be directly contacted with a target antigen or the sample comprising said target antigen. In such a case, it is envisioned that two second (monovalent) antibodies are preferably bound to one first antibody. The kit may also comprise two or more different second monovalent antibodies that recognize different epitopes of the first antibody. Generally, it is envisioned that the kit comprises the second monovalent antibody and the first antibody in a molar ratio of about 1:1 to about 10:1, such as about 1.2:1 to about 8:1, preferably about 1.5:1 to about 5:1, preferably about 1.7:1 to about 3:1. It is understood that the molar ratios given herein preferably applies to each second monovalent antibody comprised in the kit.
[0110] The present invention also relates to a kit comprising a second (preferably non-monovalent) antibody, wherein the second (preferably non-monovalent) antibody is capable of specifically binding to a first antibody via an antigen binding site of the second antibody; and a third antibody, wherein the third antibody is capable of binding to the second antibody via the antigen binding site of the third antibody, wherein the third antibody is a monovalent antibody having one or more fluorescent label(s), chromophore label(s), isotope label(s), or metal label(s) attached to it. The kit may also comprise a first antibody. It is understood that the first antibody, the second (preferably non-monovalent) antibody, and the third (monovalent) antibody can be any first, second (preferably non-monovalent), and third (monovalent) antibodies according to the methods of the invention. In the kit, the third monovalent antibody can already be bound to the second (preferably non-monovalent) antibody via the antigen binding site of the third antibody, such that the complex of first and (monovalent) second antibody can be directly contacted with a first antibody that is bound to a target antigen or the sample comprising said first antibody bound to the target antigen. In such a case, it is envisioned that two third (monovalent) antibodies are preferably bound to one second (preferably non-monovalent) antibody. The kit may also comprise two or more different third monovalent antibodies that recognize different epitopes of the second antibody, or that recognize one or more epitopes on the second antibody and one or more epitopes on the first antibody. Generally, it is envisioned that the kit comprises the third monovalent antibody and the second and/or first (non-monovalent) antibody in a molar ratio of about 1:1 to about 10:1, such as about 1.2:1 to about 8:1, preferably about 1.5:1 to about 5:1, preferably about 1.7:1 to about 3:1. It is understood that the molar ratios given herein preferably applies to each pair of third monovalent antibody and first and/or second antibody comprised in the kit.
[0111] The present invention also relates to a camelid single domain antibody that is useful for conducting the methods of the invention. The present invention thus also relates to a camelid single domain antibody that specifically binds guinea pig IgG and that is not cross-reactive to mouse IgG, rat IgG, chicken IgY, rabbit IgG, human IgG, human IgM, goat IgG, donkey IgG, pig IgG, horse IgG, or cattle IgG. Such a camelid single domain antibody preferably has a CDR1 sequence of GLTFSEYV (SEQ ID NO: 01), a CDR2 sequence of VAAMNSRT (SEQ ID NO: 02), and a CDR3 sequence of AVGAYGDYAGPSHFHS (SEQ ID NO: 03). As an illustrative example, such a camelid single domain antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00009 (SEQIDNO:04) VQLLESGGGLVQAGGSLTLSCEASGLTFSEYVMGWFRQTPGKEREFVAAV AAMNSRTYYTDSVKGRFTISRDNAKNTVFLQMNSLKPEDTAVYYCAVGAY GDYAGPSHFHSWGQGTQVTVS.
[0112] The present invention thus also relates to a camelid single domain antibody that specifically binds chicken IgY and that is not cross-reactive to guinea pig IgG, mouse IgG, rat IgG, rabbit IgG, human IgG, human IgM, goat IgG, donkey IgG, pig IgG, horse IgG, or cattle IgG. Such a camelid single domain antibody preferably has a CDR1 sequence of GNISNILS (SEQ ID NO: 05), a CDR2 sequence of ITNDGNT (SEQ ID NO: 06), and a CDR3 sequence of NAARWTQPRPS (SEQ ID NO: 07). As an illustrative example, such a camelid single domain antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00010 (SEQIDNO:08) VQLEESGGGLVEPGGSLRLSCAASGNISNILSMGWFRQAPGKRRELVATI TNDGNTEYRDSVKDRFTISRDNAEKTYYLQMDRLKLEDTAVYYCNAARWT QPRPSWGQGTQVTVS.
[0113] The present invention thus also relates to a camelid single domain antibody that specifically binds mouse or rat IgG and that is not cross-reactive to guinea pig IgG, chicken IgY, rabbit IgG, human IgG, human IgM, goat IgG, donkey IgG, pig IgG, horse IgG, or cattle IgG. Such a camelid single domain antibody preferably has a CDR1 sequence of GRTDSLYA (SEQ ID NO: 09), a CDR2 sequence of ITWIGGAV (SEQ ID NO: 10), and a CDR3 sequence of ASTFRRIWDAEESIFDT (SEQ ID NO: 11). As an illustrative example, such a camelid single domain antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00011 (SEQIDNO:12) VQLLESGGGLVQAGDSLRLSCAASGRTDSLYAVGWVRQAPGKDREFVAAI TWIGGAVLYADSVKGRFTISKKFGGNTVYLQMNNLAPEDTAVYSCASTFR RIWDAEESIFDTWGQGTQVTVS.
Further, the present invention relates to a camelid single domain antibody that specifically binds human IgM and that is not cross-reactive to guinea pig IgG, mouse IgG, rat IgG, chicken IgY, rabbit IgG, goat IgG, donkey IgG, pig IgG, horse IgG, or cattle IgG. Such a camelid single domain antibody preferably has a CDR1 sequence of GNSFSISN (SEQ ID NO: 13), a CDR2 sequence of ITSGGVA (SEQ ID NO: 14), and a CDR3 sequence of HCESGFPTLIAY (SEQ ID NO: 15). As an illustrative example, such a camelid single domain antibody may comprise or consist of a VHH domain that has the amino acid sequence of
TABLE-US-00012 (SEQIDNO:16) VQLLESGGGLVQFGGSLRLSCAASGNSFSISNMGWYHQAPGKERELVAII TSGGVAEYAASVKGRFTISRDYAKNTVYLQMNSLQPEDTAVYYCHCESGF PTLIAYWGQGTQVTVS.
The camelid single domain antibody that specifically binds human IgM may preferably be not cross-reactive to human IgG. Further, the present invention relates to a camelid single domain antibody that specifically binds rabbit IgG and that is not cross-reactive to guinea pig IgG, mouse IgG, rat IgG, chicken IgY, human IgG, human IgM, goat IgG, donkey IgG, pig IgG, horse IgG, or cattle IgG. Further, the present invention relates to a camelid single domain antibody that specifically binds goat IgG and that is not cross-reactive to guinea pig IgG, mouse IgG, rat IgG, human IgG, human IgM, chicken IgY, rabbit IgG, donkey IgG, pig IgG, horse IgG, or cattle IgG. Further, the present invention relates to a camelid single domain antibody that specifically binds rat IgG and that is not cross-reactive to guinea pig IgG, mouse IgG, chicken IgY, rabbit IgG, human IgG, human IgM, goat IgG, donkey IgG, pig IgG, horse IgG, or cattle IgG. Further, the present invention relates to a camelid single domain antibody that specifically binds mouse IgG and that is not cross-reactive to guinea pig IgG, rat IgG, chicken IgY, rabbit IgG, human IgG, human IgM, goat IgG, donkey IgG, pig IgG, horse IgG, or cattle IgG. Further, the present invention relates to a camelid single domain antibody that specifically binds human IgG and that is not cross-reactive to guinea pig IgG, mouse IgG, rat IgG, chicken IgY, rabbit IgG, human IgM, goat IgG, donkey IgG, pig IgG, horse IgG, or cattle IgG. Further, the present invention relates to a camelid single domain antibody that specifically binds donkey IgG and that is not cross-reactive to guinea pig IgG, mouse IgG, rat IgG, chicken IgY, rabbit IgG, human IgG, human IgM, goat IgG, pig IgG, horse IgG, or cattle IgG. Further, the present invention relates to a camelid single domain antibody that specifically binds sheep IgG and that is not cross-reactive to guinea pig IgG, mouse IgG, rat IgG, chicken IgY, rabbit IgG, human IgG, human IgM, goat IgG, donkey IgG, pig IgG, horse IgG, or cattle IgG. It is understood that the camelid single domain antibodies of the invention are preferably conjugated to a fluorescent label.
[0114] The present invention further relates to the use of a monovalent antibody having a fluorescent label or chromophore label attached to it for detection of a molecule on the surface of a cell, wherein the use comprises contacting the monovalent antibody with the cell and detecting the fluorescent label or chromophore label. The molecule on the surface on a cell can by any molecule, such as a protein, peptide or saccharide. The molecule may be a cell surface protein or receptor. Preferably, the molecule on the surface of a cell is an immunoglobulin or a B cell receptor, preferably IgA, IgG, IgM, IgD, IgE, or IgY, preferably IgM. The cell can be any cell, preferably a mammalian or avian cell, preferably a B cell. The B cell may be a human, guinea pig, mouse, rat, chicken, rabbit, goat, donkey, pig, horse, or cattle B cell, preferably a human B cell. The fluorescent label or chromophore label can be detected by any method that is suitable for detecting such a label, including for example microscopy, immunofluorescence, flow cytometry, Western Blot, immunohistochemistry, Southern Blot, Northern blot or ELISA. The method is preferably a flow cytometry method.
[0115] The present invention further relates to the use of a second monovalent antibody as defined herein for improving spatial resolution and/or accuracy of a microscopy method for detecting a target antigen. The method comprises contacting a first antibody as defined herein with the target antigen and contacting the monovalent antibody with the first antibody. The improved spatial resolution and/or accuracy, which may be expressed as estimated error due to special displacement of the fluorophore, is preferably about 10 nm to about 20 nm.
[0116] The invention illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms comprising, including, containing, etc. shall be read expansively and without limitation. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by exemplary embodiments and optional features, modification and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention.
[0117] The term about or approximately as used herein means within a deviation of 20%, such as within a deviation of 10% or within 5% of a given value or range.
[0118] The invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
[0119] Other embodiments are within the following claims. In addition, where features or aspects of the invention are described in terms of Markush groups, those skilled in the art will recognize that the invention is also thereby described in terms of any individual member or subgroup of members of the Markush group.
[0120] The content of all documents including scientific documents and patent documents cited herein is incorporated by reference in their entirety.
EXAMPLES
[0121] Expression of sdAbs in Escherichia coli
[0122] DNA sequences encoding the respective sdAb were cloned into appropriate prokaryotic expression vectors in frame with N-terminal or N- and C-terminal elements encoded by the respective vector. Typically, elements N-terminally preceding the sdAb encoding region contain a PolyHis-tag C-terminal tags may be common epitope or affinity tags, fluorescent proteins, or a combination thereof. If fluorescent labeling via maleimide chemistry is desired, ectopic cysteines may be introduced at appropriate positions (Described in detail in Pleiner et al. eLife 2015; 4:e11349. DOI: 10.7554/eLife.11349). In a preferred embodiment, the expression vector contains a Tac promoter (T5 promoter fused to a Lac operator sequence) controlling the expression of the sdAb fusion and carries a Kanamycin resistance cassette as well as a Lac repressor element.
[0123] Appropriate Escherichia coli expression strains carrying such prokaryotic expression vectors were typically shaken over night at 30 C. in 10 ml of terrific broth (TB medium) containing appropriate antibiotics. Cultures were diluted with 50 ml fresh medium and further cultivated at 30 C. for 4-6 hours. Cultures were further diluted to 400 ml final volume with fresh medium containing 0.3 mM IPTG and shaken over night at 25 C. Cells were harvested by centrifugation, resuspended in lysis buffer (300 mM NaCl, 50 mM Tris-HCl pH 7.5, 5 mM EDTA, 2 mM DTT) and lysed by sonication. SdAb fusions were purified from the soluble lysates obtained after removal of cell debris by centrifugation by Ni.sup.2+-chelate chromatography.
[0124] For attachment of fluorescent labels to accessible cysteines, the proteins were treated with 10 mM TCEP for 30 min and the buffer was exchanged to 10 mM Potassium phosphate pH 6.0, 200 mM NaCl by gel filtration. The protein-containing fractions were neutralized 1/10 volume 1 M Tris-HCl pH 8.5 and incubated with a 1.5-2-fold molar excess (relative to the number of accessible cysteines on the protein surface) of the respective maleimide-activated fluorophore for 90 min. Excess of non-reacted label was removed using appropriate chromatographic separation techniques (e.g. ion exchange chromatography, hydrophobic chromatography or size exclusion chromatography).
[0125] Cell Culture
[0126] Human Burkitt's lymphoma cells (RAMOS) were cultured using RPMI medium supplemented with 10% fetal calf serum (PAA laboratories GmbH), 4 mM glutamine and 100 U/ml of each penicillin and streptomycin (Sigma-Aldrich). Naturally occurring mutants lacking the B-cell receptor IgM (IgM()) were previously selected after several rounds of cell sorting (FACS).
[0127] CV-1 cells derived from African green monkey's kidney (known as COS-7 cells) and the mouse fibroblast 3T3 were grown on high glucose (4.5 g/L) Dulbecco's modified Eagle's medium (Thermo-Fischer Scientific) supplemented with 10% fetal calf serum (PAA laboratories GmbH), 4 mM glutamine and 100 U/ml of each penicillin and streptomycin (Sigma-Aldrich). Cells were seeded on poly-L-lysin coated coverslips the day before the transfection. Transfection of foreign plasmid encoding for rat Syntaxin1a fused to EGFP into COS-7 cells was performed using Lipofectamin 2000 and following the instruction of the manufacturer (Thermo-Fischer Scientific).
[0128] Hippocampal primary cultures: Brains of newborn rats were removed and placed in cold HBSS (Thermo-Fischer Scientific). Hippocampi were detached from cortex and incubated 1 h in an enzyme solution (DMEM (Thermo-Fischer Scientific), 2 mg cysteine, 100 mM CaCl2, 50 mM ethylenediaminetetraacetic acid (EDTA), 25 units papain per mL of solution, with CO2 bubbling, at 37 C.). The enzymatic solution was removed and replaced for 5 minutes with an inactivating solution (in DMEM supplemented with 5% fetal calf serum, 25 mg albumin and 25 mg trypsin inhibitor). Hippocampi were triturated using a Pasteur pipette in Neurobasal A medium (Thermo-Fischer Scientific) supplemented with 20% B27 (Thermo-Fischer Scientific) and 10% Glutamax-I (Thermo-Fischer Scientific), 20 units/ml of penicillin and 20 g/ml streptomycin (Roche-Diagnostics)]. Neurons were plated on 18 mm coverslips with a grown layer of rat brain astrocytes (for further details please refer to Rosenmund C, Stevens CF (1997) J Neurosci Methods).
[0129] Immunofluorescences
[0130] Conventional immunostaining of primary hippocampal neurons (
[0131] For
[0132] Live immunostainings of wild type (WT) and IgM() RAMOS cells were performed on 20010.sup.6 cells incubated for 30 minutes on ice with DPBS and 50 nM of anti-IgM sdAb coupled to Atto647N. After 310 minutes washing steps with DPBS, cells were mounted in Mowiol and imaged.
[0133] Microscopy
[0134] Cells were imaged with an inverted epifluorescence microscope (Eclipse Ti-E; Nikon) equipped with an HBO-100W light source and a IXON X3897 Andor Technology camera. A CFI S Plan Fluor ELWD (Extra Long Working Distance; air) 20, 0.45 NA objective (Nikon) was used for
[0135] Cell-Cytometry
[0136] Two hundred million (200106) RAMOS cells were harvested and spun down for 60 s at 300 rpm in a tabletop centrifuge. After removing all culture medium by two washing step with cold DPBS, cells were incubated in DPBS with 1% bovine serum albumin and 5 nM of Atto647N-labeled sdAbs anti human IgM for 30 minutes on ice and dark conditions. Followed by 3 washing steps in DPBS to remove excess of unbound sdAbs. Cells were finally resuspended in cold DPBS and passed through a FACSAria II (BD Biosciences). Gated cells were further analyzed by their fluorescence intensity.
[0137] Dot Blots
[0138] To assay binding of sdAb to guinea pig, rabbit, mouse, rat, goat, bovine and human IgGs as well as chicken IgYs, the respective immunoglobins were affinity purified from serum using Protein A/G affinity columns or PEG precipitation using established protocols (Polson et al. 1980 Immunol Commun. 1980; 9(5):475-93.), respectively. 0.5 g of affinity purified IgGs were spotted onto a nitrocellulose membrane (Amersham). All further incubation steps were carried out at room temperature with shaking at 60 rpm. Dried membranes were blocked with WB buffer (5% milk powder in Tris-buffered saline containing 0.05% Tween-20) for 30 min and washed three times for 3 min each using the same buffer. SdAbs recombinantly expressed in Escherichia coli as fusions harboring a 3 FLAG tag C-terminal of the respective sdAb SdAb were diluted to 5 nM in WB buffer and incubated with the membranes for 60 min. The membranes were washed as before and incubated with a mouse-anti-FLAG-HRP (horseradish peroxidase) antibody (Sigma-Aldrich, clone M2) for 60 min. After washing as before, the membranes were imaged using fluorescence reader (Fujifilm LAS-4000 Mini) and the Perkin Elmer ECL-Plus kit.
Example 1: sdAbs are Able to Recognize Specific Immunoglobulins
[0139]
Example 2: Species-Specific Binding of sdAbs
[0140] Native immunoglobulins (IgGs if not stated differently) from various species were spotted on a nitrocellulose membrane (0.5 g), followed by the incubation with an sdAb bearing a 3FLAG-tag and a GFP derivative on it C-terminus (SEQ ID NO: 19) (
Example 3: Testing an Anti-Human IgM sdAb
[0141]
Example 4: Enhancing the Signal of a Fluorescently Labeled Immunoglobulin
[0142]
Example 5: sdAbs Allow the Pre-Mixing of Reagent and Shorten Significantly the Time of Stainings
[0143]
Example 6: Immunofluorescence with Primary Antibody Premixed with Secondary Conventional or Monovalent Antibodies
[0144]
Example 7: Multiplexing Immunofluorescence with Several Primary Mouse Monoclonal Antibodies, Each Premixed with Fluorescently-Labeled Secondary Monovalent Antibodies
[0145] Multiplexing by was performed by premixing in separate tubes different mouse monoclonal antibodies (mAb) with monovalent antibodies coupled to different fluorophores for 1 hour. All pre-mixtures are pooled together and use for immunostaining the sample for 1 hour. After 3 washing steps sample can be mounted and its fluorescence measured (e.g. in microscopy, FACS, westernblots, etc). A schematic representation of the method is shown in
[0146] Here, we show a fluorescence microscopy example of multiplexing 3 mouse monoclonal primary antibodies. After pre-mixing in separate tubes i) a primary anti tubulin antibody (Cat. No. 302-211 from SySy GmbH) with a sdAb anti-mouse IgG coupled to Atto488, ii) a primary beta-Actin (Cat. No. 251-011 from SySy GmbH) with a sdAb anti-mouse IgG coupled to Atto542, and iii) an anti-zyxin (Cat. No. 307-011 from SySy GmbH) with a sdAb-coupled to AbberiorStar635P and incubation for 1 h, the mixtures were simultaneously applied to the same sample, resulting in the expected specific staining pattern for each primary antibody used. This type of multiplexing was achieved by pre-mixing primary and secondary antibodies, which is only possible if monovalent secondary antibodies are used, as essentially demonstrated in