Methods of reducing TDP-43-mediated neuronal cytotoxicity in amyotrophic lateral sclerosis by a UPF1 polypeptide or polynucleotide

10533038 ยท 2020-01-14

Assignee

Inventors

Cpc classification

International classification

Abstract

Nonsense-mediated mRNA decay (NMD) polypeptides, nucleic acids encoding NMD polypeptides, and methods of using such polypeptides and nucleic acids in the treatment of ALS and in screening for agents for the treatment of ALS are described.

Claims

1. A method of reducing TDP-43-mediated neuronal cytotoxicity in a human subject suffering from amyotrophic lateral sclerosis (ALS), wherein the subject does not have a mutation in a SOD1 gene, comprising: administering to the subject suffering from ALS a therapeutically effective amount of a UPF1 polypeptide or a nucleic acid encoding the UPF1 polypeptide, thereby reducing the TDP-43 mediated neuronal cytotoxicity in the subject; wherein the UPF1 polypeptide comprises the amino acid sequence of SEQ ID NO:2.

2. The method of claim 1, wherein the step of administering comprises administering to the subject a composition comprising the nucleic acid encoding the UPF1 polypeptide.

3. The method of claim 1, wherein the UPF1 polypeptide or the nucleic acid encoding the UPF1 polypeptide is administered into the CNS of the subject.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The following figures are presented for the purpose of illustration only, and are not intended to be limiting.

(2) FIG. 1A is a graphical representation of cell death of neurons following expression of UPF1. FIG. 1B is a graphical representation of cell death of neurons following expression of TDP-43 and UPF1.

(3) All publications, patent applications, patents, and other references mentioned herein, including GenBank database sequences, are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below.

(4) Other features and advantages of the invention will be apparent from the following detailed description, and from the claims.

DEFINITIONS

(5) In order for the present invention to be more readily understood, certain terms are first defined below. Additional definitions for the following terms and other terms are set forth throughout the specification.

(6) Approximately or about: As used herein, the term approximately or about, as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term approximately or about refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).

(7) Amelioration: As used herein, the term amelioration means the prevention, reduction or palliation of a state, or improvement of the state of a subject. Amelioration includes, but does not require, complete recovery or complete prevention of a disease condition.

(8) Characteristic portion: As used herein, the term a characteristic portion of a substance, in the broadest sense, is one that shares some degree of sequence or structural identity with respect to the whole substance. In certain embodiments, a characteristic portion shares at least one functional characteristic with the intact substance. For example, in some embodiments, a characteristic portion of a polypeptide or protein is one that contains a continuous stretch of amino acids, or a collection of continuous stretches of amino acids, that together are characteristic of a polypeptide or protein. In some embodiments, each such continuous stretch generally contains at least 2, 5, 10, 15, 20, 50, or more amino acids. In some embodiments, such a continuous stretch includes certain residues whose position and identity are fixed; certain residues whose identity tolerates some variability (i.e., one of a few specified residues is accepted); and optionally certain residues whose identity is variable (i.e., any residue is accepted). In general, a characteristic portion of a substance (e.g., of a polypeptide or protein) is one that, in addition to the sequence and/or structural identity specified above, shares at least one functional characteristic with the relevant intact substance. In some embodiments, a characteristic portion may be biologically active.

(9) Characteristic sequence: A characteristic sequence is a sequence that is found in all members of a family of polypeptides or nucleic acids, and therefore can be used by those of ordinary skill in the art to define members of the family.

(10) Combination therapy: The term combination therapy, as used herein, refers to those situations in which two or more different pharmaceutical agents are administered in overlapping regimens so that the subject is simultaneously exposed to both agents. When used in combination therapy, two or more different agents may be administered simultaneously or separately. This administration in combination can include simultaneous administration of the two or more agents in the same dosage form, simultaneous administration in separate dosage forms, and separate administration. That is, two or more agents can be formulated together in the same dosage form and administered simultaneously. Alternatively, two or more agents can be simultaneously administered, wherein the agents are present in separate formulations. In another alternative, a first agent can be administered just followed by one or more additional agents. In the separate administration protocol, two or more agents may be administered a few minutes apart, or a few hours apart, or a few days apart.

(11) Comparable: The term comparable, as used herein, refers to a system, set of conditions, effects, or results that is/are sufficiently similar to a test system, set of conditions, effects, or results, to permit scientifically legitimate comparison. Those of ordinary skill in the art will appreciate and understand which systems, sets of conditions, effects, or results are sufficiently similar to be comparable to any particular test system, set of conditions, effects, or results as described herein.

(12) Correlates: The term correlates, as used herein, has its ordinary meaning of showing a correlation with. Those of ordinary skill in the art will appreciate that two features, items or values show a correlation with one another if they show a tendency to appear and/or to vary, together. In some embodiments, a correlation is statistically significant when its p-value is less than 0.05; in some embodiments, a correlation is statistically significant when its p-value is less than 0.01. In some embodiments, correlation is assessed by regression analysis. In some embodiments, a correlation is a correlation coefficient.

(13) Homology: As used herein, the term homology refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules. In some embodiments, polymeric molecules are considered to be homologous to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical. In some embodiments, polymeric molecules are considered to be homologous to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar.

(14) Identity: As used herein, the term identity refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two nucleic acid sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes). In certain embodiments, the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or substantially 100% of the length of the reference sequence. The nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two nucleotide sequences can be determined using the algorithm of Meyers and Miller (CABIOS, 1989, 4:11-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM 120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. The percent identity between two nucleotide sequences can, alternatively, be determined using the GAP program in the GCG software package using an NWSgapdna.CMP matrix.

(15) Improve, increase, or reduce: As used herein, the terms improve, increase or reduce, or grammatical equivalents, indicate values that are relative to a reference (e.g., baseline) measurement, such as a measurement taken under comparable conditions (e.g., in the same individual prior to initiation of treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of treatment) described herein.

(16) NMD agent: As used herein, the term NMD agent refers to an NMD polypeptide, a nucleic acid that encodes an NMD polypeptide, or an agent that increases NMD polypeptide level and/or activity. In some embodiments, an NMD agent is a therapeutic agent.

(17) NMD polypeptide: As used herein, the term NMD polypeptide refers to a polypeptide whose amino acid sequence includes at least one characteristic sequence of and/or shows at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71% or 70% identity with a protein involved in nonsense-mediated mRNA decay (e.g., UPF1, UPF2, UPF3, SMG1, SMG5, SMG6, or SMG7). A wide variety of NMD sequences from flies, vertebrates, and mammals are known in the art, such as those described herein; in some embodiments, an NMD polypeptide shares at least one characteristic sequence of and/or shows the specified degree of overall sequence identity with one of the UPF1, UPF2, UPF3, SMG1, SMG5, SMG6, or SMG7 set forth herein (each of which may be considered a reference NMD polypeptide). In some embodiments, an NMD polypeptide as described herein shares at least one biological activity with a reference NMD polypeptide as set forth herein. In some such embodiment, the shared biological activity relates to nonsense-mediated mRNA decay.

(18) Polypeptide: As used herein, a polypeptide, generally speaking, is a string of at least two amino acids attached to one another by a peptide bond. In some embodiments, a polypeptide may include at least 3-5 amino acids, each of which is attached to others by way of at least one peptide bond. Those of ordinary skill in the art will appreciate that polypeptides sometimes include non-natural amino acids or other entities that nonetheless are capable of integrating into a polypeptide chain, optionally.

(19) Protein: As used herein, the term protein refers to a polypeptide (i.e., a string of at least two amino acids linked to one another by peptide bonds). Proteins may include moieties other than amino acids (e.g., may be glycoproteins, proteoglycans, etc.) and/or may be otherwise processed or modified. Those of ordinary skill in the art will appreciate that a protein can be a complete polypeptide chain as produced by a cell (with or without a signal sequence), or can be a characteristic portion thereof. Those of ordinary skill will appreciate that a protein can sometimes include more than one polypeptide chain, for example linked by one or more disulfide bonds or associated by other means. Polypeptides may contain L-amino acids, D-amino acids, or both and may contain any of a variety of amino acid modifications or analogs known in the art. Useful modifications include, e.g., terminal acetylation, amidation, methylation, etc. In some embodiments, proteins may comprise natural amino acids, non-natural amino acids, synthetic amino acids, and combinations thereof. The term peptide is generally used to refer to a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids, less than 20 amino acids, or less than 10 amino acids.

(20) Providing: As used herein, the term providing refers to performing a manipulation that causes an entity of interest to be present at a level and/or with an activity higher than that observed under otherwise comparable conditions prior to or absent the manipulation. In some embodiments, providing consists of or comprises administering the entity itself (alone or as part of a composition); in some embodiment, providing consists of or comprises administering an agent that causes an increase in level and/or activity of the entity of interest. For example, where the entity of interest is or comprises a polypeptide, in some embodiments, providing the polypeptide consists of or comprises administering the polypeptide (e.g., to a cell, whether isolated or in an organism); in some embodiments, providing the polypeptide consists of or comprises administering a nucleic acid encoding the polypeptide; in some embodiments, providing the polypeptide consists of or comprises administering an agent that results in increased expression of an endogenous copy of the polypeptide (e.g., by stimulating one or more of transcription, RNA processing, translation, etc. and/or by inhibiting an inhibitor of one of these).

(21) Reference: A reference entity, system, amount, set of conditions, etc., is one against which a test entity, system, amount, set of conditions, etc. is compared as described herein. For example, in some embodiments, a reference individual is a control individual who is not suffering from or susceptible to any form of ALS disease; in some embodiments, a reference individual is a control individual afflicted with the same form of ALS disease as an individual being treated, and optionally who is about the same age as the individual being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).

(22) Subject: As used herein, the term subject, individual, or patient refers to any organism upon which embodiments of the invention may be used or administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.).

(23) Target cell or target tissue: As used herein, the terms target cell or target tissue refers to any cell, tissue, or organism that is affected by ALS to be treated, or any cell, tissue, or organism in which a protein involved in ALS is expressed. In some embodiments, target cells, target tissues, or target organisms include those cells, tissues, or organisms in which there is a detectable or abnormally high amount of FUS or TDP-43 (e.g., comparable to that observed in patients suffering from or susceptible to ALS). In some embodiments, target cells, target tissues, or target organisms include those cells, tissues, or organisms that display a disease-associated pathology, symptom, or feature.

(24) Therapeutic agent: As used herein, the phrase therapeutic agent refers to any agent that, when administered to a subject, has a therapeutic effect and/or elicits a desired biological and/or pharmacological effect.

(25) Therapeutic regimen: As used herein, the term therapeutic regimen refers to any method used to partially or completely alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of and/or reduce incidence of one or more symptoms or features of a particular disease, disorder, and/or condition. It may include administration of one or more doses, optionally spaced apart by regular or varied time intervals. In some embodiments, a therapeutic regimen is one whose performance is designed to achieve and/or is correlated with achievement of (e.g., across a relevant population of cells, tissues, or organisms) a particular effect, e.g., reduction or elimination of a detrimental condition or disease such as ALS. In some embodiments, treatment includes administration of one or more therapeutic agents either simultaneously, sequentially or at different times, for the same or different amounts of time. In some embodiments, a treatment regimen includes genetic methods such as gene therapy, gene ablation or other methods known to induce or reduce expression (e.g., transcription, processing, and/or translation of a particular gene product, such as a primary transcript or mRNA).

(26) Therapeutically effective amount: As used herein, the term therapeutically effective amount refers to an amount of a therapeutic agent (e.g., an NMD polypeptide) which confers a therapeutic effect on the treated subject, at a reasonable benefit/risk ratio applicable to any medical treatment. Such a therapeutic effect may be objective (i.e., measurable by some test or marker) or subjective (i.e., subject gives an indication of or feels an effect). In some embodiments, therapeutically effective amount refers to an amount of a therapeutic agent or composition effective to treat, ameliorate, or prevent (e.g., delay onset of) a relevant disease or condition, and/or to exhibit a detectable therapeutic or preventative effect, such as by ameliorating symptoms associated with the disease, preventing or delaying onset of the disease, and/or also lessening severity or frequency of symptoms of the disease. A therapeutically effective amount is commonly administered in a dosing regimen that may comprise multiple unit doses. For any particular therapeutic agent, a therapeutically effective amount (and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, or on combination with other therapeutic agents. Alternatively or additionally, a specific therapeutically effective amount (and/or unit dose) for any particular patient may depend upon a variety of factors including the particular form of ALS being treated; the severity of the ALS; the activity of the specific therapeutic agent employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and/or rate of excretion or metabolism of the specific therapeutic agent employed; the duration of the treatment; and like factors as is well known in the medical arts.

(27) Treatment: As used herein, the term treatment (also treat or treating) refers to any administration of a therapeutic agent (e.g., an NMD polypeptide) according to a therapeutic regimen that achieves a desired effect in that it partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of a particular disease, disorder, and/or condition (e.g., ALS); in some embodiments, administration of the therapeutic agent according to the therapeutic regimen is correlated with achievement of the desired effect. Such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition. Alternatively or additionally, such treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition. In some embodiments, treatment may be of a subject who has been diagnosed as suffering from the relevant disease, disorder, and/or condition. In some embodiments, treatment may be of a subject known to have one or more susceptibility factors that are statistically correlated with increased risk of development of the relevant disease, disorder, and/or condition.

DETAILED DESCRIPTION

(28) The present disclosure encompasses the surprising discovery that UPF1 can prevent neuronal toxicity due to TDP-43 or FUS/TLS. UPF1 is a protein involved in nonsense-mediated mRNA decay (NMD). Accordingly, the disclosure provides, among other things, various therapeutic modalities, including use of NMD polypeptides (e.g., UPF1, UPF2, UPF3, SMG1, SMG5, SMG6, or SMG7) to treat amyotrophic lateral sclerosis (ALS).

(29) Amyotrophic Lateral Sclerosis (ALS)

(30) ALS, which exists as both inherited and random forms, is characterized by degeneration of spinal motor neurons, leading to paralysis and death. While most forms of ALS are sporadic and idiopathic (sALS), about 10% of cases are inherited in a Mendelian fashion and are designated familial ALS (fALS). The present invention provides compositions and methods useful in treating ALS.

(31) Using genetic analysis, several genes that cause fALS have been identified. The first mutations were identified in SOD1, which encodes the ubiquitously expressed copper/zinc superoxide dismutase. These variants are involved in about 20% of fALS cases worldwide (Rosen et al., Nature 362:59-62 (1993)). Other genes involved in fALS include genes coding for alsin (ALS2), vesicle associated membrane protein B (VAPB) (Nishimura et al., Am. J. Hum. Genet. 75:822-831 (2004)), senataxin (SETX) (Chen et al., Am. J. Hum. Genet. 74:1128-1135 (2004)), TAR-DNA-binding protein (TDP-43) (Sreedharan et al., Science 319:1668-1672 (2008)), fused in sarcoma or translocated in liposarcoma (FUS/TLS) (Kwiatkowski et al., Science 323:1205-1208 (2009); Vance et al., Science 323:1208-1211 (2009)), and optineurin (OPTN) (Maruyama et al., Nature 465:223-226 (2010)). FUS/TLS is a nucleic acid binding protein that, when mutated, can cause a subset of fALS and can also increase risk for the sporadic disease. Although FUS/TLS is normally located predominantly in the nucleus, pathogenic mutant forms of FUS/TLS traffic to, and form inclusions in, the cytoplasm of affected spinal motor neurons or glia.

(32) Studies of these genes have provided insight into the biochemical processes that may underlie ALS. Putative mechanisms of toxicity targeting motor neurons include glutamate excitotoxicity, oxidative damage, proteasome inhibition, mitochondrial dysfunction, ER stress, axonal transport defects, growth factor signaling deficiency, and glial cell dysfunction (Rothstein et al., Ann. Neurol. 65:S3-S9 (2009); Ilieva et al., J. Cell Biol. 187:761-772 (2009)).

(33) Nonsense-Mediated mRNA Decay

(34) In mammalian cells, expression of protein-encoding genes requires a series of steps in which pre-mRNA is processed to mRNA in the nucleus before mRNA is translated into protein in the cytoplasm. These steps are subject to quality control to ensure that only completely processed mRNA is exported to the cytoplasm (see, e.g., Maquat et al., Cell 104:173-176 (2001)). One form of quality control, called mRNA surveillance or nonsense-mediated mRNA decay (NMD), degrades mRNAs that prematurely terminate translation more than 50-55 nucleotides upstream of an exon-exon junction as a means to prevent the synthesis of potentially harmful truncated proteins (see, e.g., Maquat, J. Cell Sci. 118:1773-1776 (2005); Nicholson et al., Biochem. Soc. Trans. 38:1615-20 (2010)). A number of proteins are involved in NMD in mammalian cells, including UPF1, UPF2, UPF3, SMG1, SMG5, SMG6, and SMG7 (Wittkopp et al., Mol. Cell. Biol. 29:3517-3528 (2009); Rehwinkel et al, Trends Biochem. Sci. 31:639-646 (2006); Rehwinkel et al., RNA 11:1530-1544 (2005)). According to the present disclosure, any NMD polypeptides can be used to treat ALS in methods described herein.

(35) Nucleic Acid Sequences Encoding NMD Polypeptides

(36) Methods and compositions described herein include, for example, nucleic acids encoding NMD polypeptides (e.g., UPF1, UPF2, UPF3, SMG1, SMG5, SMG6, or SMG7). According to the present disclosure, such nucleic acids (and polypeptides) are useful in the treatment of ALS. In some embodiments, such nucleic acids have or include nucleotide sequences as set forth in SEQ ID NO:1, 3, 5, 7, 9, 11, or 13, or characteristic sequence elements thereof or therein. In some embodiments, useful nucleic acids show at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% overall sequence identity with one or more of SEQ ID NO:1, 3, 5, 7, 9, 11, or 13. Alternatively or additionally, in some embodiments, useful nucleic acids include at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more contiguous residues found in SEQ ID NO:1, 3, 5, 7, 9, 11 or 13. In some embodiments, useful nucleic acids are generated in vitro; in some embodiments, useful nucleic acids are generated in vivo. In some embodiments, useful nucleic acids are generated using genetic engineering techniques (e.g., for production and/or mutagenesis of a reference sequence). To give but a few examples, in some embodiments, nucleic acid variants (e.g., of SEQ ID NO:1, 3, 5, 7, 9, 11 or 13) are generated using techniques such as site directed mutagenesis, random chemical mutagenesis, Exonuclease III deletion procedures, and standard cloning techniques. In some embodiments, useful nucleic acids are generating using chemical synthesis and/or modification procedures.

(37) A variety of methods of making nucleic acids that are variants with respect to a reference nucleic acid (e.g., a naturally-occurring or other reference nucleic acid) are well known in the art. These include, for example, procedures in which nucleic acid sequences obtained from natural isolates are modified to generate nucleic acids that encode polypeptides having characteristics that enhance their value in industrial or laboratory applications. In such some embodiments of such procedures, a large number of variant sequences having one or more nucleotide differences with respect to the sequence obtained from the natural isolate are generated and characterized. Typically, these nucleotide differences result in amino acid changes with respect to the polypeptides encoded by the nucleic acids from the natural isolates.

(38) For example, variants can be created using error prone PCR (see, e.g., Leung et al., Technique 1:11-15, 1989; and Caldwell et al., PCR Methods Applic. 2:28-33, 1992). In error prone PCR, PCR is performed under conditions where the copying fidelity of the DNA polymerase is low, such that a high rate of point mutations is obtained along the entire length of the PCR product. Briefly, in such procedures, nucleic acids to be mutagenized are mixed with PCR primers, reaction buffer, MgCl.sub.2, MnCl.sub.2, Taq polymerase, and an appropriate concentration of dNTPs for achieving a high rate of point mutation along the entire length of the PCR product. For example, the reaction can be performed using 20 fmoles of nucleic acid to be mutagenized, 30 pmole of each PCR primer, a reaction buffer comprising 50 mM KCl, 10 mM Tris HCl (pH 8.3), and 0.01% gelatin, 7 mM MgCl.sub.2, 0.5 mM MnCl.sub.2, 5 units of Taq polymerase, 0.2 mM dGTP, 0.2 mM dATP, 1 mM dCTP, and 1 mM dTTP. PCR can be performed for 30 cycles of 94 C. for 1 min, 45 C. for 1 min, and 72 C. for 1 min. However, it will be appreciated that these parameters can be varied as appropriate. The mutagenized nucleic acids are then cloned into an appropriate vector and the activities of the polypeptides encoded by the mutagenized nucleic acids are evaluated.

(39) Variants can also be created using oligonucleotide directed mutagenesis to generate site-specific mutations in any cloned DNA of interest. Oligonucleotide mutagenesis is described in, for example, Reidhaar-Olson et al., Science 241:53-57 (1988). Briefly, in such procedures a plurality of double stranded oligonucleotides bearing one or more mutations to be introduced into the cloned DNA are synthesized and inserted into the cloned DNA to be mutagenized. Clones containing the mutagenized DNA are recovered, and the activities of the polypeptides they encode are assessed.

(40) Another method for generating variants is assembly PCR. Assembly PCR involves the assembly of a PCR product from a mixture of small DNA fragments. A large number of different PCR reactions occur in parallel in the same vial, with the products of one reaction priming the products of another reaction. Assembly PCR is described in, for example, U.S. Pat. No. 5,965,408. Still another method of generating variants is sexual PCR mutagenesis. In sexual PCR mutagenesis, forced homologous recombination occurs between DNA molecules of different, but highly related, DNA sequence in vitro as a result of random fragmentation of the DNA molecule based on sequence homology. This is followed by fixation of the crossover by primer extension in a PCR reaction. Sexual PCR mutagenesis is described in, for example, Stemmer, Proc. Natl. Acad. Sci., USA 91:10747-10751 (1994).

(41) Variants can also be created by in vivo mutagenesis. In some embodiments, random mutations in a nucleic acid sequence are generated by propagating the sequence in a bacterial strain, such as an E. coli strain, which carries mutations in one or more of the DNA repair pathways. Such mutator strains have a higher random mutation rate than that of a wild-type strain. Propagating a DNA sequence in one of these strains will generate random mutations within the DNA. Mutator strains suitable for use for in vivo mutagenesis are described in, for example, PCT Publication No. WO 91/16427.

(42) Variants can also be generated using cassette mutagenesis. In cassette mutagenesis, a small region of a double stranded DNA molecule is replaced with a synthetic oligonucleotide cassette that differs from the native sequence. The oligonucleotide often contains a completely and/or partially randomized native sequence. Recursive ensemble mutagenesis can also be used to generate variants. Recursive ensemble mutagenesis is an algorithm for protein engineering (i.e., protein mutagenesis) developed to produce diverse populations of phenotypically related mutants whose members differ in amino acid sequence. This method uses a feedback mechanism to control successive rounds of combinatorial cassette mutagenesis. Recursive ensemble mutagenesis is described in, for example, Arkin et al., Proc. Natl. Acad. Sci., USA 89:7811-7815 (1992).

(43) In some embodiments, variants are created using exponential ensemble mutagenesis. Exponential ensemble mutagenesis is a process for generating combinatorial libraries with a high percentage of unique and functional mutants, wherein small groups of residues are randomized in parallel to identify, at each altered position, amino acids which lead to functional proteins. Exponential ensemble mutagenesis is described in, for example, Delegrave et al., Biotech. Res. 11:1548-1552 (1993). Random and site-directed mutagenesis are described in, for example, Arnold, Curr. Opin. Biotech. 4:450-455 (1993). In some embodiments, variants are created using shuffling procedures wherein portions of a plurality of nucleic acids that encode distinct polypeptides are fused together to create chimeric nucleic acid sequences that encode chimeric polypeptides as described in, for example, U.S. Pat. Nos. 5,965,408 and 5,939,250.

(44) In some embodiments, nucleic acids for use in accordance with the present disclosure comprise naturally-occurring nucleotide residues. In some embodiments, nucleic acids for use in accordance with the present disclosure include one or more nucleotide analogs. A nucleotide analog is a nucleotide (i.e., an entity that is incorporated into a nucleic acid polymer without significantly disrupting the structure and/or function of that polymer) whose chemical structure differs from that of reference naturally-occurring ribonucleic or deoxyribonucleic acid residues adenine, guanine, cytosine, thymine, and uracil. In some embodiments, a nucleotide analog differs from its reference nucleotide at the base moiety, sugar moiety, and/or phosphate backbone. In some embodiments, a nucleotide analog contributes to one or more altered features in a nucleic acid polymer into which it is incorporated as compared with a comparable nucleic acid polymer containing its reference nucleotide rather than the analog. For example, in some embodiments, such analog-containing polymer shows improved, stability, hybridization, and/or solubility.

(45) In some embodiments, base moiety alterations found in nucleotide analogs include deoxyuridine for deoxythymidine and 5-methyl-2-deoxycytidine or 5-bromo-2-deoxycytidine for deoxycytidine. In some embodiments, sugar moiety alterations found in nucleotide analogs include modification of the 2 hydroxyl of the ribose sugar to form 2-O-methyl or 2-O-allyl sugars. In some embodiments, deoxyribose phosphate backbone alterations found in nucleotide analogs include morpholino nucleic acids, in which each base moiety is linked to a six-membered, morpholino ring, or peptide nucleic acids, in which the deoxyphosphate backbone is replaced by a pseudopeptide backbone and the four bases are retained (see, e.g., Summerton et al., Antisense Nucleic Acid Drug Dev. 7:187-195 (1997); Hyrup et al., Bioorgan. Med. Chem. 4:5-23(1996)). Alternatively or additionally, nucleotide analogs may have a phosphorothioate or phosphorodithioate backbone, a phosphoroamidite, or an alkyl phosphotriester backbone.

(46) In certain instances, an NMD polynucleotide or variant for use in accordance with the present disclosure includes alterations to codon(s) to optimize for expression in a particular host cell. For example, for expression in E. coli, an NMP polynucleotide or variant can include one or more altered codons as described in, e.g., Grosjean et al., Gene 18:199-209 (1982).

(47) NMD Polypeptides

(48) In some embodiments, methods and compositions described utilize NMD polypeptides (e.g., UPF1, UPF2, UPF3, SMG1, SMG5, SMG6, or SMG7 polypeptides). According to the present disclosure, such polypeptides are useful in the treatment of ALS. In some embodiments, such polypeptides useful in the practice of the present disclosure have or include amino acid sequences as set forth in SEQ ID NO:2, 4, 6, 8, 10, 12, or 14, or characteristic sequence elements thereof or therein. In some embodiments, useful polypeptides show at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, or 70% overall sequence identity with one or more of SEQ ID NO:2, 4, 6, 8, 10, 12, or 14. Alternatively or additionally, in some embodiments, useful polypeptides include at least about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100, or 150 or more contiguous amino acid residues found in SEQ ID NO:2, 4, 6, 8, 10, 12, or 14.

(49) In some embodiments, a useful polypeptide differs from its reference polypeptide (e.g., a polypeptide having or including an amino acid sequence as set forth in SEQ ID NO:2, 4, 6, 8, 10, 12, or 14, or characteristic sequence elements thereof or therein) by one or more amino acid residues. For example, in some embodiments, the difference is a conservative or nonconservative substitution of one or more amino acid residues. Conservative substitutions are those that substitute a given amino acid in a polypeptide by another amino acid of similar characteristics. Typical conservative substitutions are the following replacements: replacement of an aliphatic amino acid, such as alanine, valine, leucine, and isoleucine, with another aliphatic amino acid; replacement of a serine with a threonine or vice versa; replacement of an acidic residue, such as aspartic acid and glutamic acid, with another acidic residue; replacement of a residue bearing an amide group, such as asparagine and glutamine, with another residue bearing an amide group; exchange of a basic residue, such as lysine and arginine, with another basic residue; and replacement of an aromatic residue, such as phenylalanine and tyrosine, with another aromatic residue.

(50) In some embodiments, useful NMD polypeptides include a substituent group on one or more amino acid residues. Still other useful polypeptides are associated with (e.g., fused, linked, or coupled to) another moiety (e.g., a peptide or molecule). For example, useful NMD polypeptides can be fused, linked, or coupled to an amino acid sequence (e.g., a leader sequence, a secretory sequence, a proprotein sequence, a second polypeptide, or a sequence that facilitates purification, enrichment, or stabilization of the polypeptide). In certain other embodiments, a polypeptide includes a targeting agent, e.g., a targeting agent described herein.

(51) A variety of methods of making polypeptides are known in the art and can be used to make NMD polypeptides. For example, NMD polypeptides can be recombinantly produced by utilizing a host cell system engineered to express a nucleic acid encoding an NMD polypeptide (e.g., a nucleic acid described herein). Alternatively or additionally, an NMD polypeptide can be produced by activating an endogenous gene (e.g., a nucleic acid encoding an NMD polypeptide present endogenously in a cell). Alternatively or additionally, an NMD polypeptide can be partially or fully prepared by chemical synthesis. Alternatively or additionally, an NMD polypeptide can be purified from natural sources.

(52) Where an NMD polypeptide is recombinantly produced, any expression system can be used. Known expression systems include, without limitation, for example, egg, baculovirus, plant, yeast, or mammalian cells.

(53) In some embodiments, an NMD polypeptide suitable for use in methods described herein are produced in mammalian cells. Non-limiting examples of mammalian cells that can be used include BALB/c mouse myeloma line (NSO/l, ECACC No: 85110503); human retinoblasts (PER.C6, CruCell, Leiden, The Netherlands); monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol., 36:59, 1977); human fibrosarcoma cell line (e.g., HT1080); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells +/DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216, 1980); mouse sertoli cells (TM4, Mather, Biol. Reprod., 23:243-251, 1980); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL 51); TRI cells (Mather et al., Annals N.Y. Acad. Sci., 383:44-68, 1982); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).

(54) Targeting Agents

(55) An NMD agent described herein can be provided in association with and/or can include a targeting agent.

(56) The present disclosure is not limited to any particular targeting agent, and a variety of targeting agents can be used. Examples of such targeting agents include, but are not limited to, nucleic acids (e.g., RNA and DNA), polypeptides (e.g., receptor ligands, signal peptides, avidin, Protein A, and antigen binding proteins), polysaccharides, biotin, hydrophobic groups, hydrophilic groups, drugs, and any organic molecules that bind to target cells or target tissues (e.g., receptors on target cells or target tissues).

(57) Targeting agents can be associated with NMD agents in any of a number of ways. For example, polypeptide targeting agents can be coupled to or fused to an NMD polypeptide. In other embodiments, a targeting agent is associated (e.g., covalently or noncovalently bound) to an NMD agent with either short (e.g., direct coupling), medium (e.g., using small-molecule bifunctional linkers such as SPDP (Pierce Biotechnology, Inc., Rockford, Ill.)), or long (e.g., PEG bifunctional linkers (Nektar Therapeutics, Inc., San Carlos, Calif.)) linkages.

(58) In some instances, targeting agents are or comprise antigen binding proteins or antibodies or binding portions thereof. Antibodies can be generated to allow for specific targeting of antigens or immunogens (e.g., target cell or target tissue specific antigens). Such antibodies include, but are not limited to, polyclonal antibodies; monoclonal antibodies or antigen binding fragments thereof modified antibodies such as chimeric antibodies, reshaped antibodies, humanized antibodies, or fragments thereof (e.g., Fv, Fab, Fab, F(ab).sub.2); or biosynthetic antibodies, e.g., single chain antibodies, single domain antibodies (DAB), Fvs, or single chain Fvs (scFv) (see, e.g., in Harlow et al., Using Antibodies: A Laboratory Manual: Portable Protocol I. Cold Spring Harbor Laboratory (Dec. 1, 1998); Zola, Monoclonal Antibodies: Preparation and Use of Monoclonal Antibodies and Engineered Antibody Derivatives, Springer Verlag (Dec. 15, 2000; 1st edition)). Antibody attachment can be performed by any known method e.g., through standard covalent binding to free amine groups (see, e.g., Torchilin et al., Hybridoma 6:229-240 (1987); Torchilin et al, Biochim. Biophys. Acta 1511:397-411 (2001); Masuko et al., Biomacromol. 6:800-884 (2005)).

(59) In some instances, a targeting agent is or comprises a nucleic acid (e.g., RNA or DNA). In some examples, nucleic acid targeting agents are designed to hybridize by base pairing to a particular nucleic acid (e.g., chromosomal DNA, mRNA, or ribosomal RNA). In some situations, nucleic acid targeting agents bind a ligand on a target cell or target tissue. For example, a nucleic acid can bind human nerve growth factor (Binkley et al., Nuc. Acids Res. 23:3198-205 (1995)). Nucleic acids that bind ligands can be identified by known methods, such as SELEX procedures (see, e.g., U.S. Pat. Nos. 5,475,096; 5,270,163; and 5,475,096; and WO 97/38134; WO 98/33941; and WO 99/07724). In some embodiments, targeting agents can be or comprise aptamers, for example that bind to particular sequences.

(60) In some embodiments, a targeting agent binds to a receptor on the surface of a brain cell to facilitate cellular uptake. For example, a targeting agent can be mannose-6-phosphate (M6P), bis-phosphorylated oligosaccharides, or IGF-II, which are useful for targeting the cation-independent mannose-6-phosphate receptor (CI-MPR) on a brain cell. In some embodiments, a targeting agent is or comprises ascorbate, which is taken up by a sodium-dependent-vitamin C transporter (SVCT2), (see, e.g., Tsukaguchi et al., Nature 399:70-75 (1999)), which is useful for targeting to a brain cell.

(61) Therapeutic Administration

(62) NMD agents (e.g., NMD polynucleotides, a nucleic acid encoding an NMD polypeptide, or an agent that increases NMD polypeptide level and/or activity) described herein can be used to treat ALS, e.g., subjects suffering from or susceptible to ALS. The route and/or mode of administration of an NMD agent described herein can vary depending upon the desired results. One with skill in the art, i.e., a physician, is aware that dosage regimens can be adjusted to provide the desired response, e.g., a therapeutic response.

(63) Methods of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, oral, sublingual, intracerebral, intrathecal, intravaginal, transdermal, rectal, by inhalation, or topical, particularly to the ears, nose, eyes, or skin. The mode of administration is left to the discretion of the practitioner.

(64) In some instances, an NMD agent described herein (e.g., a pharmaceutical formulation of an NMD agent) can effectively cross the blood brain barrier and enter the brain. In other instances, an NMD agent can be delivered using techniques designed to permit or to enhance the ability of the formulation to cross the blood-brain barrier. Such techniques are known in the art (e.g., WO 89/10134; Cloughesy et al., J. Neurooncol. 26:125-132 (1995); and Begley, J. Pharm. Pharmacol. 48:136-146 (1996)). Components of a formulation can also be modified (e.g., chemically) using methods known in the art to facilitate their entry into the CNS.

(65) For example, physical methods of transporting compositions across the blood-brain barrier include, but are not limited to, circumventing the blood-brain barrier entirely, or by creating openings in the blood-brain barrier. Circumvention methods include, but are not limited to, direct injection into the brain (see e.g., Papanastassiou et al., Gene Therapy 9: 398-406 (2002)) and implanting a delivery device in the brain (see e.g., Gill et al., Nature Med. 9: 589-595 (2003); and Gliadel Wafers, Guildford Pharmaceutical). Methods of creating openings in the barrier include, but are not limited to, ultrasound (see e.g., U.S. Patent Publication No. 2002/0038086), osmotic pressure (e.g., by administration of hypertonic mannitol (Neuwelt, E. A., Implication of the Blood-Brain Barrier and its Manipulation, Vols 1 & 2, Plenum Press, N.Y. (1989))), permeabilization by, e.g., bradykinin or permeabilizer A-7 (see, e.g., U.S. Pat. Nos. 5,112,596, 5,268,164, 5,506,206, and 5,686,416), and transfection of neurons that straddle the blood-brain barrier with vectors containing genes encoding an NMD agent (see, e.g., U.S. Patent Publ. No. 20030083299).

(66) Lipid-based methods can also be used to transport an NMD agent across the blood-brain barrier. Exemplary, nonlimiting methods include encapsulating an NMD agent in liposomes that are coupled to a targeting agent described herein (e.g., an antibody that binds to receptors on vascular endothelium of the blood-brain barrier (see, e.g., U.S. Patent Publ. No. 20020025313). In certain other embodiments, a targeting agent is coated in low-density lipoprotein particles (see, e.g., U.S. Patent Publ. No. 20040204354) or apolipoprotein E (see, e.g., U.S. Patent Publ. No. 20040131692).

(67) In some embodiments, an NMD agent is delivered to the CNS of a subject, e.g., by administering into the cerebrospinal fluid (CSF) of a subject in need of treatment. As used herein, intrathecal administration (also referred to as intrathecal injection) refers to an injection into the spinal canal (intrathecal space surrounding the spinal cord). Various techniques may be used including, without limitation, lateral cerebroventricular injection through a burrhole or cisternal or lumbar puncture or the like. Exemplary methods are described in Lazorthes et al., Adv. Tech. Stand. Neurosurg. 18:143-192 (1991), and Omaya, Cancer Drug Deliv. 1:169-179 (1984).

(68) In some instances, an NMD agent described herein is administered locally. This can be achieved, for example, by local infusion during surgery, topical application (e.g., in a cream or lotion), by injection, by means of a catheter, by means of a suppository or enema, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers. In some situations, an NMD agent described herein is introduced into the central nervous system, circulatory system or gastrointestinal tract by any suitable route, including intraventricular injection, intrathecal injection, paraspinal injection, epidural injection, enema, and by injection adjacent to a peripheral nerve.

(69) Specifically, various devices can be used for intrathecal delivery of NMD agents described herein. In some embodiments, a device for intrathecal administration contains a fluid access port (e.g., injectable port); a hollow body (e.g., catheter) having a first flow orifice in fluid communication with the fluid access port and a second flow orifice configured for insertion into spinal cord; and a securing mechanism for securing the insertion of the hollow body in the spinal cord. Various other devices may be used to effect intrathecal administration of a therapeutic composition. For example, formulations containing NMD agents can be administered using an Ommaya reservoir that is in common use for intrathecally administering drugs for meningeal carcinomatosis (Lancet 2: 983-84, 1963). More specifically, in this method, a ventricular tube is inserted through a hole formed in the anterior horn and is connected to an Ommaya reservoir installed under the scalp, and the reservoir is subcutaneously punctured to intrathecally deliver an NMD agent, which is injected into the reservoir. Other devices for intrathecal administration of therapeutic compositions or formulations to an individual are described in U.S. Pat. No. 6,217,552. Alternatively, an NMD agent can be intrathecally given, for example, by a single injection, or continuous infusion. It should be understood that the dosage treatment may be in the form of a single dose administration or multiple doses.

(70) In some embodiments, intrathecal administration can be performed by either lumbar puncture (i.e., slow bolus) or via a port-catheter delivery system (i.e., infusion or bolus).

(71) Relative to intravenous administration, a single dose volume suitable for intrathecal administration is typically small. Typically, intrathecal delivery maintains the balance of the composition of the CSF as well as the intracranial pressure of the subject. In some embodiments, intrathecal delivery is performed absent the corresponding removal of CSF from a subject. In some embodiments, a suitable single dose volume may be e.g., less than about 10 ml, 8 ml, 6 ml, 5 ml, 4 ml, 3 ml, 2 ml, 1.5 ml, 1 ml, or 0.5 ml. In some embodiments, a suitable single dose volume may be about 0.5-5 ml, 0.5-4 ml, 0.5-3 ml, 0.5-2 ml, 0.5-1 ml, 1-3 ml, 1-5 ml, 1.5-3 ml, 1-4 ml, or 0.5-1.5 ml. In some embodiments, intrathecal delivery according to the present invention involves a step of removing a desired amount of CSF first. In some embodiments, less than about 10 ml (e.g., less than about 9 ml, 8 ml, 7 ml, 6 ml, 5 ml, 4 ml, 3 ml, 2 ml, 1 ml) of CSF is first removed before intrathecal administration. In those cases, a suitable single dose volume may be e.g., more than about 3 ml, 4 ml, 5 ml, 6 ml, 7 ml, 8 ml, 9 ml, 10 ml, 15 ml, or 20 ml.

(72) Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent, or via perfusion in a fluorocarbon or synthetic pulmonary surfactant.

(73) An NMD agent described herein can be formulated as a pharmaceutical composition that includes a suitable amount of a physiologically acceptable excipient (see, e.g., Remington's Pharmaceutical Sciences pp. 1447-1676 (Alfonso R. Gennaro, ed., 19th ed. 1995)). Such physiologically acceptable excipients can be, e.g., liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. The physiologically acceptable excipients can be saline, gum acacia, gelatin, starch paste, talc, keratin, colloidal silica, urea and the like. In addition, auxiliary, stabilizing, thickening, lubricating, and coloring agents can be used. In one situation, the physiologically acceptable excipients are sterile when administered to an animal. The physiologically acceptable excipient should be stable under the conditions of manufacture and storage and should be preserved against the contaminating action of microorganisms. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid excipients, particularly for injectable solutions. Suitable physiologically acceptable excipients also include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. Other examples of suitable physiologically acceptable excipients are described in Remington's Pharmaceutical Sciences pp. 1447-1676 (Alfonso R. Gennaro, ed., 19th ed. 1995). The pharmaceutical compositions, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.

(74) Liquid carriers can be used in preparing solutions, suspensions, emulsions, syrups, and elixirs. An NMD agent described herein can be suspended in a pharmaceutically acceptable liquid carrier such as water, an organic solvent, a mixture of both, or pharmaceutically acceptable oils or fat. The liquid carrier can contain other suitable pharmaceutical additives including solubilizers, emulsifiers, buffers, preservatives, sweeteners, flavoring agents, suspending agents, thickening agents, colors, viscosity regulators, stabilizers, or osmo-regulators. Suitable examples of liquid carriers for oral and parenteral administration include water (particular containing additives described herein, e.g., cellulose derivatives, including sodium carboxymethyl cellulose solution), alcohols (including monohydric alcohols and polyhydric alcohols, e.g., glycols) and their derivatives, and oils (e.g., fractionated coconut oil and arachis oil). For parenteral administration the carrier can also be an oily ester such as ethyl oleate and isopropyl myristate. The liquid carriers can be in sterile liquid form for administration. The liquid carrier for pressurized compositions can be halogenated hydrocarbon or other pharmaceutically acceptable propellant.

(75) In other instances, an NMD agent described herein is formulated for intravenous administration. Compositions for intravenous administration can comprise a sterile isotonic aqueous buffer. The compositions can also include a solubilizing agent. Compositions for intravenous administration can optionally include a local anesthetic such as lidocaine to lessen pain at the site of the injection. The ingredients can be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water-free concentrate in a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent. Where an NMD agent described herein is administered by infusion, it can be dispensed, for example, with an infusion bottle containing sterile pharmaceutical grade water or saline. Where an NMD agent described herein is administered by injection, an ampule of sterile water for injection or saline can be provided so that the ingredients can be mixed prior to administration.

(76) An NMD agent described herein can be administered rectally or vaginally in the form of a conventional suppository. Suppository formulations can be made using methods known to those in the art from traditional materials, including cocoa butter, with or without the addition of waxes to alter the suppository's melting point, and glycerin. Water-soluble suppository bases, such as polyethylene glycols of various molecular weights, can also be used.

(77) The amount of an NMD agent described herein that is effective for treating ALS can be determined using standard clinical techniques known to those with skill in the art. In addition, in vitro or in vivo assays can optionally be employed to help identify optimal dosage ranges. The precise dose to be employed can also depend on the route of administration, the condition, the seriousness of the condition being treated, as well as various physical factors related to the individual being treated, and can be decided according to the judgment of a health-care practitioner.

(78) Compositions described herein (e.g., therapeutically effective amounts of compositions described herein) can be administered as single administrations or as multiple administrations. Such compositions can be administered at regular intervals, depending on the nature, severity and extent of the subject's condition (e.g., ALS). In some embodiments, a therapeutically effective amount of a therapeutic agent (e.g., an NMD agent) is administered intrathecally periodically at regular intervals (e.g., once every year, once every six months, once every five months, once every three months, bimonthly (once every two months), monthly (once every month), biweekly (once every two weeks), or weekly).

(79) As used herein, the term therapeutically effective amount is largely determined based on the total amount of the therapeutic agent contained in pharmaceutical compositions described herein. Generally, a therapeutically effective amount is sufficient to achieve a meaningful benefit to a subject (e.g., treating, modulating, curing, preventing and/or ameliorating ALS). For example, a therapeutically effective amount can be an amount sufficient to achieve a desired therapeutic and/or prophylactic effect, such as an amount sufficient to treat ALS or the symptoms thereof. Generally, the amount of a therapeutic agent (e.g., an NMD agent) administered to a subject in need thereof will depend upon the characteristics of the subject. Such characteristics include the condition, disease severity, general health, age, sex and body weight of the subject. One of ordinary skill in the art will be readily able to determine appropriate dosages depending on these and other related factors. In addition, both objective and subjective assays can optionally be employed to identify optimal dosage ranges. A therapeutically effective amount can be administered in a dosing regimen that can include multiple unit doses.

(80) In some embodiments, a therapeutically effective dose ranges from about 0.005 mg/kg brain weight to 500 mg/kg brain weight, e.g., from about 0.005 mg/kg brain weight to 400 mg/kg brain weight, from about 0.005 mg/kg brain weight to 300 mg/kg brain weight, from about 0.005 mg/kg brain weight to 200 mg/kg brain weight, from about 0.005 mg/kg brain weight to 100 mg/kg brain weight, from about 0.005 mg/kg brain weight to 90 mg/kg brain weight, from about 0.005 mg/kg brain weight to 80 mg/kg brain weight, from about 0.005 mg/kg brain weight to 70 mg/kg brain weight, from about 0.005 mg/kg brain weight to 60 mg/kg brain weight, from about 0.005 mg/kg brain weight to 50 mg/kg brain weight, from about 0.005 mg/kg brain weight to 40 mg/kg brain weight, from about 0.005 mg/kg brain weight to 30 mg/kg brain weight, from about 0.005 mg/kg brain weight to 25 mg/kg brain weight, from about 0.005 mg/kg brain weight to 20 mg/kg brain weight, from about 0.005 mg/kg brain weight to 15 mg/kg brain weight, from about 0.005 mg/kg brain weight to 10 mg/kg brain weight.

(81) In some embodiments, a therapeutically effective dose is greater than about 0.1 mg/kg brain weight, greater than about 0.5 mg/kg brain weight, greater than about 1.0 mg/kg brain weight, greater than about 3 mg/kg brain weight, greater than about 5 mg/kg brain weight, greater than about 10 mg/kg brain weight, greater than about 15 mg/kg brain weight, greater than about 20 mg/kg brain weight, greater than about 30 mg/kg brain weight, greater than about 40 mg/kg brain weight, greater than about 50 mg/kg brain weight, greater than about 60 mg/kg brain weight, greater than about 70 mg/kg brain weight, greater than about 80 mg/kg brain weight, greater than about 90 mg/kg brain weight, greater than about 100 mg/kg brain weight, greater than about 150 mg/kg brain weight, greater than about 200 mg/kg brain weight, greater than about 250 mg/kg brain weight, greater than about 300 mg/kg brain weight, greater than about 350 mg/kg brain weight, greater than about 400 mg/kg brain weight, greater than about 450 mg/kg brain weight, greater than about 500 mg/kg brain weight.

(82) In some embodiments, a therapeutically effective dose can be expressed as mg/kg body weight. As one skilled in the art would appreciate, brain weights and body weights can be correlated (see, e.g., Dekaban, Ann. Neurol. 4:345-56 (1978)).

(83) In some embodiments, a therapeutically effective dose can be expressed as mg/15 cc of CSF. As one skilled in the art would appreciate, therapeutically effective doses based on brain weights and body weights can be converted to mg/15 cc of CSF. For example, the volume of CSF in adult humans is approximately 150 mL (Johanson et al., Cerebrospinal Fluid Res. 14:5:10 (2008)). Therefore, single dose injections of 0.1 mg to 50 mg protein to adults would be approximately 0.01 mg/15 cc of CSF (0.1 mg) to 5.0 mg/15 cc of CSF (50 mg) doses in adults.

(84) It is to be further understood that for any particular subject, specific dosage regimens can be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of an NMD agent and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed invention.

(85) In some instances, a pharmaceutical composition described herein is in unit dosage form, e.g., as a tablet, capsule, powder, solution, suspension, emulsion, granule, or suppository. In such form, the pharmaceutical composition can be sub-divided into unit doses containing appropriate quantities of an NMD agent described herein. The unit dosage form can be a packaged pharmaceutical composition, for example, packeted powders, vials, ampoules, pre-filled syringes or sachets containing liquids. The unit dosage form can be, for example, a capsule or tablet itself, or it can be the appropriate number of any such compositions in package form. Such unit dosage form can contain from about 1 mg/kg to about 250 mg/kg, and can be given in a single dose or in two or more divided doses.

(86) Gene Therapy

(87) In embodiments in which an NMD agent consists of or comprises a nucleic acid encoding an NMD polypeptide, the present disclosure includes methods of administering such nucleic acid to a subject to treat ALS.

(88) In some embodiments, a nucleic acid encoding an NMD polypeptide is inserted into a viral vector for delivery to a subject. For example, retrovirus vectors can be used as a recombinant delivery system for transferring nucleic acids encoding NMD polypeptides vivo (see, e.g., Dropulic, Hum. Gene Ther. 22:649-57 (2011); and Kumar et al., Curr. Gene Ther. 11:144-53 (2011)). Retroviruses useful in methods of the present disclosure include, but are not limited to, murine leukemia virus (MLV), human immunodeficiency virus (HIV), equine infectious anaemia virus (EIAV), mouse mammary tumour virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukemia virus (A-MLV), Avian myelocytomatosis virus-29 (MC29), Avian erythroblastosis virus (AEV) and all other retroviridiae including lentiviruses (see, e.g., Coffin et al., Retroviruses, 1997 Cold Spring Harbor Laboratory Press Eds: J M Coffin, S M Hughes, H E Varmus, pp 758-763)). A replication defective retrovirus can be packaged into virions that can be used to infect a target cell through the use of a helper virus by standard techniques (see, e.g., Current Protocols in Molecular Biology, Ausubel, F. M. et al. (eds.) Greene Publishing Associates, (1989), Sections 9.10-9.14).

(89) In other embodiments, adenovirus-derived vectors are used to deliver nucleic acids encoding NMD polypeptides. The genome of an adenovirus can be manipulated such that it encodes and expresses an NMD polypeptide, but is inactivated in terms of its ability to replicate in a normal lytic viral life cycle (see, e.g., Berkner et al. (1988) BioTechniques 6:616; Rosenfeld et al. (1991) Science 252:431-434; and Rosenfeld et al. (1992) Cell 68:143-155). Suitable adenoviral vectors useful in the methods of the present disclosure include those derived from the adenovirus strain Ad type 5 d1324 or other strains of adenovirus (e.g., Ad2, Ad3, Ad7 etc.).

(90) In some embodiments, an adeno-associated virus (AAV) is used to deliver a nucleic acid encoding an NMD polypeptide (see, e.g., Muzyczka et al. (1992) Curr. Topics in Micro. and Immunol. 158:97-129). A variety of nucleic acids have been introduced into different cell types using AAV vectors (see, e.g., Hermonat et al. (1984) Proc. Natl. Acad. Sci. USA 81:6466-6470; Tratschin et al. (1985) Mol. Cell. Biol. 4:2072-2081; Wondisford et al. (1988) Mol. Endocrinol. 2:32-39; Tratschin et al. (1984) J. Virol. 51:611-619; and Flotte et al. (1993) J. Biol. Chem. 268:3781-3790). Particularly useful AAVs include those that normally infect humans (e.g., serotypes 1, 2, 3A, 3B, 4, 5, and 6) or primates (e.g., serotypes 1 and 4).

(91) In other embodiments, non-viral methods are useful to deliver a nucleic acid encoding an NMD polypeptide to a subject. Such nonviral methods of gene transfer can exploit mechanisms normally used by mammalian cells for uptake and intracellular transport of macromolecules. For example, liposomal delivery systems, poly-lysine conjugates, and artificial viral envelopes can be used. In some embodiments, a nucleic acid encoding an NMD polypeptide is entrapped in liposomes bearing positive charges on their surface (e.g., lipofectins). In some embodiments, a liposome can be conjugated to a targeting agent described herein (see, e.g., Mizuno et al. (1992) No Shinkei Geka 20:547-551).

(92) Certain cationic polymers (complexation agents) known to spontaneously bind to and condense nucleic acids into nanoparticles can also be used including, e.g., naturally occurring proteins, peptides, or derivatives, as well as synthetic cationic polymers such as polyethylenimine (PEI), polylysine (PLL), etc. Many useful polymers contain both chargeable amino groups, to allow for ionic interaction with negatively charged DNA phosphate, and a degradable region, such as a hydrolyzable ester linkage. Examples of these include, without limitation, poly(alpha-(4-aminobutyl)-L-glycolic acid), network poly(amino ester), and poly(beta-amino esters). Such complexation agents can protect DNA against degradation, e.g., by nucleases, serum components, etc., and create a less negative surface charge, which may facilitate passage through hydrophobic membranes (e.g., cytoplasmic, lysosomal, endosomal, nuclear) of the cell. Certain complexation agents facilitate intracellular trafficking events such as endosomal escape, cytoplasmic transport, and nuclear entry, and can dissociate from the nucleic acid.

(93) Cell-Based Therapy

(94) An NMD polynucleotide can also be advantageously provided to a cell ex vivo, followed by administration of the living cell to the subject. In some embodiments, primary or secondary cells are genetically engineered to express an NMD polypeptide. Such cells can be obtained from a variety of tissues and include cell types which can be maintained propagated in culture. For example, primary and secondary cells include fibroblasts, endothelial cells, glial cells, and neural cells. In some embodiments, primary cells are obtained from an individual to whom a genetically engineered primary or secondary cells is to be administered. Primary cells can also be obtained from a donor (other than the recipient) of the same species or another species (e.g., mouse, rat, rabbit, cat, dog, pig, cow, bird, sheep, goat, horse).

(95) Primary or secondary cells (e.g., of vertebrate or mammalian origin) can be transfected with a nucleic acid encoding an NMD polypeptide. In some embodiments, a cell is transfected with an exogenous nucleic acid sequence that includes a nucleic acid encoding an NMD polypeptide and an additional nucleic acid sequence (e.g., a regulatory sequence, e.g., a promoter, which causes expression, e.g., inducible expression or upregulation, of an endogenous NMD sequence). Transfected primary or secondary cells may also include DNA encoding a selectable marker which confers a selectable phenotype upon them, facilitating their identification and isolation.

(96) Methods for treating disease by implanting a cell that has been modified to express a recombinant protein are also well known. See, for example, U.S. Pat. No. 5,399,346, disclosing methods for introducing a nucleic acid into a primary human cell for introduction into a human. Although use of human cells for ex vivo therapy is preferred in some embodiments, other cells such as bacterial cells may be implanted in a subject's vasculature, continuously releasing a therapeutic agent. See, for example, U.S. Pat. Nos. 4,309,776 and 5,704,910.

(97) Kits

(98) An NMD agent described herein (e.g., a pharmaceutical composition comprising an NMD agent) can be provided in a kit. In some instances, the kit includes (a) a container that contains an NMD agent described herein (e.g., a pharmaceutical composition comprising an NMD agent) and, optionally (b) informational material. The informational material can be descriptive, instructional, marketing or other material that relates to the methods described herein and/or the use of an NMD agent, e.g., for therapeutic benefit.

(99) The informational material of the kits is not limited in its form. In some instances, the informational material can include information about production of an NMD agent, molecular weight of an NMD agent, concentration, date of expiration, batch or production site information, and so forth. In other situations, the informational material relates to methods of administering an NMD agent, e.g., in a suitable amount, manner, or mode of administration (e.g., a dose, dosage form, or mode of administration described herein). The method can be a method of treating a subject having ALS.

(100) In some cases, the informational material, e.g., instructions, is provided in printed matter, e.g., a printed text, drawing, and/or photograph, e.g., a label or printed sheet. The informational material can also be provided in other formats, such as Braille, computer readable material, video recording, or audio recording. In other instances, the informational material of the kit is contact information, e.g., a physical address, email address, website, or telephone number, where a user of the kit can obtain substantive information about an NMD agent therein and/or their use in the methods described herein. The informational material can also be provided in any combination of formats.

(101) In addition to an NMD agent, the kit can include other ingredients, such as a solvent or buffer, a stabilizer, or a preservative. The kit can also include other agents, e.g., a second or third agent, e.g., other therapeutic agents. The components can be provided in any form, e.g., liquid, dried or lyophilized form. The components can be substantially pure (although they can be combined together or delivered separate from one another) and/or sterile. When the components are provided in a liquid solution, the liquid solution can be an aqueous solution, such as a sterile aqueous solution. When the components are provided as a dried form, reconstitution generally is by the addition of a suitable solvent. The solvent, e.g., sterile water or buffer, can optionally be provided in the kit.

(102) The kit can include one or more containers for an NMD agent or other agents. In some cases, the kit contains separate containers, dividers or compartments for an NMD agent and informational material. For example, an NMD agent can be contained in a bottle, vial, or syringe, and the informational material can be contained in a plastic sleeve or packet. In other situations, the separate elements of the kit are contained within a single, undivided container. For example, an NMD agent can be contained in a bottle, vial or syringe that has attached thereto the informational material in the form of a label. In some cases, the kit can include a plurality (e.g., a pack) of individual containers, each containing one or more unit dosage forms (e.g., a dosage form described herein) of an NMD agent. The containers can include a unit dosage, e.g., a unit that includes an NMD agent. For example, the kit can include a plurality of syringes, ampules, foil packets, blister packs, or medical devices, e.g., each containing a unit dose. The containers of the kits can be air tight, waterproof (e.g., impermeable to changes in moisture or evaporation), and/or light-tight.

(103) The kit can optionally include a device suitable for administration of an NMD agent, e.g., a syringe or other suitable delivery device. The device can be provided preloaded with an NMD agent, e.g., in a unit dose, or can be empty, but suitable for loading.

(104) Treatment of ALS

(105) The present invention encompasses the surprising finding that NMD agents are useful, among other things, in the treatment or prevention (i.e., delay of onset) of ALS. UPF1 was initially identified as one of many genes able to rescue toxicity mediated by FUS/TLS in a yeast model (Ju et al., PLoS Biol. 9:e1001052 (2011)). However, the present finding that expressing UPF1 in neuronal cells expressing FUS/TLS or TDP-43 reduces cellular toxicity is surprising, especially given the finding that expression of UPF1 had no effect on the cytoplasmic levels of FUS/TLS or TDP-43 in the neuronal cells. Accordingly, in some embodiments, an NMD agent is provided to the central nervous system of a subject, e.g., a subject suffering from or susceptible to ALS. In some embodiments, an NMD agent is provided to one or more of target cells or tissues of brain, spinal cord, and/or peripheral organs. In some embodiments, target cells or tissues include those cells or tissues that display a disease-associated pathology, symptom, or feature. In some embodiments, target cells or tissues include those cells or tissues in which TDP-43 or FUS/TLS is expressed at an elevated level, e.g., cells in which TDP-43 or FUS/TLS is expressed at an elevated level in the cytoplasm of the cells. As used herein, a target tissue may be a brain target tissue, a spinal cord target tissue and/or a peripheral target tissue.

(106) Compositions described herein can be provided directly into the CNS of a subject suffering from or at risk of developing ALS, thereby achieving a therapeutic concentration within the affected cells and tissues of the CNS (e.g., the brain). For example, one or more NMD agents can be provided to target cells or tissues of the brain, spinal cord and/or peripheral organs to treat ALS. As used herein, the term treat or treatment refers to amelioration of one or more symptoms associated with the disease, prevention or delay of the onset of one or more symptoms of the disease, and/or lessening of the severity or frequency of one or more symptoms of the disease.

(107) In some embodiments, treatment refers to partially or complete alleviation, amelioration, relief, inhibition, delaying onset, reducing severity and/or incidence of neurological impairment in a patient suffering from or susceptible to ALS. As used herein, the term neurological impairment includes various symptoms associated with impairment of the central nervous system (e.g., the brain and spinal cord). Symptoms of neurological impairment may include, for example, developmental delay, progressive cognitive impairment, hearing loss, impaired speech development, deficits in motor skills, hyperactivity, aggressiveness and/or sleep disturbances, among others.

(108) In some embodiments, treatment refers to decreased toxicity of various cells or tissues. In some embodiments, treatment refers to decreased neuronal toxicity due to FUS or TDP-43 in brain target tissues, spinal cord neurons, and/or peripheral target tissues. In certain embodiments, toxicity is decreased by about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100% or more as compared to a control. In some embodiments, toxicity is decreased by at least 1-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold or 10-fold as compared to a control. In some embodiments, toxicity is measured by tests known to those of ordinary skill in the art including, but not limited to, neuroimaging methods (e.g., CT scans, MRI, functional MRI, etc.).

(109) In certain embodiments, treatment according to the present disclosure results in a reduction (e.g., about a 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 95%, 97.5%, 99% or more reduction) or a complete elimination of the presence, or alternatively the accumulation, of one or more pathological, clinical, or biological markers that are associated with ALS. For example, in some embodiments, upon administration to a subject, a pharmaceutical composition described herein demonstrates or achieves a reduction in muscle loss, muscle twitching, muscle weakness, spasticity, abnormal tendon reflexes, Babinski sign, breathing problems, facial weakness, slurred speech, loss of perception, loss of reasoning, loss of judgment, and/or loss of imagination.

(110) In some embodiments, treatment refers to increased survival (e.g., survival time). For example, treatment can result in an increased life expectancy of a patient. In some embodiments, treatment results in an increased life expectancy of a patient by more than about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 100%, about 105%, about 110%, about 115%, about 120%, about 125%, about 130%, about 135%, about 140%, about 145%, about 150%, about 155%, about 160%, about 165%, about 170%, about 175%, about 180%, about 185%, about 190%, about 195%, about 200% or more, as compared to the average life expectancy of one or more control individuals with ALS without treatment. In some embodiments, treatment results in an increased life expectancy of a patient by more than about 6 months, about 7 months, about 8 months, about 9 months, about 10 months, about 11 months, about 12 months, about 2 years, about 3 years, about 4 years, about 5 years, about 6 years, about 7 years, about 8 years, about 9 years, about 10 years or more, as compared to the average life expectancy of one or more control individuals with ALS without treatment. In some embodiments, treatment results in long term survival of a patient. As used herein, the term long term survival refers to a survival time or life expectancy longer than about 40 years, 45 years, 50 years, 55 years, 60 years, or longer.

(111) The term improve, increase or reduce, as used herein, indicates values that are relative to a control. In some embodiments, a suitable control is a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of the treatment described herein. A control individual is an individual afflicted with ALS, who is about the same age and/or gender as the individual being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).

(112) The individual (also referred to as patient or subject) being treated is an individual (fetus, infant, child, adolescent, or adult human) having ALS or having the potential to develop ALS. In some instances, a subject to be treated is genetically predisposed to developing ALS. For example, a subject to be treated has a mutation in a SOD1 gene, ALS2 gene, VAPB gene, SETX gene, TDP-43 gene, FUS/TLS gene, and/or OPTN gene.

(113) Combination Therapy

(114) In some embodiments, an NMD agent described herein is administered to a subject in combination with one or more additional therapies to treat ALS or one or more symptoms of ALS. For example, an NMD agent can be administered in combination with riluzole (Rilutek, Sanofi-Aventis, Bridgewater, N.J.), baclofen, diazepam, trihexyphenidyl or amitriptyline.

(115) In some embodiments, combined administration of an NMD agent and a second agent results in an improvement in ALS or a symptom thereof to an extent that is greater than one produced by either the NMD agent or the second agent alone. The difference between the combined effect and the effect of each agent alone can be a statistically significant difference.

(116) In some embodiments, combined administration of an NMD agent and a second agent allows administration of the second agent at a reduced dose, at a reduced number of doses, and/or at a reduced frequency of dosage compared to a standard dosing regimen approved for the second agent. For example, approved standard regimen for Rilutek is 50 mg every 12 hours. Accordingly, for administration in combination with an NMD agent, a therapeutically effective amount of Rilutek can be a dosage of less than about 50 mg and/or a frequency of greater than about every 12 hours.

(117) In some embodiments, an immunosuppressant agent known to the skilled artisan can be administered to a subject in combination with an NMD polypeptide described herein. Exemplary immunosuppressant agents include, without limitation, cyclosporine, FK506, rapamycin, CTLA4-Ig, anti-TNF agents (such as etanercept), daclizumab (e.g., Zenapax), anti-CD2 agents, anti-CD4 agents, and anti-CD40 agents.

(118) Methods of Identifying Modulators of NMD Polypeptide Expression or Activity

(119) NMD polypeptides described herein (e.g., UPF1, UPF2, UPF3, SMG1, SMG5, SMG6, or SMG7 polypeptides) are useful for identifying agents that can be potentially used to treat ALS. For example, an agent that increases expression or activity of an NMD polypeptide can be identified as an agent that can be used to treat ALS. Numerous methods exist for evaluating whether an agent alters NMD polypeptide expression or NMD polypeptide activity or level. In one embodiment, the ability of a test agent to modulate (e.g., increase or decrease) (e.g., permanently or temporarily) expression from an NMD polynucleotide promoter is evaluated by e.g., routine reporter (e.g., LacZ, luciferase, or GFP) transcription assay. For example, a cell or transgenic animal whose genome comprises a reporter gene operably linked to an NMD polynucleotide promoter, can be contacted with a test agent, and the ability of the test agent to increase or decrease reporter activity is indicative of the ability of the agent to modulate an NMD polypeptide.

(120) In some embodiments, effects of a test agent on NMD polypeptide expression or NMD polypeptide activity or level can be evaluated in a cell, cell lysate, or subject, preferably a non-human experimental mammal, and more preferably a rodent (e.g., a rat, mouse, rabbit), or explant thereof. Methods of assessing NMD polypeptide expression are well know in the art, e.g., Northern analysis, ribonuclease protection assay, reverse transcription-polymerase chain reaction (RT-PCR) or RNA in situ hybridization (see, e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual (3.sup.rd ed. 2001)). The level of NMD polypeptide can be monitored by, e.g., Western analysis, immunoassay, or in situ hybridization. In some embodiments, a DNA construct encoding an NMD polypeptide/GFP fusion protein is transfected into cells, and level of GFP fluorescence in the presence or absence of a test agent is determined. An increase in fluorescence in the presence of the test agent is indicative of the ability of the test agent to increase NMD polypeptide level.

(121) In some embodiments, the effect of a test agent on NMD polypeptide expression or NMD polypeptide activity or level is confirmed in a second assay, e.g., is observed as a change, in the presence of the test agent, in the ability of the NMD polypeptide to reduce toxicity of a cell, e.g., a neuronal cell, expressing TDP-43 and/or FUS.

(122) Agents and test agents to be used in the methods described herein include crude or partially or substantially purified extracts of organic sources, e.g., botanical (e.g., herbal) and algal extracts, inorganic elements or compounds, as well as partially or substantially purified or synthetic agents, e.g., small molecules, polypeptides, antibodies, and polynucleotides, and libraries of these.

(123) In one example, combinatorial chemical libraries can be produced or obtained that sample chemical compounds that are structurally or chemically related or unrelated. Preparation and screening of combinatorial chemical libraries is well known to those of skill in the art. Such combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Pat. No. 5,010,175; Furka, Int. J. Pept. Prot. Res. 37:487-493 (1991); and Houghton et al., Nature 354:84-88 (1991)). Other chemistries for generating chemical diversity libraries can also be used. Such chemistries include, but are not limited to: peptoids (e.g., PCT Publication No. WO 91/19735), encoded peptides (e.g., PCT Publication No. WO 93/20242), random bio-oligomers (e.g., PCT Publication No. WO 92/00091), benzodiazepines (e.g., U.S. Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs et al., Proc. Nat. Acad. Sci. USA 90:6909-6913 (1993)), vinylogous polypeptides (Hagihara et al., J. Amer. Chem. Soc. 114:6568 (1992)), nonpeptidal peptidomimetics with glucose scaffolding (Hirschmann et al., J. Amer. Chem. Soc. 114:9217-9218 (1992)), analogous organic syntheses of small compound libraries (Chen et al., J. Amer. Chem. Soc. 116:2661 (1994)), oligocarbamates (Cho et al., Science 261:1303 (1993)), and/or peptidyl phosphonates (Campbell et al., J. Org. Chem. 59:658 (1994)), nucleic acid libraries, peptide nucleic acid libraries (see, e.g., U.S. Pat. No. 5,539,083), antibody libraries (see, e.g., Vaughn et al., Nature Biotechnology, 14(3):309-314 (1996) and PCT/US96/10287), carbohydrate libraries (see, e.g., Liang et al., Science, 274:1520-1522 (1996) and U.S. Pat. No. 5,593,853), and small organic molecule libraries (see, e.g., benzodiazepines, Baum C&EN, January 18, page 33 (1993); isoprenoids, U.S. Pat. No. 5,569,588; thiazolidinones and metathiazanones, U.S. Pat. No. 5,549,974; pyrrolidines, U.S. Pat. Nos. 5,525,735 and 5,519,134; morpholino compounds, U.S. Pat. No. 5,506,337; benzodiazepines, U.S. Pat. No. 5,288,514, and the like).

(124) The invention is further illustrated by the following examples. The examples are provided for illustrative purposes only. They are not to be construed as limiting the scope or content of the invention in any way.

EXAMPLES

Example 1: Expression of UPF1 in Neurons Eliminates Toxicity of FUS or TDP-43

(125) The present Example describes reduction of TDP-43 or FUS-mediated neuronal toxicity by UPF1.

(126) A yeast model of ALS was used to identify a human gene, UPF1, which suppressed toxicity of FUS/TLS in yeast (Ju et al., PLoS Biol. 9:e1001052 (2011)). Further, UPF1 was able to suppress the cytotoxicity of ALS-associated TDP-43 mutations in yeast as well.

(127) To test the efficacy of UPF1 in reducing TDP-43 or FUS-mediated cytotoxicity in neurons, UPF1 was expressed in motor neurons expressing disease-associated FUS or TDP-43. Motor neurons were either isolated from mice or created from fibroblasts taken from human ALS patients using iPS cell techniques (described in Yamanaka et al., Cell 126:663-676 (2006)). FUS or TDP-43 were tagged with EGFP (Enhanced Green Fluorescent Protein) and expressed in motor neurons, which were visualized by fluorescent microscopy using mApple.

(128) The motor neurons died within a few days of FUS or TDP-43 expression due to toxicity of these ALS-related proteins. UPF1 was expressed in the motor neurons and Kaplan-Meyer survival curves were determined. As shown in FIG. 1A, UPF1 expression had no effect on survival of wild type neurons, indicating that UPF1 was not a generic survival factor. However, as shown in FIG. 1B, UPF1 was able to completely eliminate the toxicity of TDP-43 in a dose-dependent manner. UPF1 had a similar effect on cells expressing FUS (data not shown). Moreover, UPF1 expression was unable to rescue the toxicity of ALS-associated mutants of SOD1, demonstrating for the first time that SOD1-dependent fALS is a distinct disease mechanistically.

Example 2: Yeast Screening Assay for Compounds that Rescue FUS Toxicity

(129) A drug screen based on the yeast model described in Example 1 was developed to identify compounds that rescue toxicity that resulted from FUS expression. Because the phenotype was rescue from cell death, the screen demonstrated exceptionally good signal-to noise, with a Z score of around 0.8.

(130) Briefly, two yeast strains were engineered: 1FUS, in which a FUS gene was stably integrated at the HIS locus; and 1Vec, in which an empty vector was integrated at the same locus. The media used were YPRaffinose and 2YPGalactose (2 concentrated). Yeast cells were grown by inoculating a single colony of 1FUS strain or 1Vec strain into 2 ml YPRaffinose medium and were grown overnight at 30 C. The overnight cultures were then used to inoculate 50 ml YPRaffinose medium at OD600=0.2 and were grown for 24 hrs at 30 C.

(131) The cultures were then diluted in 500 ml 2YPGalactose medium at OD600=0.2. 384 well plates were pre-filled with 25 l of each test compound at a concentration of 30 M. A Multidrop was used to add 25 l of the suspension of 1FUS to each well on columns 1-23 of the plate; 1Vec was added to each well on column 24 as control. The yeast and compounds were mixed thoroughly. The plates were kept in a humidified incubator at 30 C. The OD600 of each plate was monitored at 24 hr and 48 hrs.

(132) The compound(s) that rescued the growth of 1FUS were selected and retested. The compounds that passed the retest were further checked in a 10-dose response experiment. The compounds that demonstrated good dose responses were re-ordered, and retested.

EQUIVALENTS

(133) It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.

(134) TABLE-US-00001 Sequences UPF1nucleotidesequence(GenBankAccessionNo. U59323.1,nt176-3532) (SEQIDNO:1) 176 atgag 181 cgtggaggcgtacgggcccagctcgcagactctcactttcctggacacggaggaggccga 241 gctgcttggcgccgacacacagggctccgagttcgagttcaccgactttactcttcctag 301 ccagacgcagacgccccccggcggccccggcggcccgggcggtggcggcgcgggaagccc 361 gggcggcgcgggcgccggcgctgcggcgggacagctcgacgcgcaggttgggcccgaagg 421 catcctgcagaacggggctgtggacgacagtgtagccaagaccagccagttgttggctga 481 gttgaacttcgaggaagatgaagaagacacctattacacgaaggacctccccatacacgc 541 ctgcagttactgtggaatacacgatcctgcctgcgtggtttactgtaataccagcaagaa 601 gtggttctgcaacggacgtggaaatacttctggcagccacattgtaaatcaccttgtgag 661 ggcaaaatgcaaagaggtgaccctgcacaaggacgggcccctgggggagacagtcctgga 721 gtgctacaactgcggctgtcgcaacgtcttcctcctcggcttcatcccggccaaagctga 781 ctcagtggtggtgctgctgtgcaggcagccctgtgccagccagagcagcctcaaggacat 841 caactgggacagctcgcagtggcagccgctgatccaggaccgctgcttcctgtcctggct 901 ggtcaagatcccctccgagcaggagcagctgcgggcacgccagatcacggcacagcagat 961 caacaagctggaggagctgtggaaggaaaacccttctgccacgctggaggacctggagaa 1021 gccgggggtggacgaggagccgcagcatgtcctcctgcggtacgaggacgcctaccagta 1081 ccagaacatattcgggcccctggtcaagctggaggccgactacgacaagaagctgaagga 1141 gtcccagactcaagataacatcactgtcaggtgggacctgggccttaacaagaagagaat 1201 cgcctacttcactttgcccaagactgactctgacatgcggctcatgcagggggatgagat 1261 atgcctgcggtacaaaggggaccttgcgcccctgtggaaagggatcggccacgtcatcaa 1321 ggtccctgataattatggcgatgagatcgccattgagctgcggagcagcgtgggtgcacc 1381 tgtggaggtgactcacaacttccaggtggattttgtgtggaagtcgacctcctttgacag 1441 gatgcagagcgcattgaaaacgtttgccgtggatgagacctcggtgtctggctacatcta 1501 ccacaagctgttgggccacgaggtggaggacgtaatcaccaagtgccagctgcccaagcg 1561 cttcacggcgcagggcctccccgacctcaaccactcccaggtttatgccgtgaagactgt 1621 gctgcaaagaccactgagcctgatccagggcccgccaggcacggggaagacggtgacgtc 1681 ggccaccatcgtctaccacctggcccggcaaggcaacgggccggtgctggtgtgtgctcc 1741 gagcaacatcgccgtggaccagctaacggagaagatccaccagacggggctaaaggtcgt 1801 gcgcctctgcgccaagagccgtgaggccatcgactccccggtgtcttttctggccctgca 1861 caaccagatcaggaacatggacagcatgcctgagctgcagaagctgcagcagctgaaaga 1921 cgagactggggagctgtcgtctgccgacgagaagcggtaccgggccttgaagcgcaccgc 1981 agagagagagctgctgatgaacgcagatgtcatctgctgcacatgtgtgggcgccggtga 2041 cccgaggctggccaagatgcagttccgctccattttaatcgacgaaagcacccaggccac 2101 cgagccggagtgcatggttcccgtggtcctcggggccaagcagctgatccttgtaggcga 2161 ccactgccagctgggcccagtggtgatgtgcaagaaggcggccaaggccgggctgtcaca 2221 gtcgctcttcgagcgcctggtggtgctgggcatccggcccatccgcctgcaggtccagta 2281 ccggatgcaccctgcactcagcgccttcccatccaacatcttctacgagggctccctcca 2341 gaatggtgtcactgcagcggatcgtgtgaagaagggatttgacttccagtggccccaacc 2401 cgataaaccgatgttcttctacgtgacccagggccaagaggagattgccagctcgggcac 2461 ctcctacctgaacaggaccgaggctgcgaacgtggagaagatcaccacgaagttgctgaa 2521 ggcaggcgccaagccggaccagattggcatcatcacgccctacgagggccagcgctccta 2581 cctggtgcagtacatgcagttcagcggctccctgcacaccaagctctaccaggaagtgga 2641 gatcgccagtgtggacgcctttcagggacgcgagaaggacttcatcatcctgtcctgtgt 2701 gcgggccaacgagcaccaaggcattggctttttaaatgaccccaggcgtctgaacgtggc 2761 cctgaccagagcaaggtatggcgtcatcattgtgggcaacccgaaggcactatcaaagca 2821 gccgctctggaaccacctgctgaactactataaggagcagaaggtgctggtggaggggcc 2881 gctcaacaacctgcgtgagagcctcatgcagttcagcaagccacggaagctggtcaacac 2941 tatcaacccgggagcccgcttcatgaccacagccatgtatgatgcccgggaggccatcat 3001 cccaggctccgtctatgatcggagcagccagggccggccttccagcatgtacttccagac 3061 ccatgaccagattggcatgatcagtgccggccctagccacgtggctgccatgaacattcc 3121 catccccttcaacctggtcatgccacccatgccaccgcctggctattttggacaagccaa 3181 cgggcctgctgcagggcgaggcaccccgaaaggcaagactggtcgtgggggacgccagaa 3241 gaaccgctttgggcttcctggacccagccagactaacctccccaacagccaagccagcca 3301 ggatgtggcgtcacagcccttctctcagggcgccctgacgcagggctacatctccatgag 3361 ccagccttcccagatgagccagcccggcctctcccagccggagctgtcccaggacagtta 3421 ccttggtgacgagtttaaatcacaaatcgacgtggcgctctcacaggactccacgtacca 3481 gggagagcgggcttaccagcatggcggggtgacggggctgtcccagtattaa UPF1aminoacidsequence(GenBankAccessionNo.AAC51140.1) (SEQIDNO:2) 1 msveaygpssqtltfldteeaellgadtqgsefeftdftlpsqtqtppggpggpggggag 61 spggagagaaagqldaqvgpegilqngavddsvaktsqllaelnfeedeedtyytkdlpi 121 hacsycgihdpacvvycntskkwfcngrgntsgshivnhlvrakckevtlhkdgplgetv 181 lecyncgcrnvfllgfipakadsvvvllcrqpcasqsslkdinwdssqwqpliqdrcfls 241 wlvkipseqeqlrarqitaqqinkleelwkenpsatledlekpgvdeepqhvllryeday 301 qyqnifgplvkleadydkklkesqtqdnitvrwdlglnkkriayftlpktdsdmrlmqgd 361 eiclrykgdlaplwkgighvikvpdnygdeiaielrssvgapvevthnfqvdfvwkstsf 421 drmqsalktfavdetsysgyiyhkllghevedvitkcqlpkrftaqglpdlnhsqvyavk 481 tvlqrplsliqgppgtgktvtsativyhlarqgngpvlvcapsniavdqltekihqtglk 541 vvrlcaksreaidspvsflalhnqirnmdsmpelqklqqlkdetgelssadekryralkr 601 taerellmnadvicctcvgagdprlakmqfrsilidestqatepecmvpvvlgakqlilv 661 gdhcqlgpvvmckkaakaglsqslferlvvlgirpirlqvqyrmhpalsafpsnifyegs 721 lqngvtaadrvkkgfdfqwpqpdkpmffyvtqgqeeiassgtsylnrteaanvekittkl 781 lkagakpdqigiitpyegqrsylvqymqfsgslhtklyqeveiasvdafqgrekdfiils 841 cvranehqgigflndprrlnvaltrarygviivgnpkalskqplwnhllnyykeqkvlve 901 gplnnlreslmqfskprklvntinpgarfmttamydareaiipgsvydrssqgrpssmyf 961 qthdqigmisagpshvaamnipipfnlvmppmpppgyfgqangpaagrgtpkgktgrggr 1021 qknrfglpgpsqtnlpnsqasqdvasqpfsqgaltqgyismsqpsqmsqpglsqpelsqd 1081 sylgdefksqidvalsqdstyqgerayqhggvtglsqy UPF2nucleotidesequence(GenBankAccessionNo.AF318574.1) (nt76-3894) (SEQIDNO:3) 76 atgccagctgagcgtaaaaagccagcaagtatggaagaaaaagac 121 tctttaccaaacaacaaggaaaaagactgcagtgaaaggcggacagtgagcagcaaggag 181 aggccaaaagacgatatcaagctcactgccaagaaggaggtcagcaaggcccctgaagac 241 aagaagaagagactggaagatgataagagaaaaaaggaagacaaggaacgcaagaaaaaa 301 gacgaagaaaaggtgaaggcagaggaagaatcaaagaaaaaagaagaggaagaaaaaaag 361 aaacatcaagaggaagagagaaagaagcaagaagagcaggccaaacgtcagcaagaagaa 421 gaagcagctgctcagatgaaagaaaaagaagaatccattcagcttcatcaggaagcttgg 481 gaacgacatcatttaagaaaggaacttcgtagcaaaaaccaaaatgctccggacagccga 541 ccagaggaaaacttcttcagccgcctcgactcaagtttgaagaaaaatactgcttttgtc 601 aagaaactaaaaactattacagaacaacagagagactccttgtcccatgattttaatggc 661 ctaaatttaagcaaatacattgcagaagctgtagcttccatcgtggaagcaaaactaaaa 721 atctctgatgtgaactgtgctgtgcacctctgctctctctttcaccagcgttatgctgac 781 tttgccccatcacttcttcaggtctggaaaaaacattttgaagcaaggaaagaggagaaa 841 acacctaacatcaccaagttaagaactgatttgcgttttattgcagaattgacaatagtt 901 gggattttcactgacaaggaaggtctttccttaatctatgaacagctaaaaaatattatt 961 aatgctgatcgggagtcccacactcatgtctctgtagtgattagtttctgtcgacattgt 1021 ggagatgatattgctggacttgtaccaaggaaagtaaagagtgctgcagagaagtttaat 1081 ttgagttttcctcctagtgagataattagtccagagaaacaacagcccttccagaatctt 1141 ttaaaagagtactttacgtctttgaccaaacacctgaaaagggaccacagggagctccag 1201 aatactgagagacaaaacaggcgcattctacattctaaaggggagctcagtgaagataga 1261 cataaacagtatgaggaatttgctatgtcttaccagaagctgctggcaaattctcaatcc 1321 ttagcagaccttttggatgaaaatatgccagatcttcctcaagacaaacccacaccagaa 1381 gaacatgggcctggaattgatatattcacacctggtaaacctggagaatatgacttggaa 1441 ggtggtatatgggaagatgaagatgctcggaatttttatgagaacctcattgatttgaag 1501 gcttttgtcccagccatcttgtttaaagacaatgaaaaaagttgtcagaataaagagtcc 1561 aacaaagatgataccaaagaggcaaaagaatctaaggagaataaggaggtatcaagtccc 1621 gatgatttggaacttgagttggagaatctagaaattaatgatgacaccttagaattagag 1681 ggtggagatgaagctgaagatcttacaaagaaacttcttgatgaacaagaacaagaagat 1741 gaggaagccagcactggatctcatctcaagctcatagtagatgctttcctacagcagtta 1801 cccaactgtgtcaaccgagatctgatagacaaggcagcaatggatttttgcatgaacatg 1861 aacacaaaagcaaacaggaagaagttggtacgggcactcttcatagttcctagacaaagg 1921 ttggatttgctaccattttatgcaagattggttgctacattgcatccctgcatgtctgat 1981 gtagcagaggatctttgttccatgctgaggggggatttcagatttcatgtacggaaaaag 2041 gaccagatcaatattgaaacaaagaataaaactgttcgttttataggagaactaactaag 2101 tttaagatgttcaccaaaaatgacacactgcattgtttaaagatgcttctgtcagacttc 2161 tctcatcaccatattgaaatggcatgcaccctgctggagacatgtggacggtttcttttc 2221 agatctccagaatctcacctgaggaccagtgtacttttggagcaaatgatgagaaagaag 2281 caagcaatgcatcttgatgcgagatacgtcacaatggtagagaatgcatattactactgc 2341 aacccacctccagctgaaaaaaccgtgaaaaagaaacgtcctcctctccaggaatatgtc 2401 cggaaacttttgtacaaagatctctctaaggttaccaccgagaaggttttgagacagatg 2461 cgaaagctgccctggcaggaccaagaagtgaaagactatgttatttgttgtatgataaac 2521 atctggaatgtgaaatataatagtattcattgtgtagccaacctcttagcaggactagtg 2581 ctctaccaagaggatgttgggatccacgttgtggatggagtgttagaagatattcgatta 2641 ggaatggaggttaatcaacctaaatttaatcagaggcgcatcagcagtgccaagttctta 2701 ggagaactttacaattaccgaatggtggaatcagctgttattttcagaactctgtattct 2761 tttacctcatttggtgttaatcctgatggctctccaagttccctggacccacctgagcat 2821 cttttcagaattagactcgtatgcactattctggacacatgtggccagtactttgacaga 2881 ggttccagtaaacgaaaacttgattgtttccttgtatattttcagcgttatgtttggtgg 2941 aagaaaagtttggaggtttggacaaaagaccatccatttcctattgatatagattacatg 3001 atcagtgatacactagaactgctaagaccaaagatcaaactctgtaattctctggaagaa 3061 tccatcaggcaggtacaagacttggaacgagaattcttaataaaactaggcctagtaaat 3121 gacaaagactcaaaagattctatgacagaaggagaaaatcttgaagaggatgaagaagaa 3181 gaagaaggtggggctgaaacagaagaacaatctggaaatgaaagtgaagtaaatgagcca 3241 gaagaagaggagggttctgataatgatgatgatgagggagaagaagaggaggaagagaat 3301 acagattaccttacagattccaataaggaaaatgaaaccgatgaagagaatactgaggta 3361 atgattaaaggcggtggacttaagcatgtaccttgtgtagaagatgaggacttcattcaa 3421 gctctggataaaatgatgctagaaaatctacagcaacgaagtggtgaatctgttaaagtg 3481 caccaactagatgtggccattcctttgcatctcaaaagccagctgaggaaagggccccca 3541 ctgggaggtggggaaggagaggctgagtctgcagacacaatgccgtttgtcatgttaaca 3601 agaaaaggcaataaacagcagtttaagatccttaatgtacccatgtcctctcaacttgct 3661 gcaaatcactggaaccagcaacaggcagaacaagaagagaggatgagaatgaagaagctc 3721 acactagatatcaatgaacggcaagaacaagaagattatcaagaaatgttgcagtctctt 3781 gcacagcgcccagctccagcaaacaccaatcgtgagaggcggcctcgctaccaacatccg 3841 aagggagcacctaatgcagatctaatctttaagactggtgggaggagacgttga UPF2aminoacidsequence(GenBankAccessionNo.AAG60689.1) (SEQIDNO:4) 1 mpaerkkpasmeekdslpnnkekdcserrtvsskerpkddikltakkevskapedkkkrl 61 eddkrkkedkerkkkdeekvkaeeeskkkeeeekkkhqeeerkkqeeqakrqqeeeaaaq 121 mkekeesiqlhqeawerhhlrkelrsknqnapdsrpeenffsrldsslkkntafvkklkt 181 iteqqrdslshdfnglnlskyiaeavasiveaklkisdvncavhlcslfhqryadfapsl 241 lqvwkkhfearkeektpnitklrtdlrfiaeltivgiftdkeglsliyeqlkniinadre 301 shthvsvvisfcrhcgddiaglvprkvksaaekfnlsfppseiispekqqpfqnllkeyf 361 tsltkhlkrdhrelqnterqnrrilhskgelsedrhkqyeefamsyqkllansqsladll 421 denmpdlpqdkptpeehgpgidiftpgkpgeydleggiwededarnfyenlidlkafvpa 481 ilfkdnekscqnkesnkddtkeakeskenkevsspddlelelenleinddtleleggdea 541 edltkklldeqeqedeeastgshlklivdaflqqlpncvnrdlidkaamdfcmnmntkan 601 rkklvralfivprqrldllpfyarlvatlhpcmsdvaedlcsmlrgdfrfhvrkkdqini 661 etknktvrfigeltkfkmftkndtlhclkmllsdfshhhiemactlletcgrflfrspes 721 hlrtsvlleqmmrkkqamhldaryvtmvenayyycnpppaektvkkkrpplqeyvrklly 781 kdlskvttekvlrqmrklpwqdqevkdyviccminiwnvkynsihcvanllaglvlyqed 841 vgihvvdgvledirlgmevnqpkfnqrrissakflgelynyrmvesavifrtlysftsfg 901 vnpdgspssldppehlfrirlvctildtcgqyfdrgsskrkldcflvyfqryvwwkksle 961 vwtkdhpfpididymisdtlellrpkiklcnsleesirqvqdlerefliklglvndkdsk 1021 dsmtegenleedeeeeeggaeteeqsgnesevnepeeeegsdndddegeeeeeentdylt 1081 dsnkenetdeentevmikggglkhvpcvededfiqaldkmmlenlqqrsgesvkvhqldv 1141 aiplhlksqlrkgpplgggegeaesadtmpfvmltrkgnkqqfkilnvpmssqlaanhwn 1201 qqqaeqeermrmkkltldinerqeqedyqemlqslaqrpapantnrerrpryqhpkgapn 1261 adlifktggrrr UPF3nucleotidesequence(GenBankAccessionNo.AF318575_1) (nt22-1380) (SEQIDNO:5) 22 atgctgtcggccctagaagtgcagttccaccgcgactcg 61 cagcagcaggaggctgagacgccgccaacttcgtcctccggttgcgggggcggtgcgggc 121 aaacctcgcgaggagaagaggacggccctgagcaaggtggtcatccgccgcctgcctccg 181 ggcctcaccaaggagcagctggaggagcagctgcgcccgctgccagcacacgactacttc 241 gagttcttcgccgccgacctgagtctttatcctcatctctactcaagagcatacattaat 301 tttaggaatcctgatgacatccttctttttagagatcgttttgatggatatatcttcctt 361 gacagcaaaggcctagaatatcctgcagtggtagagtttgctccattccagaagatagcc 421 aaaaagaagctgagaaaaaaagatgccaagactggaagcatcgaagatgatccagaatat 481 aagaagtttttagaaacctactgtgtggaggaagagaagaccagtgccaaccctgagact 541 ctgctgggggagatggaggcgaagacaagagagctcattgctagaagaaccacacctctt 601 ttggaatatattaaaaatagaaaattagaaaagcagagaattcgagaagagaagcgagaa 661 gaacggaggaggagagagttagaaaagaaacgtttgcgggaagaggaaaaaagaagaaga 721 agagaagaagaaagatgcaaaaaaaaagagacagataaacagaagaaaattgcagagaaa 781 gaagtaaggattaagcttcttaagaaaccagaaaagggagaggaaccaaccacagagaaa 841 ccaaaagaaagaggagaggagattgatactggaggtggcaagcaggaatcctgtgccccc 901 ggtgcagtcgtaaaagccaggcccatggaaggctcgctggaggagccccaggagacgtca 961 cacagcggcagtgataaagagcacagggatgtggagagatctcaagaacaagaatctgaa 1021 gcacaaagataccatgtggatgacggcaggaggcacagagctcaccacgagcctgaacgg 1081 ctttccagaaggagtgaggatgagcagagatgggggaaaggacctggccaagacagaggg 1141 aagaaggggagccaggacagcggggctccgggggaggccatggagagactgggaagagcg 1201 caaaggtgtgacgacagtccagcacccagaaaagagcgactggcaaacaaggaccggcca 1261 gccttgcagctgtatgatccaggagctcgcttccgagcgcgagagtgtggcggaaacagg 1321 aggatctgcaaggcagaaggttcggggactggtcctgagaagagggaagaggcagagtga UPF3aminoacidsequence(GenBankAccessionNo.AAG60690.1) (SEQIDNO:6) 1 mlsalevqfhrdsqqqeaetpptsssgcgggagkpreekrtalskvvirrlppgltkeql 61 eeqlrplpahdyfeffaadlslyphlysrayinfrnpddillfrdrfdgyifldskgley 121 pavvefapfqkiakkklrkkdaktgsieddpeykkfletycveeektsanpetllgemea 181 ktreliarrttplleyiknrklekqrireekreerrrrelekkrlreeekrrrreeerck 241 kketdkqkkiaekevrikllkkpekgeepttekpkergeeidtgggkqescapgavvkar 301 pmegsleepqetshsgsdkehrdversqeqeseaqryhvddgrrhrahheperlsrrsed 361 eqrwgkgpgqdrgkkgsqdsgapgeamerlgraqrcddspaprkerlankdrpalqlydp 421 garfrarecggnrrickaegsgtgpekreeae SMG1nucleotidesequence(GenBankAccessionNo.NM_015092.4, nt364-11349) (SEQIDNO:7) 364 atgagccgcagagccccggggtctcggctgagcagcggcggcggcggcggcggcacc 421 aagtatccgcggagctggaatgactggcaacccagaactgatagtgcatcagccgaccca 481 gataatttaaaatattcttcatccagagatagaggtggttcttcctcttatggactgcaa 541 ccttcaaattcagctgtggtgtctcggcaaaggcacgatgataccagagtccacgctgac 601 atacagaatgacgaaaagggtggctacagtgtcaatggaggatctggggaaaatacttat 661 ggtcggaagtcgttggggcaagagctgagggttaacaatgtgaccagccctgagttcacc 721 agtgttcagcatggcagtcgtgctttagccaccaaagacatgaggaaatcacaggagaga 781 tcgatgtcttattctgatgagtctcgactgtcgaatcttcttcggaggatcacccgggaa 841 gacgacagagaccgaagattggctactgtaaagcagttgaaagaatttattcagcaacca 901 gaaaataagctggtactagttaaacaattggataatatcttggctgctgtacatgacgtg 961 cttaatgaaagtagcaaattgcttcaggagttgagacaggagggagcttgctgtcttggc 1021 cttctttgtgcttctctgagctatgaggctgagaagatcttcaagtggatttttagcaaa 1081 tttagctcatctgcaaaagatgaagttaaactcctctacttatgtgccacctacaaagca 1141 ctagagactgtaggagaaaagaaagccttttcatctgtaatgcagcttgtaatgaccagc 1201 ctgcagtctattcttgaaaatgtggatacaccagaattgctttgtaaatgtgttaagtgc 1261 attcttttggtggctcgatgttaccctcatattttcagcactaattttagggatacagtt 1321 gatatattagttggatggcatatagatcatactcagaaaccttcgctcacgcagcaggta 1381 tctgggtggttgcagagtttggagccattttgggtagctgatcttgcattttctactact 1441 cttcttggtcagtttctggaagacatggaagcatatgctgaggacctcagccatgtggcc 1501 tctggggaatcagtggatgaagatgtccctcctccatcagtgtcattaccaaagctggct 1561 gcacttctccgggtatttagtactgtggtgaggagcattggggaacgcttcagcccaatt 1621 cggggtcctccaattactgaggcatatgtaacagatgttctgtacagagtaatgagatgt 1681 gtgacggctgcaaaccaggtgtttttttctgaggctgtgttgacagctgctaatgagtgt 1741 gttggtgttttgctcggcagcttggatcctagcatgactatacattgtgacatggtcatt 1801 acatatggattagaccaactggagaattgccagacttgtggtaccgattatatcatctca 1861 gtcttgaatttactcacgctgattgttgaacagataaatacgaaactgccatcatcattt 1921 gtagaaaaactgtttataccatcatctaaactactattcttgcgttatcataaagaaaaa 1981 gaggttgttgctgtagcccatgctgtttatcaagcagtgctcagcttgaagaatattcct 2041 gttttggagactgcctataagttaatattgggagaaatgacttgtgccctaaacaacctc 2101 ctacacagtctacaacttcctgaggcctgttctgaaataaaacatgaggcttttaagaat 2161 catgtgttcaatgtagacaatgcaaaatttgtagttatatttgacctcagtgccctgact 2221 acaattggaaatgccaaaaactcactaatagggatgtgggcgctatctccaactgtcttt 2281 gcacttctgagtaagaatctgatgattgtgcacagtgacctggctgttcacttccctgcc 2341 attcagtatgctgtgctctacacattgtattctcattgtaccaggcatgatcactttatc 2401 tctagtagcctcagttcttcctctccttctttgtttgatggagctgtgattagcactgta 2461 actacggctacaaagaaacatttctcaattatattaaatcttctgggaatattacttaag 2521 aaagataaccttaaccaggacacgaggaaactgttaatgacttgggctttggaagcagct 2581 gttttaatgaagaagtctgaaacatacgcacctttattctctcttccgtctttccataaa 2641 ttttgcaaaggccttttagccaacactctcgttgaagatgtgaatatctgtctgcaggca 2701 tgcagcagtctacatgctctgtcctcttccttgccagatgatcttttacagagatgtgtc 2761 gatgtttgccgtgttcaactagtgcacagtggaactcgtattcgacaagcatttggaaaa 2821 ctgttgaaatcaattcctttagatgttgtcctaagcaataacaatcacacagaaattcaa 2881 gaaatttctttagcattaagaagtcacatgagtaaagcaccaagtaatacattccacccc 2941 caagatttctctgatgttattagttttattttgtatgggaactctcatagaacagggaag 3001 gacaattggttggaaagactgttctatagctgccagagactggataagcgtgaccagtca 3061 acaattccacgcaatctcctgaagacagatgctgtcctttggcagtgggccatatgggaa 3121 gctgcacaattcactgttctttctaagctgagaaccccactgggcagagctcaagacacc 3181 ttccagacaattgaaggtatcattcgaagtctcgcagctcacacattaaaccctgatcag 3241 gatgttagtcagtggacaactgcagacaatgatgaaggccatggtaacaaccaacttaga 3301 cttgttcttcttctgcagtatctggaaaatctggagaaattaatgtataatgcatacgag 3361 ggatgtgctaatgcattaacttcacctcccaaggtcattagaacttttttctataccaat 3421 cgccaaacttgtcaggactggctaacgcggattcgactctccatcatgagggtaggattg 3481 ttggcaggccagcctgcagtgacagtgagacatggctttgacttgcttacagagatgaaa 3541 acaaccagcctatctcaggggaatgaattggaagtaaccattatgatggtggtagaagca 3601 ttatgtgaacttcattgtcctgaagctatacagggaattgctgtctggtcatcatctatt 3661 gttggaaaaaatcttctgtggattaactcagtggctcaacaggctgaagggaggtttgaa 3721 aaggcctctgtggagtaccaggaacacctgtgtgccatgacaggtgttgattgctgcatc 3781 tccagctttgacaaatcggtgctcaccttagccaatgctgggcgtaacagtgccagcccg 3841 aaacattctctgaatggtgaatccagaaaaactgtgctgtccaaaccgactgactcttcc 3901 cctgaggttataaattatttaggaaataaagcatgtgagtgctacatctcaattgccgat 3961 tgggctgctgtgcaggaatggcagaacgctatccatgacttgaaaaagagtaccagtagc 4021 acttccctcaacctgaaagctgacttcaactatataaaatcattaagcagctttgagtct 4081 ggaaaatttgttgaatgtaccgagcagttagaattgttaccaggagaaaatatcaatcta 4141 cttgctggaggatcaaaagaaaaaatagacatgaaaaaactgcttcctaacatgttaagt 4201 ccggatccgagggaacttcagaaatccattgaagttcaattgttaagaagttctgtttgt 4261 ttggcaactgctttaaacccgatagaacaagatcagaagtggcagtctataactgaaaat 4321 gtggtaaagtacttgaagcaaacatcccgcatcgctattggacctctgagactttctact 4381 ttaacagtttcacagtctttgccagttctaagtaccttgcagctgtattgctcatctgct 4441 ttggagaacacagtttctaacagactttcaacagaggactgtcttattccactcttcagt 4501 gaagctttacgttcatgtaaacagcatgacgtgaggccatggatgcaggcattaaggtat 4561 actatgtaccagaatcagttgttggagaaaattaaagaacaaacagtcccaattagaagc 4621 catctcatggaattaggtctaacagcagcaaaatttgctagaaaacgagggaatgtgtcc 4681 cttgcaacaagactgctggcacagtgcagtgaagttcagctgggaaagaccaccactgca 4741 caggatttagtccaacattttaaaaaactatcaacccaaggtcaagtggatgaaaaatgg 4801 gggcccgaacttgatattgaaaaaaccaaattgctttatacagcaggccagtcaacacat 4861 gcaatggaaatgttgagttcttgtgccatatctttctgcaagtctgtgaaagctgaatat 4921 gcagttgctaaatcaattctgacactggctaaatggatccaggcagaatggaaagagatt 4981 tcaggacagctgaaacaggtttacagagctcagcaccaacagaacttcacaggtctttct 5041 actttgtctaaaaacatactcactctaatagaactgccatctgttaatacgatggaagaa 5101 gagtatcctcggatcgagagtgaatctacagtgcatattggagttggagaacctgacttc 5161 attttgggacagttgtatcacctgtcttcagtacaggcacctgaagtagccaaatcttgg 5221 gcagcgttggccagctgggcttataggtggggcagaaaggtggttgacaatgccagtcag 5281 ggagaaggtgttcgtctgctgcctagagaaaaatctgaagttcagaatctacttccagac 5341 actataactgaggaagagaaagagagaatatatggtattcttggacaggctgtgtgtcgg 5401 ccggcggggattcaggatgaagatataacacttcagataactgagagtgaagacaacgaa 5461 gaagatgacatggttgatgttatctggcgtcagttgatatcaagctgcccatggctttca 5521 gaacttgatgaaagtgcaactgaaggagttattaaagtgtggaggaaagttgtagataga 5581 atattcagcctgtacaaactctcttgcagtgcatactttactttccttaaactcaacgct 5641 ggtcaaattcctttagatgaggatgaccctaggctgcatttaagtcacagagtggaacag 5701 agcactgatgacatgattgtgatggccacattgcgcctgctgcggttgctcgtgaagcat 5761 gctggtgagcttcggcagtatctggagcacggcttggagacaacacccactgcaccatgg 5821 agaggaattattccgcaacttttctcacgcttaaaccaccctgaagtgtatgtgcgccaa 5881 agtatttgtaaccttctctgccgtgtggctcaagattccccacatctcatattgtatcct 5941 gcaatagtgggtaccatatcgcttagtagtgaatcccaggcttcaggaaataaattttcc 6001 actgcaattccaactttacttggcaatattcaaggagaagaattgctggtttctgaatgt 6061 gagggaggaagtcctcctgcatctcaggatagcaataaggatgaacctaaaagtggatta 6121 aatgaagaccaagccatgatgcaggattgttacagcaaaattgtagataagctgtcctct 6181 gcaaaccccaccatggtattacaggttcagatgctcgtggctgaactgcgcagggtcact 6241 gtgctctgggatgagctctggctgggagttttgctgcaacaacacatgtatgtcctgaga 6301 cgaattcagcagcttgaagatgaggtgaagagagtccagaacaacaacaccttacgcaaa 6361 gaagagaaaattgcaatcatgagggagaagcacacagctttgatgaagcccatcgtattt 6421 gctttggagcatgtgaggagtatcacagcggctcctgcagaaacacctcatgaaaaatgg 6481 tttcaggataactatggtgatgccattgaaaatgccctagaaaaactgaagactccattg 6541 aaccctgcaaagcctgggagcagctggattccatttaaagagataatgctaagtttgcaa 6601 cagagagcacagaaacgtgcaagttacatcttgcgtcttgaagaaatcagtccatggttg 6661 gctgccatgactaacactgaaattgctcttcctggggaagtctcagccagagacactgtc 6721 acaatccatagtgtgggcggaaccatcacaatcttaccgactaaaaccaagccaaagaaa 6781 cttctctttcttggatcagatgggaagagctatccttatcttttcaaaggactggaggat 6841 ttacatctggatgagagaataatgcagttcctatctattgtgaataccatgtttgctaca 6901 attaatcgccaagaaacaccccggttccatgctcgacactattctgtaacaccactagga 6961 acaagatcaggactaatccagtgggtagatggagccacacccttatttggtctttacaaa 7021 cgatggcaacaacgggaagctgccttacaagcacaaaaggcccaagattcctaccaaact 7081 cctcagaatcctggaattgtaccccgtcctagtgaactttattacagtaaaattggccct 7141 gctttgaaaacagttgggcttagcctggatgtgtcccgtcgggattggcctcttcatgta 7201 atgaaggcagtattggaagagttaatggaggccacacccccgaatctccttgccaaagag 7261 ctctggtcatcttgcacaacacctgatgaatggtggagagttacgcagtcttatgcaaga 7321 tctactgcagtcatgtctatggttggatacataattggccttggagacagacatctggat 7381 aatgttcttatagatatgacgactggagaagttgttcacatagattacaatgtttgcttt 7441 gaaaaaggtaaaagccttagagttcctgagaaagtaccttttcgaatgacacaaaacatt 7501 gaaacagcactgggtgtaactggagtagaaggtgtatttaggctttcatgtgagcaggtt 7561 ttacacattatgcggcgtggcagagagaccctgctgacgctgctggaggcctttgtgtac 7621 gaccctctggtggactggacagcaggaggcgaggctgggtttgctggtgctgtctatggt 7681 ggaggtggccagcaggccgagagcaagcagagcaagagagagatggagcgagagatcacc 7741 cgcagcctgttttcttctagagtagctgagattaaggtgaactggtttaagaatagagat 7801 gagatgctggttgtgcttcccaagttggacggtagcttagatgaatacctaagcttgcaa 7861 gagcaactgacagatgtggaaaaactgcagggcaaactactggaggaaatagagtttcta 7921 gaaggagctgaaggggtggatcatccttctcatactctgcaacacaggtattctgagcac 7981 acccaactacagactcagcaaagagctgttcaggaagcaatccaggtgaagctgaatgaa 8041 tttgaacaatggataacacattatcaggctgcattcaataatttagaagcaacacagctt 8101 gcaagcttgcttcaagagataagcacacaaatggaccttggtcctccaagttacgtgcca 8161 gcaacagcctttctgcagaatgctggtcaggcccacttgattagccagtgcgagcagctg 8221 gagggggaggttggtgctctcctgcagcagaggcgctccgtgctccgtggctgtctggag 8281 caactgcatcactatgcaaccgtggccctgcagtatccgaaggccatatttcagaaacat 8341 cgaattgaacagtggaagacctggatggaagagctcatctgtaacaccacagtagagcgt 8401 tgtcaagagctctataggaaatatgaaatgcaatatgctccccagccacccccaacagtg 8461 tgtcagttcatcactgccactgaaatgaccctgcagcgatacgcagcagacatcaacagc 8521 agacttattagacaagtggaacgcttgaaacaggaagctgtcactgtgccagtttgtgaa 8581 gatcagttgaaagaaattgaacgttgcattaaagttttccttcatgagaatggagaagaa 8641 ggatctttgagtctagcaagtgttattatttctgccctttgtacccttacaaggcgtaac 8701 ctgatgatggaaggtgcagcgtcaagtgctggagaacagctggttgatctgacttctcgg 8761 gatggagcctggttcttggaggaactctgcagtatgagcggaaacgtcacctgcttggtt 8821 cagttactgaagcagtgccacctggtgccacaggacttagatatcccgaaccccatggaa 8881 gcgtctgagacagttcacttagccaatggagtgtatacctcacttcaggaattgaattcg 8941 aatttccggcaaatcatatttccagaagcacttcgatgtttaatgaaaggggaatacacg 9001 ttagaaagtatgctgcatgaactggacggtcttattgagcagaccaccgatggcgttccc 9061 ctgcagactctagtggaatctcttcaggcctacttaagaaacgcagctatgggactggaa 9121 gaagaaacacatgctcattacatcgatgttgccagactactacatgctcagtacggtgaa 9181 ttaatccaaccgagaaatggttcagttgatgaaacacccaaaatgtcagctggccagatg 9241 cttttggtagcattcgatggcatgtttgctcaagttgaaactgctttcagcttattagtt 9301 gaaaagttgaacaagatggaaattcccatagcttggcgaaagattgacatcataagggaa 9361 gccaggagtactcaagttaatttttttgatgatgataatcaccggcaggtgctagaagag 9421 attttctttctaaaaagactacagactattaaggagttcttcaggctctgtggtaccttt 9481 tctaaaacattgtcaggatcaagttcacttgaagatcagaatactgtgaatgggcctgta 9541 cagattgtcaatgtgaaaaccctttttagaaactcttgtttcagtgaagaccaaatggcc 9601 aaacctatcaaggcattcacagctgactttgtgaggcagctcttgatagggctacccaac 9661 caagccctcggactcacactgtgcagttttatcagtgctctgggtgtagacatcattgct 9721 caagtagaggcaaaggactttggtgccgaaagcaaagtttctgttgatgatctctgtaag 9781 aaagcggtggaacataacatccagatagggaagttctctcagctggttatgaacagggca 9841 actgtgttagcaagttcttacgacactgcctggaagaagcatgacttggtgcgaaggcta 9901 gaaaccagtatttcttcttgtaagacaagcctgcagcgggttcagctgcatattgccatg 9961 tttcagtggcaacatgaagatctacttatcaatagaccacaagccatgtcagtcacacct 10021 cccccacggtctgctatcctaaccagcatgaaaaagaagctgcataccctgagccagatt 10081 gaaacttctattgcaacagttcaggagaagctagctgcacttgaatcaagtattgaacag 10141 cgactcaagtgggcaggtggtgccaaccctgcattggcccctgtactacaagattttgaa 10201 gcaacgatagctgaaagaagaaatcttgtccttaaagagagccaaagagcaagtcaggtc 10261 acatttctctgcagcaatatcattcattttgaaagtttacgaacaagaactgcagaagcc 10321 ttaaacctggatgcggcgttatttgaactaatcaagcgatgtcagcagatgtgttcgttt 10381 gcatcacagtttaacagttcagtgtctgagttagagcttcgtttattacagagagtggac 10441 actggtcttgaacatcctattggcagctctgaatggcttttgtcagcacacaaacagttg 10501 acccaggatatgtctactcagagggcaattcagacagagaaagagcagcagatagaaacg 10561 gtctgtgaaacaattcagaatctggttgataatataaagactgtgctcactggtcataac 10621 cgacagcttggagatgtcaaacatctcttgaaagctatggctaaggatgaagaagctgct 10681 ctggcagatggtgaagatgttccctatgagaacagtgttaggcagtttttgggtgaatat 10741 aaatcatggcaagacaacattcaaacagttctatttacattagtccaggctatgggtcag 10801 gttcgaagtcaagaacacgttgaaatgctccaggaaatcactcccaccttgaaagaactg 10861 aaaacacaaagtcagagtatctataataatttagtgagttttgcatcacccttagtcacc 10921 gatgcaacaaatgaatgttcgagtccaacgtcatctgctacttatcagccatccttcgct 10981 gcagcagtccggagtaacactggccagaagactcagcctgatgtcatgtcacagaatgct 11041 agaaagctgatccagaaaaatcttgctacatcagctgatactccaccaagcaccgttcca 11101 ggaactggcaagagtgttgcttgtagtcctaaaaaggcagtcagagaccctaaaactggg 11161 aaagcggtgcaagagagaaactcctatgcagtgagtgtgtggaagagagtgaaagccaag 11221 ttagagggccgagatgttgatccgaataggaggatgtcagttgctgaacaggttgactat 11281 gtcattaaggaagcaactaatctagataacttggctcagctgtatgaaggttggacagcc 11341 tgggtgtga SMG1aminoacidsequence(GenBankAccessionNo.NP_055907.3) (SEQIDNO:8) 1 msrrapgsrlssggggggtkyprswndwqprtdsasadpdnlkysssrdrggsssyglqp 61 snsavvsrqrhddtrvhadiqndekggysvnggsgentygrkslgqelrvnnvtspefts 121 vqhgsralatkdmrksqersmsysdesrlsnllrritreddrdrrlatvkqlkefiqqpe 181 nklvlvkqldnilaavhdvlnesskllqelrqegacclgllcaslsyeaekifkwifskf 241 sssakdevkllylcatykaletvgekkafssvmqlvmtslqsilenvdtpellckcvkci 301 llvarcyphifstnfrdtvdilvgwhidhtqkpsltqqvsgwlqslepfwvadlafsttl 361 lgqfledmeayaedlshvasgesvdedvpppsvslpklaallrvfstvvrsigerfspir 421 gppiteayvtdvlyrvmrcvtaanqvffseavltaanecvgvllgsldpsmtihcdmvit 481 ygldqlencqtcgtdyiisvlnlltliveqintklpssfveklfipsskllflryhkeke 541 vvavahavyqavlslknipvletayklilgemtcalnnllhslqlpeacseikheafknh 601 vfnvdnakfvvifdlsalttignaknsligmwalsptvfallsknlmivhsdlavhfpai 661 qyavlytlyshctrhdhfissslsssspslfdgavistvttatkkhfsiilnllgillkk 721 dnlnqdtrkllmtwaleaavlmkksetyaplfslpsfhkfckgllantlvedvniclqac 781 sslhalssslpddllqrcvdvcrvqlvhsgtrirqafgkllksipldvvlsnnnhteiqe 841 islalrshmskapsntfhpqdfsdvisfilygnshrtgkdnwlerlfyscqrldkrdqst 901 iprnllktdavlwqwaiweaaqftvlsklrtplgraqdtfqtiegiirslaahtlnpdqd 961 vsqwttadndeghgnnqlrlvlllgylenleklmynayegcanaltsppkvirtffytnr 1021 qtcqdwltrirlsimrvgllagqpavtvrhgfdlltemkttslsqgnelevtimmvveal 1081 celhcpeaiqgiavwsssivgknllwinsvaqqaegrfekasveyqehlcamtgvdccis 1141 sfdksvltlanagrnsaspkhslngesrktvlskptdsspevinylgnkacecyisiadw 1201 aavqewqnaihdlkkstsstslnlkadfnyikslssfesgkfvecteqlellpgeninll 1261 aggskekidmkkllpnmlspdprelqksievqllrssvclatalnpieqdqkwqsitenv 1321 vkylkqtsriaigplrlstltvsqslpvlstlqlycssalentvsnrlstedcliplfse 1381 alrsckqhdvrpwmqalrytmyqnqllekikeqtvpirshlmelgltaakfarkrgnvsl 1441 atrllaqcsevqlgktttaqdlvqhfkklstqgqvdekwgpeldiektkllytagqstha 1501 memlsscaisfcksvkaeyavaksiltlakwiqaewkeisgqlkqvyraqhqqnftglst 1561 lskniltlielpsvntmeeeypriesestvhigvgepdfilgqlyhlssvqapevakswa 1621 alaswayrwgrkvvdnasqgegvrllpreksevqnllpdtiteeekeriygilgqavcrp 1681 agiqdeditlqitesedneeddmvdviwrqlisscpwlseldesategvikvwrkvvdri 1741 fslyklscsayftflklnagqipldeddprlhlshrveqstddmivmatlrllrllvkha 1801 gelrqylehglettptapwrgiipqlfsrlnhpevyvrqsicnllcrvaqdsphlilypa 1861 ivgtislssesqasgnkfstaiptllgniqgeellvseceggsppasqdsnkdepksgln 1921 edqammqdcyskivdklssanptmvlqvqmlvaelrrvtvlwdelwlgvllqqhmyvlrr 1981 iqqledevkrvqnnntlrkeekiaimrekhtalmkpivfalehvrsitaapaetphekwf 2041 qdnygdaienaleklktplnpakpgsswipfkeimlslqqraqkrasyilrleeispwla 2101 amtnteialpgevsardtvtihsvggtitilptktkpkkllflgsdgksypylfkgledl 2161 hlderimqflsivntmfatinrqetprfharhysvtplgtrsgliqwvdgatplfglykr 2221 wqqreaalqaqkaqdsyqtpqnpgivprpselyyskigpalktvglsldvsrrdwplhvm 2281 kavleelmeatppnllakelwsscttpdewwrvtqsyarstavmsmvgyiiglgdrhldn 2341 vlidmttgevvhidynvcfekgkslrvpekvpfrmtqnietalgvtgvegvfrlsceqvl 2401 himrrgretlltlleafvydplvdwtaggeagfagavyggggqqaeskqskremereitr 2461 slfssrvaeikvnwfknrdemlvvlpkldgsldeylslqeqltdveklqgklleeiefle 2521 gaegvdhpshtlqhrysehtqlqtqqravqeaiqvklnefeqwithyqaafnnleatqla 2581 sllqeistqmdlgppsyvpataflqnagqahlisqceqlegevgallqqrrsvlrgcleq 2641 lhhyatvalqypkaifqkhrieqwktwmeelicnttvercqelyrkyemqyapqppptvc 2701 qfitatemtlqryaadinsrlirgverlkqeavtvpvcedqlkeiercikvflhengeeg 2761 slslasviisalctltrrnlmmegaassageqlvdltsrdgawfleelcsmsgnvtclvq 2821 llkqchlvpqdldipnpmeasetvhlangvytslqelnsnfrqiifpealrclmkgeytl 2881 esmlheldglieqttdgvplqtlveslqaylrnaamgleeethahyidvarllhaqygel 2941 iqprngsvdetpkmsagqmllvafdgmfaqvetafsllveklnkmeipiawrkidiirea 3001 rstqvnffdddnhrqvleeifflkrlqtikeffrlcgtfsktlsgsssledqntvngpvq 3061 ivnvktlfrnscfsedqmakpikaftadfvrqlliglpnqalglticsfisalgvdiiaq 3121 veakdfgaeskvsvddlckkavehniqigkfsqlvmnratvlassydtawkkhdlvrrle 3181 tsisscktslgrvqlhiamfqwqhedllinrpqamsvtppprsailtsmkkklhtlsqie 3241 tsiatvqeklaalessieqrlkwagganpalapvlqdfeatiaerrnlvlkesqrasqvt 3301 flcsniihfeslrtrtaealnldaalfelikrcqqmcsfasqfnssyselelrllqrvdt 3361 glehpigssewllsahkqltgdmstqraiqtekeqqietvcetiqnlvdniktvltghnr 3421 qlgdvkhllkamakdeeaaladgedvpyensvrqflgeykswqdniqtvlftlvqamgqv 3481 rsqehvemlqeitptlkelktqsqsiynnlvsfasplvtdatnecssptssatyqpsfaa 3541 avrsntgqktqpdvmsqnarkliqknlatsadtppstvpgtgksvacspkkavrdpktgk 3601 avqernsyavsvwkrvkaklegrdvdpnrrmsvaeqvdyvikeatnldnlaqlyegwtaw 3661 v SMG5nucleotidesequence(GenBankAccessionNo.NM_015327.2, nt150-3200) (SEQIDNO:9) 150 atgagccaaggcccccccacaggggagagca 181 gcgagcccgaagcaaaagtcctccacactaagcggctttaccgggctgtggtggaggctg 241 tgcatcgacttgacctcatcctttgcaacaaaactgcttatcaagaagtattcaaaccag 301 aaaacattagcctgaggaacaagctgcgtgagctctgcgtcaagcttatgttcctgcacc 361 cagtggactatgggagaaaggctgaggagctgctgtggagaaaggtatactatgaagtta 421 tccagcttatcaagactaacaaaaagcacatccacagccggagcactttggaatgtgcct 481 acaggacgcacctggttgctggtattggcttctaccagcatctccttctctatatccagt 541 cccactaccagctggaactgcagtgctgcatcgactggacccatgtcactgaccccctca 601 taggatgcaagaagccagtgtctgcctcagggaaggagatggattgggcacagatggcat 661 gtcaccgatgtctggtgtatctgggggatttgtcccgatatcagaatgaattagctggcg 721 tagataccgagctgctagccgagagattttactaccaagccctgtcagtagctcctcaga 781 ttggaatgcccttcaatcagctgggcaccctggcaggcagcaagtactataatgtggaag 841 ccatgtattgctacctgcgctgcatccagtcagaagtgtcctttgagggagcctatggga 901 acctcaagcggctgtatgacaaggcagccaaaatgtaccaccaactgaagaagtgtgaga 961 ctcggaaactgtctcctggcaaaaagcgatgtaaagacattaaaaggttgctagtgaact 1021 ttatgtatctgcaaagcctcctacagcccaaaagcagctccgtggactcagagctgacct 1081 cactttgccagtcagtcctggaggacttcaacctctgcctcttctacctgccctcctcac 1141 ccaacctcagcctggccagtgaggatgaggaggagtatgagagtggatatgctttcctcc 1201 cggaccttctcatctttcaaatggtcatcatctgccttatgtgtgtgcacagcttggaga 1261 gagcaggatccaagcagtacagtgcagccattgccttcaccctggccctcttttcccacc 1321 tcgtcaatcatgtcaacatacggctgcaggctgagctggaagagggcgagaatcccgtcc 1381 cggcattccagagtgatggcacagatgaaccagagtccaaggaacctgtggagaaagagg 1441 aggagccagatcctgagcctcctcctgtaacaccccaagtgggtgagggcagaaagagcc 1501 gtaagttctctcgcctctcctgtctccgccgtcgccgccacccacccaaagttggtgatg 1561 acagtgacctgagtgaaggctttgaatcggactcaagccatgactcagcccgggccagtg 1621 agggctcagacagtggctctgacaagagtcttgaaggtgggggaacggcctttgatgctg 1681 aaacagactcggaaatgaatagccaggagtcccgatcagacttggaagatatggaggaag 1741 aggaggggacacggtcaccaaccctggagccccctcggggcagatcagaggctcccgatt 1801 ccctcaatggcccactgggccccagtgaggctagcattgccagcaatctacaagccatgt 1861 ccacccagatgttccagactaagcgctgcttccgactggcccccacctttagcaacctgc 1921 tcctccagcccaccaccaaccctcatacctcggccagccacaggccttgcgtcaatgggg 1981 atgtagacaagccttcagagccagcctctgaggagggctctgagtcggaggggagtgagt 2041 ccagtggacgctcctgtcggaatgagcgcagcatccaggagaagcttcaggtcctgatgg 2101 ccgaaggtctgcttcctgctgtgaaagtcttcctggactggcttcggaccaaccccgacc 2161 tcatcatcgtgtgtgcgcagagctctcaaagtctgtggaaccgcctgtctgtgttgctga 2221 atctgttgcctgctgctggtgaactccaggagtctggcctggccttgtgtcctgaggtcc 2281 aagatcttcttgaaggttgtgaactgcctgacctcccctctagccttctgctcccagagg 2341 acatggctcttcgtaacctgcccccgctccgagctgcccacagacgctttaactttgaca 2401 cggatcggcccctgctcagcaccttagaggagtcagtggtgcgcatctgctgcatccgca 2461 gctttggtcatttcatcgcccgcctgcaaggcagcatcctgcagttcaacccagaggttg 2521 gcatcttcgtcagcattgcccagtctgagcaggagagcctgctgcagcaggcccaggcac 2581 agttccgaatggcacaggaggaagctcgtcggaacaggctcatgagagacatggctcagc 2641 tacgacttcagctcgaagtgtctcagctggagggcagcctgcagcagcccaaggcccagt 2701 cagccatgtctccctacctcgtccctgacacccaggccctctgccaccatctccctgtca 2761 tccgccaactggccaccagtggccgcttcattgtcatcatcccaaggacagtgatcgatg 2821 gcctggatttgctgaagaaggaacacccaggggcccgggatgggattcggtacctggagg 2881 cagagtttaaaaaaggaaacaggtacattcgctgccagaaagaggtgggaaagagctttg 2941 agcggcataagctgaagaggcaggatgcagatgcctggactctctataagatcctagaca 3001 gctgcaaacagctgactctggcccagggggcaggtgaggaggatccgagtggcatggtga 3061 ccatcatcacaggccttccactggacaaccccagcgtgctttcaggccccatgcaggcag 3121 ccctgcaggccgctgcccacgccagtgtggacatcaagaatgttctggacttctacaagc 3181 agtggaaggaaattggttga SMG5aminoacidsequence(GenBankAccessionNo.NP_056142.2) (SEQIDNO:10) 1 msqgpptgessepeakvlhtkrlyravveavhrldlilcnktayqevfkpenislrnklr 61 elcvklmflhpvdygrkaeellwrkvyyeviqliktnkkhihsrstlecayrthlvagig 121 fyqhlllyiqshyqlelqccidwthvtdpligckkpvsasgkemdwaqmachrclvylgd 181 lsryqnelagvdtellaerfyyqalsvapqigmpfnqlgtlagskyynveamycylrciq 241 sevsfegaygnlkrlydkaakmyhqlkkcetrklspgkkrckdikrllvnfmylqsllqp 301 ksssvdseltslcqsvledfnlclfylpsspnlslasedeeeyesgyaflpdllifqmvi 361 iclmcvhsleragskqysaaiaftlalfshlvnhvnirlqaeleegenpvpafqsdgtde 421 peskepvekeeepdpepppvtpqvgegrksrkfsrlsclrrrrhppkvgddsdlsegfes 481 dsshdsarasegsdsgsdkslegggtafdaetdsemnsqesrsdledmeeeegtrsptle 541 pprgrseapdslngplgpseasiasnlqamstqmfqtkrcfrlaptfsnlllqpttnpht 601 sashrpcvngdvdkpsepaseegsesegsessgrscrnersiqeklqvlmaegllpavkv 661 fldwlrtnpdliivcaqssqslwnrlsvllnllpaagelqesglalcpevqdllegcelp 721 dlpsslllpedmalrnlpplraahrrfnfdtdrpllstleesvvriccirsfghfiarlq 781 gsilqfnpevgifvsiaqseqesllqqaqaqfrmaqeearrnrlmrdmaqlrlqlevsql 841 egslqqpkaqsamspylvpdtqalchhlpvirqlatsgrfiviiprtvidgldllkkehp 901 gardgiryleaefkkgnryircqkevgksferhklkrqdadawtlykildsckqltlaqg 961 ageedpsgmvtiitglpldnpsvlsgpmqaalqaaahasvdiknvldfykqwkeig SMG6nucleotidesequence(GenBankAccessionNo.BC064916.1, nt296-1831) (SEQIDNO:11) 296 atgga 301 gacattccctgcagtggctgagaaggtcctcaaggagttccaggtgttactgcagcacag 361 cccctctcccattggaagtacccgcatgctgcagcttatgaccatcaatatgtttgcagt 421 acacaactcccagctgaaagactgcttctcggaggagtgccgctctgtgatccaggaaca 481 agccgcagctctgggcttggccatgttttctctactggtccgccgctgcacctgcttact 541 taaggagtccgccaaagctcagctgtcctctcctgaggaccaggatgaccaagacgacat 601 caaggtgtcttcctttgtcccggacctgaaggagctgctccccagtgtcaaagtctggtc 661 agattggatgctcggctacccggacacctggaatcctcctcccacatccctggatctgcc 721 ctcgcatgttgctgtggatgtatggtcgacgctggctgatttctgtaacatactgactgc 781 agtgaatcagtctgaggtgccactgtacaaggacccggatgatgacctcacccttcttat 841 cctggaagaggatcggcttctctcgggctttgtccccttgctggctgcccctcaggaccc 901 ctgctacgtggagaaaacctcggataaggttattgcagctgactgcaaaagggtcacagt 961 gctgaagtattttctggaagccctttgtggacaagaagagcctctgctggcattcaaggg 1021 tggaaagtatgtgtcagtggcacccgtcccagacaccatgggaaaggaaatgggaagcca 1081 agagggaacacgactggaagatgaggaggaggatgtggtgattgaagactttgaggaaga 1141 ttcagaggctgaaggcagcggaggcgaggatgacatcagggagcttcgggccaagaagct 1201 ggctctggccaggaagatagctgagcagcagcgtcgccaggaaaagatccaggctgtcct 1261 ggaggaccacagtcagatgaggcagatggagctcgaaatcagacctttgttcctcgtacc 1321 agacaccaacggcttcattgaccacctggccagtctggcgcggctgctggagagcaggaa 1381 gtacatcctggtggtgcccctcatcgtgatcaatgagctggacggcctggccaaggggca 1441 ggagacagaccaccgggctgggggctacgcccgtgtggtacaagagaaggcccgcaagtc 1501 catcgagttcctcgagcagcgattcgagagtcgggactcttgcctgcgagccctgaccag 1561 ccgtggcaatgaactcgaatccatcgccttccgcagtgaggacatcactggccagctggg 1621 taacaacgatgatctcatcctgtcctgctgcctccactactgcaaagacaaggctaagga 1681 cttcatgcccgccagcaaagaggagccaatccggctactgcgggaggtggtgctgttgac 1741 ggatgaccggaacctgcgtgtgaaggcgctcacaaggaatgttcctgtacgggacatccc 1801 agccttcctcacgtgggcccaggtgggctga SMG6aminoacidsequence(GenBankAccessionNo.AAH64916.1) (SEQIDNO:12) 1 metfpavaekvlkefqvllqhspspigstrmlqlmtinmfavhnsqlkdcfseecrsviq 61 eqaaalglamfsllvrrctcllkesakaqlsspedqddqddikvssfvpdlkellpsvkv 121 wsdwmlgypdtwnppptsldlpshvavdvwstladfcniltavnqsevplykdpdddltl 181 lileedrllsgfvpllaapqdpcyvektsdkviaadckrvtvlkyflealcgqeepllaf 241 kggkyvsvapvpdtmgkemgsqegtrledeeedvviedfeedseaegsggeddirelrak 301 klalarkiaeqqrrqekiqavledhsqmrqmeleirplflvpdtngfidhlaslarlles 361 rkyilvvplivineldglakgqetdhraggyarvvqekarksiefleqrfesrdsclral 421 tsrgnelesiafrseditgqlgnnddlilscclhyckdkakdfmpaskeepirllrevvl 481 ltddrnlrvkaltrnvpvrdipafltwaqvg SMG7nucleotidesequence(GenBankAccessionNo.BC036381.1, nt119-3655) (SEQIDNO:13) 119 at 121 gagcctgcagagcgcgcagtacctccggcaggcagaagtcctgaaggctgacatgacaga 181 ttctaagctgggtccagctgaagtctggacatccaggcaggctctgcaggacctgtacca 241 gaaaatgctagttaccgatttggaatacgctttagacaagaaagtagaacaggatctctg 301 gaatcacgcctttaagaatcagatcacaacactacaaggccaggcaaagaatcgagcaaa 361 tccgaatcggagtgaagttcaggcaaacctttctctgttcctagaggcagctagtggctt 421 ctatactcagttattacaagaactgtgtacagtatttaatgtagatttaccatgccgtgt 481 gaagtcttcccaattgggaattatcagcaataaacagacgcataccagcgccatagtgaa 541 gccacagtctagctcctgttcctatatctgccagcactgcctcgtccaccttggagacat 601 tgctcgatacagaaaccagaccagccaggcagagtcctactataggcatgcagctcagct 661 tgtcccctccaatggtcagccttataatcagttggctatcttagcttcttccaaaggaga 721 ccatctgaccacaattttctactactgcagaagcattgctgtgaagttccctttcccagc 781 tgcctccactaatctgcaaaaagcactttctaaagcactggaaagccgagatgaggtgaa 841 aaccaagtggggtgtttctgacttcatcaaggcctttattaaattccacggtcatgtgta 901 cctgagtaagagcttggaaaagttgagccctcttcgagagaaattggaagaacagtttaa 961 gaggctgctattccaaaaagctttcaactctcagcagttagttcatgtcactgtcattaa 1021 cctgtttcaacttcatcaccttcgtgactttagcaatgaaaccgagcagcacacttatag 1081 ccaagatgagcagctatgttggacacagttgctggccctctttatgtcttttctcggcat 1141 cctgtgcaagtgtcctctacagaatgagtctcaggaggagtcctacaatgcctatcctct 1201 tccagcagtcaaggtctccatggactggctaagactcagacccagggtctttcaggaggc 1261 agtggtggatgaaagacagtacatttggccctggttgatttctcttctgaatagtttcca 1321 tccccatgaagaggacctctcaagtattagtgcgacaccacttccagaggagtttgaatt 1381 acaaggatttttggcattgagaccttctttcaggaacttggatttttccaaaggtcacca 1441 gggtattacaggggacaaagaaggccagcaacgacgaatacgacagcaacgcttgatctc 1501 tataggcaaatggattgctgataatcagccaaggctgattcagtgtgaaaatgaggtagg 1561 gaaattgttgtttatcacagaaatcccagaattaatactggaagaccccagtgaagccaa 1621 agagaacctcattctgcaagaaacatctgtgatagagtcgctggctgcagatgggagccc 1681 agggctaaaatcagtgctatctacaagccgaaatttaagcaacaactgtgacacaggaga 1741 gaagccagtggttaccttcaaagaaaacattaagacacgagaagtgaacagagaccaagg 1801 aagaagttttcctcccaaagaggtaaaatcccagacagaactaagaaagactccagtgtc 1861 tgaagccagaaaaacacctgtaactcaaaccccaactcaagcaagtaactcccagttcat 1921 ccccattcatcaccctggagccttccctcctcttcccagcaggccagggtttccgccccc 1981 aacatatgttatccccccgcctgtggcattttctatgggctcaggttacaccttcccagc 2041 tggtgtttctgtcccaggaacctttcttcagcctacagctcactctccagcaggaaacca 2101 ggtgcaagctgggaaacagtcccacattccttacagccagcaacggccctctggaccagg 2161 gccaatgaaccagggacctcaacaatcacagccaccttcccagcaaccccttacatcttt 2221 accagctcagccaacagcacagtctacaagccagctgcaggttcaagctctaactcagca 2281 acaacaatcccctacaaaagctgtgccggctttggggaaaagcccgcctcaccactctgg 2341 attccagcagtatcaacaggcagatgcctccaaacagctgtggaatccccctcaggttca 2401 aggcccattagggaaaattatgcctgtgaaacagccctactaccttcagacccaagaccc 2461 cataaaactgtttgagccgtcattgcaacctcctgtaatgcagcagcagcctctagaaaa 2521 aaaaatgaagccttttcccatggagccatataaccataatccctcagaagtcaaggtccc 2581 agaattctactgggattcttcctacagcatggctgataacagatctgtaatggcacagca 2641 agcaaacatagaccgcaggggcaaacggtcaccaggaatcttccgtccagagcaggatcc 2701 tgtacccagaatgccgtttgaggaccccaagagctcccctctgcttcctccggacctgtt 2761 aaagagtctggctgccttggaggaagaggaagagctgattttttctaacactcctgatct 2821 ttacccggctctgctggggcctctcgcctctcttcctggacgaagcctttttaaatcctt 2881 attggagaagccctcagagctcatgtcacattcatcctctttcctgtccctcaccggatt 2941 ctctctcaatcaggaaagatacccaaataatagtatgttcaatgaggtatatgggaaaaa 3001 cctgacatccagctccaaagcagaactcagtccctcaatggccccccaggaaacatctct 3061 gtattccctttttgaagggactccgtggtctccatcacttcctgccagttcagatcattc 3121 aacaccagccagccagtctcctcattcctctaacccaagcagcctacccagctctcctcc 3181 aacacacaaccataattctgttccattctccaattttggacccattgggactccagataa 3241 cagggatagaaggactgcagatcggtggaaaactgataagccagccatgggtgggtttgg 3301 cattgattatctctcagcaacgtcatcctctgagagcagttggcatcaggccagcactcc 3361 gagtggcacctggacaggccatggcccttccatggaggattcctctgctgtcctcatgga 3421 aagcctaaagaagcaacagcatggggtccagcagttggggcccaaaagacagtctgaaga 3481 ggaaggaagcagcagtatctgcgtagcccacagagggcccaggcccctgcccagctgcag 3541 tctcccagcctccactttcagagtgaaattcaaggcagcacggacatgtgcccatcaggc 3601 acagaagaaaacacgacgtcgtccattttggaagagacgaaagaaaggaaaataa SMG7aminoacidsequence(GenBankAccessionNo.AAH36381.1) (SEQIDNO:14) 1 mslqsaqylrqaevlkadmtdsklgpaevwtsrqalqdlyqkmlvtdleyaldkkveqdl 61 wnhafknqittlqgqaknranpnrsevqanlslfleaasgfytqllqelctvfnvdlpcr 121 vkssqlgiisnkqthtsaivkpqssscsyicqhclvhlgdiaryrnqtsqaesyyrhaaq 181 lvpsngqpynqlailasskgdhlttifyycrsiavkfpfpaastnlqkalskalesrdev 241 ktkwgvsdfikafikfhghvylsksleklsplrekleeqfkrllfqkafnsqqlvhvtvi 301 nlfqlhhlrdfsneteqhtysqdeqlcwtqllalfmsflgilckcplqnesqeesynayp 361 lpavkvsmdwlrlrprvfqeavvderqyiwpwlisllnsfhpheedlssisatplpeefe 421 lqgflalrpsfrnldfskghqgitgdkegqqrrirqqrlisigkwiadnqprliqcenev 481 gkllfiteipeliledpseakenlilqetsvieslaadgspglksvlstsrnlsnncdtg 541 ekpvvtfkeniktrevnrdqgrsfppkevksqtelrktpvsearktpvtqtptqasnsqf 601 ipihhpgafpplpsrpgfppptyvipppvafsmgsgytfpagvsvpgtflqptahspagn 661 qvqagkqshipysqqrpsgpgpmnqgpqqsqppsqqpltslpaqptaqstsqlqvqaltq 721 qqqsptkavpalgkspphhsgfqqyqqadaskqlwnppqvqgplgkimpvkqpyylqtqd 781 piklfepslqppvmqqqplekkmkpfpmepynhnpsevkvpefywdssysmadnrsvmaq 841 ganidrrgkrspgifrpeqdpvprmpfedpksspllppdllkslaaleeeeelifsntpd 901 lypallgplaslpgrslfksllekpselmshsssflsltgfslnqerypnnsmfnevygk 961 nltssskaelspsmapqetslyslfegtpwspslpassdhstpasqsphssnpsslpssp 1021 pthnhnsvpfsnfgpigtpdnrdrrtadrwktdkpamggfgidylsatsssesswhqast 1081 psgtwtghgpsmedssavlmeslkkqqhgvqqlgpkrqseeegsssicvahrgprplpsc 1141 slpastfrvkfkaartcahqaqkktrrrpfwkrrkkgk