CHARACTERIZATION OF S-ADENOSYL-L-METHIONINE-CONSUMING ENZYMES WITH 1-STEP EZ-MTASE: A UNIVERSAL COUPLED-ASSAY
20230220443 · 2023-07-13
Inventors
Cpc classification
G01N2333/978
PHYSICS
International classification
Abstract
Methods and kits are disclosed for measuring activity of a methyltransferase or a radical SAM enzyme or for screening for an inhibitor of a methyltransferase or a radical SAM enzyme, where the methods and kits comprise, respectively, deaminase TM0936 for a MTase coupled assay and deaminase PA3170 for a radical SAM coupled assay.
Claims
1. A method of measuring activity of a methyltransferase, comprising contacting the methyltransferase with S-adenosyl-L-methionine (SAM) and/or a fluorescent SAM analog to generate S-adenosyl-L-homocysteine (SAH), quantitatively catabolizing the SAH to S-inosyl-L-homocysteine (SIH) in the presence of deaminase TM0936, and measuring the SIH produced.
2. The method of claim 1, wherein the methyltransferase is a protein methyltransferase, a DNA methyltransferase or an RNA methyltransferase.
3. The method of claim 1, wherein the methyltransferase is a lysine methyltransferase, an arginine methyltransferase, a histone-lysine N-methyltransferase, a glycine N-methyltransferase or a sarcosine/dimethylglycine N-methyltransferase.
4. The method of claim 1, wherein the method is carried out at a pH between pH 5 and pH 10.
5. The method of claim 1, wherein the method is carried out in the presence of sinefungin.
6. The method of claim 1, wherein the methyltransferase activity is quantified by measuring a decrease of absorbance at 263 nm.
7. The method of claim 1, wherein the SAM is a fluorescent SAM analog.
8. The method of claim 7, wherein the fluorescent SAM analog is S-8-aza-adenosine-L-methionine (8-aza-SAM), and wherein the methyltransferase activity is quantified by measuring a decrease of fluorescence emission at 360 nm.
9. The method of claim 1, wherein the methyltransferase activity is measured from or within a biological sample.
10. A method of screening for an inhibitor of a methyltransferase, comprising carrying out the method of claim 1 in the presence and in the absence of a candidate compound, wherein a decrease in the activity of methyltransferase in the presence of the candidate compound, compared to methyltransferase activity in the absence of the candidate compound, indicates that the candidate compound is an inhibitor of the methyltransferase.
11. A kit for measuring the activity of a methyltransferase or a radical SAM enzyme, the kit comprising: S-adenosyl-L-methionine (SAM) and/or fluorescent SAM analog; and deaminase TM0936.
12. The kit of claim 11, wherein the fluorescent SAM analog is S-8-aza-adenosine-L-methionine (8-aza-SAM).
13. A method of measuring activity of a radical SAM enzyme, comprising contacting the radical SAM enzyme with S-adenosyl-L-methionine (SAM) to generate 5′-deoxyadenosine (5DOA), quantitatively catabolizing 5DOA to 5′-deoxyinosine (5DOI) in the presence of the deaminase PA3170, and measuring the 5DOI produced.
14. The method of claim 13, wherein the method is carried out at a pH between pH 5 and pH 10.
15. The method of claim 13, wherein the reaction is carried out in the presence of sinefungin.
16. The method of claim 13, wherein the radical SAM enzyme activity is quantified by measuring a decrease of absorbance at 263 nm.
17. The method of claim 13, wherein the radical SAM enzyme activity is measured from or within a biological sample.
18. A method of screening for an inhibitor of a radical SAM enzyme, comprising carrying out the method of claim 13 in the presence and in the absence of a candidate compound, wherein a decrease in the activity of radical SAM enzyme in the presence of the candidate compound, compared to radical SAM enzyme activity in the absence of the candidate compound, indicates that the candidate compound is an inhibitor of the radical SAM enzyme.
19. A kit for measuring the activity of a radical SAM enzyme, the kit comprising: S-adenosyl-L-methionine (SAM) and deaminase PA3170.
20. The method of claim 1, wherein the contacting and catabolizing are done as a one-step method.
21. The method of claim 20, wherein the method is a high throughput screening method.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
DETAILED DESCRIPTION OF THE INVENTION
[0023] The invention provides a method of measuring the activity of a methyltransferase comprising contacting the methyltransferase with S-adenosyl-L-methionine (SAM) to generate S-adenosyl-L-homocysteine (SAH) and quantitatively catabolizing SAH to S-inosyl-L-homocysteine (SIH) in the presence of the deaminase TM0936.
[0024] The methyltransferase can be a protein methyltransferase, DNA methyltransferase or RNA methyltransferase. The methyltransferase can be, for example, a lysine methyltransferase, an arginine methyltransferase, a histone-lysine N-methyltransferase, a glycine N-methyltransferase or a sarcosine/dimethylglycine N-methyltransferase.
[0025] The reaction can be carried out at a pH between pH 5 and pH 10. The reaction can be carried out in the presence of sinefungin.
[0026] Methyltransferase activity can be quantified by measuring a decrease of absorbance at 263 nm.
[0027] The reaction can be carried out using a fluorescent SAM analog. As an example, the fluorescent SAM analog can be S-8-aza-adenosine-L-methionine (8-aza-SAM) and methyltransferase activity can be monitored through a decrease of fluorescence emission at 360 nm.
[0028] The methyltransferase activity can be measured from or within a biological sample, such as, e.g., a liver sample.
[0029] The invention also provides a method of screening for an inhibitor of a methyltransferase, comprising carrying out any of the methods of measuring the activity of a methyltransferase disclosed herein in the present and in the absence of a candidate compound, wherein a decrease in the activity of methyltransferase in the presence of the compound, compared to methyltransferase activity in the absence of the compound, indicates that the compound is an inhibitor of the methyltransferase.
[0030] The invention also provides a kit for measuring the activity of a methyltransferase, the kit comprising: S-adenosyl-L-methionine (SAM) and/or fluorescent SAM analog; and the deaminase TM0936. The fluorescent SAM analog can be, for example, S-8-aza-adenosine-L-methionine (8-aza-SAM).
[0031] The invention also provides a method of measuring the activity of a radical SAM enzyme comprising contacting the enzyme with S-adenosyl-L-methionine (SAM) to generate 5′-deoxyadenosine (5DOA) and quantitatively catabolizing 5DOA to 5′-deoxyinosine (5D01) in the presence of the deaminase PA3170.
[0032] A radical SAM enzyme is an enzyme that use a [4Fe-4S].sup.+ cluster to reductively cleave S-adenosyl-L-methionine (SAM) to generate a radical, usually a 5′-deoxyadenosyl radical, as a critical intermediate.
[0033] The reaction can be carried out at a pH between pH 5 and pH 10. The reaction can be carried out in the presence of sinefungin.
[0034] The SAM enzyme activity can be quantified by measuring a decrease of absorbance at 263 nm.
[0035] The SAM enzyme activity can be measured from or within a biological sample, such as, e.g., a liver sample.
[0036] The invention also provides a method of screening for an inhibitor of a radical SAM enzyme, comprising carrying out any of the methods of measuring the activity of a radical SAM enzyme disclosed herein in the present and in the absence of a candidate compound, wherein a decrease in the activity of radical SAM enzyme in the presence of the compound, compared to radical SAM enzyme activity in the absence of the compound, indicates that the compound is an inhibitor of the radical SAM enzyme.
[0037] The invention also provides a kit for measuring the activity of a radical SAM enzyme, the kit comprising: S-adenosyl-L-methionine (SAM) and the deaminase PA3170.
[0038] In one embodiment, TM0936 (for MTase coupled assay) has the following amino acid sequence (Thermotoga maritima, SEQ ID NO:1):
TABLE-US-00001 MIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGE VKVDLDLSGKLVMPALFNTHTHAPMTLLRGVAEDL SFEEWLFSKVLPIEDRLTEKMAYYGTILAQMEMAR HGIAGFVDMYFHEEWIAKAVRDFGMRALLTRGLVD SNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSP YLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEEYD LEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPF FVSHNPASNLKLGNGIAPVQRMIEHGMKVTLGTDG AASNNSLNLFFEMRLASLLQKAQNPRNLDVNTCLK MVTYDGAQAMGFKSGKIEEGWNADLVVIDLDLPEM FPVQNIKNHLVHAFSGEVFATMVAGKWIYFDGEYP TIDSEEVKRELARIEKELYSS.
[0039] In one embodiment, PA3170 (for radical SAM coupled assay) has the following amino acid sequence (Pseudomonas aeruginosa. SEQ ID NO:2):
TABLE-US-00002 MPNVRNPFDLLLLPTWIVPVEPAGVVLRDHALGIR DGQIAVVAPREQAMRHGATEIRELPGMLLAPGLVN AHGHSAMSLFRGLADDLPLMTWLQDHIWPAEGQWV SEDFIRDGTELAIAEQVKGGITCFSDMYFYPQAIC GVVHDSGVRAQVAIPVLDFPIPGARDSAEAIRQGM ALFDDLKHHPRIRIAFGPHAPYTVSDDKLEQILVL TEELDASIQMHVHETAFEVEQATERNGERPLARLH RLGLLGPRFQAVHMTQVDDDDLAMLVETNSSVIHC PESNLKLASGFCPVEKLWQAGVNVAIGTDGAASNN DLDLLGETRTAALLAKAVYGQATALDAHRALRMAT LNGARALGLERLIGSLEAGKAADLVAFDLSGLAQQ PVYDPVSQLIYASGRDCVRHVWVGGRQLLDDGRLL RHDEQRLIARAREWGPKIAASDRS.
[0040] All combinations of the various elements described herein are within the scope of the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
[0041] This invention will be better understood from the Experimental Details, which follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
EXPERIMENTAL DETAILS
Introduction and Overview
[0042] S-adenosyl-L-methionine-consuming enzymes play a crucial role in metabolic pathways. The first subset of enzymes is composed of the methyltransferases. These proteins use SAM to deposit methyl marks. Many of these epigenetic ‘writers’ are associated with gene regulation. As cancer etiology is highly correlated with misregulated methylation patterns, methyltransferases are emerging therapeutic targets. The second subset of enzymes incorporates the radical SAM (RS) enzymes. These enzymes commonly generate a 5′-deoxyadenosyl radical; this radical is a critical intermediate and it is utilized to perform an array of unusual and chemically difficult transformations. Successful design of methyltransferase and radical SAM enzyme inhibitors relies on 1) the access to enzyme mechanistic insights and 2) the efficient screening of molecules against these targets. To characterize both methyltransferases and radical SAM enzymes (RS), we report a highly-sensitive one-step deaminase-linked continuous assay where the S-adenosyl-L-homocysteine (SAH) MTase-product or the 5′-deoxyadenosine (5DOA) radical-SAM product is rapidly and quantitatively catabolized to S-inosyl-L-homocysteine (SIH) or 5′-deoxyinosine (5DOI), respectively.
[0043] A coupled assay relying on one single enzyme is a clear asset, thus we took advantage of enzyme TM0936. This SAH-deaminase is a robust and efficient catalyst (41,43). By converting SAH into SIH, the enzyme relives MTAses from product inhibition (39,44). We coupled this catalyst to several MTase families: two protein arginine methyltransferases (PRMT5 and PRMT7), a histone-lysine N-methyltransferase (DIM-5) and a sarcosine/dimethylglycine N-methyltransferase (SDMT). We present efficient measurement of kinetic parameters well suited to high-throughput screening (HTS). Furthermore, we measured the inhibition value of sinefungin against SDMT, thus establishing the compatibility between sinefungin and TM0936 and demonstrating its use for inhibitor screening.
[0044] TM0936 is a strong catalyst and pH variations only affected the deaminase activity to a small extent; the decrease of absorbance at 263 nm was monitored accurately across a 5-unit pH range (5.0-10.0). Thus, in a technical tour de force, we established the pH dependence of SDMT reaction rates. Likewise, variations in salt concentration had no effect on TM0936 activity, and we quantified the impact of ionic strength onto the affinity between histone tails and their MTase target. Finally, conscious that a UV-mode of detection may limit the applications of this assay, we synthesized a fluorescent SAM analog. In most cases, the S-8-aza-adenosine-L-methionine (8-aza-SAM) was a good substrate for MTases. As TM0936 efficiently converted 8-aza-SAH into the non-fluorescent product 8-aza-SIH, PRMT7 activity was monitored through a decrease of fluorescence emission at 360 nm.
[0045] Unlike discontinuous radioactive- and antibody-based assays, our assay provides a simple, versatile and affordable approach towards the characterization of methyltransferases. With Z′-factors above 0.75, detectable methylation rates as low as 2 μM h.sup.−1 and the use of submicromolar methyltransferase concentrations, this assay is well suited to high-throughput screening and may promote the identification of novel therapeutics.
Materials and Methods
Reagents
[0046] Common chemicals and reagents were obtained from commercial sources and used without further purification. D-luciferin (Gold Biolotechnology, #L-123), phosphoenolpyruvic acid (MP Biomedicals, #02151872), S-adenosyl-L-methionine (Sigma-Aldrich, #A7007; purification onto weak cation exchanger column—HiTrap CM Sepharose FF—is required to eliminate both S-adenosyl-L-homocysteine and 5′-deoxy-5′-methylthioadenosine impurities) (68), 8-aza-adenosine (Berry & Associates, #PRA10007), sinefungin and sarcosine (Santa Cruz Biotechnology; #sc-203263 and #sc-204262, respectively).
Analytical Procedures.
[0047] HPLC methods-All purifications used a Luna C18(2) reversed phase column (Phenomenex #00G-4252-E0; 4.6×250 mm, 5 μm, 100 A), with:
Buffer B1: 100 mM potassium dihydrogenophosphate with 8 mM tetrabutylammonium bisulfate in water (pH=6.00; KOH);
Buffer B2: 100 mM potassium dihydrogenophosphate with 8 mM tetrabutylammonium bisulfate in 30% acetonitrile (pH=6.00; KOH); Buffer B3: water;
Buffer B4: 30% acetonitrile;
Buffer B5: 0.1% formic acid;
Buffer B6: 0.1% formic acid in 50% acetonitrile;
Buffer B7: 100 mM acetic acid with 100 mM triethylamine (pH=6.00; formic acid);
Buffer B8: 100 mM acetic acid with 100 mM triethylamine in 30% acetonitrile (pH=6.00; formic acid)
TABLE-US-00003 time flow Method A Method B time flow Method C time flow Method D ( ) (
) B1 B2 B3 B4 (
) (
) B5 B6 (
) (
) B7 B8 0 1 98 2 98 2 0 1 100 0 0 1 98 2 5 1 98 2 98 2 8 1 100 0 6 1 98 2 25 1 0 100 0 100 14 2 10 90 16 1 0 100 26 2 0 100 0 100 14.5 2 10 90 16.5 2 0 100 32 2 0 100 0 100 20.5 2 10 90 19.5 2 0 100 33 2 98 2 98 2 21 2 100 0 20 2 98 2 39 2 98 2 98 2 29 2 100 0 23 2 98 2 40 0 98 2 98 2 30 0 100 0 24 0 98 0.
indicates data missing or illegible when filed
[0048] NMR spectroscopy—.sup.1H (.sup.11C) NMR spectra were recorded on a Bruker Avance IIIHD 600 MHz (150 MHz) system equipped with a 5 mm H/F-TCI CryoProbe. ICON-NMR software (Bruker Biospin) was used to record all spectra. The .sup.1H-.sup.1H spectra were obtained at a constant temperature of 298 K using a COSY pulse sequence: 2048 and 128 points, sweep widths of 12 and offset 5.0 ppm in the primary and secondary direction, respectively and 4 scans. The .sup.1H-.sup.13C edited spectra were obtained at a constant temperature of 298 K using the HSQC pulse sequence: with 2048 and 256 points, sweep widths of 12 and 200 ppm and offset 5.0 and 75 ppm for the .sup.1H and .sup.13C dimension, respectively and 16 scans. The length of standard proton pulse to achieve a 90° nutation was determined with the ‘pulsecal’ command. The data were processed with Topspin 3.2 (Bruker Biospin) with baseline and phase correction. .sup.31P NMR spectra were recorded on a Bruker Avance IIIHD 300 MHz (121 MHz) system equipped with a 5 mm BBFO probe.
[0049] Mass spectrometry—Accurate mass measurements were performed using the Orbitrap Velos Mass Spectrometer (ThermoFisher) in the positive ionization mode at a resolution of 60,000 (at m/z 300) and using angiotensin as the lock mass. Flow injection analysis of 50% acetonitrile/water containing 0.1% formic acid was used to introduce the sample into the mass spectrometer at 0.075 mL min.sup.−1. Prior to injection of 10 μL, 10 μL of a 10 μM solution of angiotensin in 50% acetonitrile/water containing 0.1% formic acid was mixed with 20 μL of a 50 μM solution of sample in water.
Enzymatic Syntheses
[0050] One-pot preparation of 8-aza-adenosine triphosphate (8-aza-ATP)—A 1.5-mL reaction mixture (100 mM TRIS/HEPES, 50 mM KCl, 40 mM MgCl.sub.2, 2 mM μME, 450 mM phosphoenolpyruvate and 400 U pyruvate kinase/myokinase; pH=7.50) was carried out in a 2-mL tube containing 50 mg 8-aza-adenosine suspension (8-aza-A, C≈125 mM) and 1 mM ATP. Reaction started upon addition of adenosine kinase from Anopheles gambiae (AgAK; 25 μM final concentration, enzyme:nucleoside is 1:5,000). Samples were mixed with a LabRoller™ rotator; within an hour, precipitate (8-aza-A) dissolved as monophosphorylation occurred. After 7 h (25° C.), reactions were stopped (Amicon Ultra-0.5 mL, MWCO 10K, 10,000 rpm; 4° C., 15 min) and 8-aza-ATP (95% conversion) was isolated by HPLC (Method A-tR(min): 8-aza-ATP 19.22, 8-aza-adenosine 12.77). The fraction containing 8-aza-ATP was freeze-dried and further desalting was performed (HPLC; Method B). A last lyophilization step offered pure 8-aza-ATP. .sup.1H NMR δ (600 MHz, D.sub.2O) 4.17 (2H, m, 5′-H), 4.43 (1H, q, 4′-H, J 4.2), 4.76 (1H, t, 3′-H, J 4.8), 5.16 (1H, t, 2′-H, J 4.8), 6.34 (1H, d, 1′-H, J 4.2), 8.36 (1H, s, 2-H); .sup.31P NMR δ (121 MHz, D20) −23.13 (t, P0, J 19.7), −11.40 (d, Pa, J 19.6), −9.67 (br s, Pγ); .sup.1H-.sup.13C edited HSQC NMR δ (150 MHz, D.sub.2O) 65.2 (C-5′), 70.4 (C-3′), 73.2 (C-2′), 84.0 (C-4′), 88.2 (C-1′), 157.2 (C-2). FTMS+p ESI m/z 508.9981 (M+), calcd for [C.sub.9H.sub.16N.sub.6O.sub.13P3]+508.9983.
[0051] Preparation of S-8-aza-adenosyl-L-methionine (8-aza-SAM)-A 1-mL reaction mixture (50 mM HEPES, 50 mM KCl, 10 mM MgCl.sub.2, 1 mM μME, 25 mM phosphoenolpyruvate and 5 U pyruvate kinase/myokinase; pH=7.50) was carried out with 25 mM L-methionine and 10 mM of 8-aza-ATP. The synthesis started upon addition of methionine adenosyltransferase from Methanococcus jannaschii (MjMAT; 25 μM final concentration, enzyme: triphosphate 1:400). After 2 h at 35° C., reactions were stopped (Amicon Ultra-0.5 mL, MWCO 10K, 10,000 rpm; 4° C., 15 min) and the SAM analog (65% conversion) was isolated by HPLC (Method C-tR(min): 8-aza-SAM 4.67). The SAM analog-containing fraction was freeze-dried and further purified onto a weak cation exchanger column (HiTrap CM Sepharose FF, GE Healthcare Life Sciences, #17-5155-01; column was pre-charged with Na+, impurities—including excess L-methionine—were eluted with water while 8-aza-SAM was stripped-off column with a 200 mM HCl solution). A final lyophilization step offered pure 8-aza-SAM as white powder. .sup.1H NMR δ (600 MHz, D.sub.2O; diluted sample) 2.33 (2 H, m, β-H), 2.90 (3H, s, S(R)Me; 5%), 2.94 (3H, s, S(S)Me; 95%), 3.55 (2H, m, 5′-H), 3.78 (1H, m, α-H), 3.90 (2H, m, γ-H), 4.66 (1H, dd, 4′-H, Ja 6.6, Jb 5.4), 4.79 (1H, m, 3′-H), 4.95 (1H, dd, 2′-H, Ja 2.4, Jb 1.8), 6.47 (1H, d, 1′-H, J 1.8), 8.39 (1H, s, 2-H); .sup.1H-.sup.13C edited HSQC NMR δ (150 MHz, D20; concentrated acidic sample) 23.6 (SMe), 24.7 (Cβ), 38.6 (C-5′), 44.6 (Cγ), 51.8 (Cα), 73.3 (C-3′), 73.9 (C-2′), 78.9 (C-4′), 90.3 (C-1′). FTMS+p ESI m/z 400.1398 (M.sup.+), calcd for [C.sub.14H.sub.22N.sub.70O.sub.5S]+400.1398.
[0052] Preparation of S-8-aza-adenosyl-L-homocysteine (8-aza-S4H)—The 7-mL reaction mixtures. (100 mM TRIS, 100 μM MgCl.sub.2, 1 mM βME, 10% glycerol; pH=7.90) were carried out with 40 mM sarcosine and 0.5 mM of 8-aza-SAM. The methyltransfer reactions started upon addition of GsSDMT enzyme (10 μM final concentration; high excess to prevent product inhibition). After 1 h at 25° C., reactions were stopped (Amicon Ultra-15 mL, MWCO 10K, 4,000 rpm; 4° C., 20 min) and 8-aza-SAH (95% conversion) was isolated by HPLC (Method D-tR(min): 8-aza-SAM 4.75, 8-aza-SAH 13.07). The 8-aza-SAH fractions were freeze-dried to offer white powder. .sup.1H NMR δ (600 MHz, D.sub.2O) 2.02 (2H, m, β-H), 2.60 (2H, t, γ-H, J 7.8), 2.95 (2H, dd, 5′-H, Ja 14.4, Jb 4.8), 3.74 (1H, m, α-H), 4.39 (1H, dd, 4′-H, Ja 7.2, Jb 4.8), 4.66 (1H, t, 3′-H, J 4.8), 5.13 (1H, dd, 2′-H, Ja 4.8, Jb 3.6), 6.35 (1H, d, 1′-H, J 3.6), 8.35 (1H, s, 2-H); .sup.1H-.sup.13C edited HSQC NMR δ (150 MHz, D20) 27.6 (Cγ), 30.3 (Cβ), 33.4 (C-5′), 53.7 (Cα), 73.1 (C-3′), 73.6 (C-2′), 84.0 (C-4′), 88.7 (C-1′), 156.9 (C-2). FTMS+p ESI m/z 386.1233 (M+), calcd for [C.sub.13H.sub.20N.sub.7O.sub.5S]+386.1241 and 408.1058 (M−H+Na+), calcd for [C.sub.13H.sub.19N.sub.7NaO.sub.5S]+408.1061.
[0053] Preparation of S-8-aza-inosyl-L-homocysteine (8-aza-SIH)—The 1-mL reaction mixture (100 mM HEPES, 1 mM βME, 10% glycerol; pH=7.50) was carried out with 5 mM of 8-aza-SAH. The deaminase reaction started upon addition of TM0936 (50 μM final concentration). After 15 min at 35° C., reaction was stopped (Amicon Ultra-0.5 mL, MWCO 10K, 10,000 rpm; 4° C., 15 min) and 8-aza-SIH (100% conversion) was isolated by HPLC (Method D-tR(min): 8-aza-SIH 11.60, 8-aza-SAH 13.07). The 8-aza-SIH fraction was freeze-dried to offer white powder. .sup.1H NMR δ (600 MHz, D20) 2.04 (2H, m, —H), 2.61 (2H, t, γ-H, J 7.8), 2.96 (2H, dd, 5′-H, Ja 14.4, Jb 4.8), 3.74 (1H, m, α-H), 4.39 (0H, dd, 4′-H, Ja 5.4, Jb 4.8), 4.65 (1H, t, 3′-H, J 5.4), 5.10 (1H, t, 2′-H, J 3.6), 6.37 (1H, d, 1′-H, J 3.6), 8.33 (1H, s, 2-H); .sup.1H-.sup.13C edited HSQC NMR δ (150 MHz, D20) 27.5 (Cγ), 30.2 (Cβ), 33.4 (C-5′), 53.8 (Cα), 73.1 (C-3′), 73.7 (C-2′), 84.2 (C-4′), 89.1 (C-1′). FTMS+p ESI m/z 387.1081 (M+), calcd for [C.sub.13H.sub.19N.sub.6O.sub.6S]+387.1081 and 409.0897 (MH+Na+), calcd for [C.sub.13H.sub.18N.sub.6NaO.sub.6S].sup.+ 409.0901.
Purification of Enzymes
[0054] Photinus pyralis luciferase (FLUC)—The original wild-type firefly luciferase gene (pQE30-FLUC) was sub-cloned into the pMCSG10 vector to offer N-terminal His.sub.6-GST-TEVtagged enzyme (69). BL21(DE3) cells, transformed with this new vector, were grown at 37° C. in LB broth containing 100 μg mL.sup.−1 ampicillin to an OD.sub.600=0.6. The cultures were cooled down (18° C.), supplemented with IPTG (0.4 mM final concentration) and incubated for an additional 12 h. Harvested cells were re-suspended (50 mM TRIS, 300 mM NaCl, 5 mM imidazole, 1 mM βME, 10% glycerol, pH=8.00 containing PMSF and RNAse). Lysis was achieved using BugBuster® 10× and sonication; debris were removed by centrifugation at 20,000 rpm for 20 min. The supernatant was loaded onto Ni-NTA agarose and enzyme was eluted using an imidazole gradient (5-500 mM). Fractions containing the tagged FLUC were concentrated, desalted, and further digested by His6-tagged TEV protease (4° C., 16 h). Subtractive Ni-NTA and further purification on Superdex 200 (16/300) column (50 mM TRIS, 300 mM NaCl, 1 mM βME, 10% glycerol, pH=8.00) offered FLUC. The concentrated enzyme (150 μM) was kept at −80° C.
[0055] Proteins for enzymatic syntheses—For the synthesis of 8-aza-ATP and 8-aza-SAM, the N-terminal His6-tagged adenosine kinase from Anopheles gambiae (AgAK) and methionine adenosyltransferase from Methanococus jannaschii (MjMAT) were expressed and purified as reported previously (70-72). The sarcosine/dimethylglycine N-methyltransferase from Galdieria sulphuraria (GsSDMT; DNASU clone ID GsCD00383580) was used for the preparation of 8-aza-SAH, by-products of this methyltransferase reaction with sarcosine and corresponding 8-aza-SAM (73).
[0056] Methyltransferases—The PRMT5 from Caenorhabditis elegans (CePRMT5) was expressed and purified as described previously with some modification (74,75). In addition to Triton X-100 (1%), prior use of BugBuster® reagent for cell lysis also improved yield of recovered protein. The PRMT7 from Trypanosoma brucei (TbPRMT7) was prepared using a published protocol (76). The H4.sub.(1-20) peptide substrate for CePRMT and TbPRMT7 was purchased from GenScript (>95%). Following the described procedures, the histone H3 Lysine-K9 methyltransferase from Neurospora crassa (NcDIM-5) was expressed and purified as a GST-tagged enzyme (77). The H3.sub.(1-53) peptide substrate for DIM-5 was expressed as a His.sub.6-tagged peptide from a modification of the original vector with a stop codon (Y54Stop) (78). Ni-NTA purification, followed by removal of N-terminus tag with His.sub.6-TEV protease (4° C., 16 h) and subtractive Ni-NTA offered H3.sub.(1-53). Peptide was purified by HPLC (78), and further lyophilization offered suitable substrate for DIM-5 kinetic studies. The sarcosine/dimethylglycine N-methyltransferase from Galdieria sulphuraria (GsSDMT; DNASU clone ID GsCD00383580) was expressed as a His.sub.8-MBPtagged enzyme (maltose binding protein). Further removal of the His.sub.8-MBP-tag with His6-tagged TEC protease (4° C., 16 h) and gel filtration step offered purified enzyme (73).
[0057] TM0936 coupling enzyme—The SAH-deaminase from Thermotoga maritima (gene TM0936; DNASU clone ID TmCD00084735) was expressed and purified as described in a previous report (79). Likewise, the 5DOA-deaminase from Pseudomonas aeruginosa (PA3170) was expressed and purified as described in a previous report (42). Finally, the preparation of 5′-methylthioadenosine/S-adenosyl-L-homocysteine nucleotidase from Salmonella enterica (SeMTAN) was previously reported (80).
pH-, Salt- and DMSO-Dependence of FLUC Luminescence
[0058] Relative enzymatic efficiency of FLUC upon pH variation—The impact of pH onto enzymatic efficiency for recombinant FLUC was determined at 25° C. by monitoring luminescence (RLU, relative light unit) with a SpectraMax L instrument (one photomultiplier, ‘photo-counting’ mode; Molecular Devices). Briefly, 90-μL reactions containing buffer (50 mM phosphate; pH 5.80-8.00), 1 mM MgCl.sub.2, 1 mM βME, 10% glycerol, 10 μM of both ATP and luciferin, were loaded onto a 96-well half-area flat bottom plate (Corning, #3992). Light production started upon addition of FLUC recombinant enzyme (10 μL at 10 nM) and RLU were recorded. For optimum experimental condition (i.e. pH=8.00), the RLU was set to 1.0 and corresponding ratios were determined for other experiments.
[0059] Salt and DMSO effect on FLUC luminescence—Using the same experimental procedure as above (50 mM phosphate, pH=8.00), luminescence was recorded under various concentrations of either NaCl (0-500 mM) or DMSO (0-7.5%, v/v). Light production started upon addition of FLUC recombinant enzyme (10 μL at 10 nM) and RLU were monitored. For optimum experimental condition (i.e. no salt, no DMSO), the RLU was set to 1.0 and corresponding ratios were determined for other experiments.
[0060] Spectral analysis of the FLUC luminescence—The spectral components of FLUC luminescence were observed at various pHs (50 mM phosphate buffer) by mixing ATP (1 mM), luciferin (1 mM), MgCl.sub.2 (5 mM), 1 mM βME, 10% glycerol and FLUC (1 μM) in a 96-well half-area flat bottom plate. Lower pH values drastically affect the enzyme and shift its luminescence towards a red emission spectrum, with light production no longer occurring below pH=6.00. A semi-quantitative analysis of the FLUC luminescence (pHs 8.00, 7.20 and 6.40) was performed under the same conditions using a quartz cuvette and a FluoroMax-3 fluorometer (3-mL reaction volume; emission scan: 450-750 nm, 5 nm s.sup.−1; excitation slit width ‘shutoff’, emission slit width 10 mu). The light generated upon luciferin oxidation was a combination of three spectral components with maximum emission at 556, 606 and 654 nm; thus, experimental traces RLU=f(λ) were fitted to a three-component Gaussian function (Eq. 1) (81):
where λ is the scanned emission wavelength (FLUC), RLU.sup.MAX and σ are the luminescence intensity and the Gaussian RMS width at the specific maximum emission wavelength (i.e. 556, 606 or 654 mu), respectively.
Differential Extinction Coefficients (Δε) for Deaminase Reaction
[0061] Nucleoside concentrations (stock solutions) were determined using known extinction coefficients for: adenosine, 259(ε/M.sup.−1 cm.sup.−1 15,400) and 8-aza-adenosine, 277(e/M-1 cm.sup.−1 17,830). The deaminase reactions using these various substrates were performed in quartz cuvettes (1-cm light path; 3-mL reaction volume) and absorbance measurements were carried out with a NanoDrop 2000c (scan mode: 220-320 nm with multi scans superimposed; 37° C. and continuous stirring). Briefly, the 3-mL reactions contained 50 mM buffer (acetate: pH 4.00-5.00; MES: pH 5.00-6.50; phosphate: pH 5.80-8.00; TRIS: pH 7.50-8.50; CHES: pH 8.90-9.90), 1 mM βME and 10% glycerol. Five different concentrations of either adenosine or 8-aza-adenosine substrates were used (10, 20, 30, 40 and 50 μM). Mixtures were blanked before acquisition and reactions started upon addition of deaminase (TM0936, 2 μL of 240.5 μM enzyme stock). Over the course of the deaminase reaction (e.g. adenosine.fwdarw.inosine), optimum wavelengths at which the highest absorbance shift is observed were selected (i.e. adenosine reaction, λ=263 mu; 8-aza-adenosine reaction, λ1=282 nm and λ2=292 nm). Scans were recorded until the absorbance at these monitored wavelengths reached a stable value (82). For each pH condition, the end-point absorbance shifts were plotted against initial nucleoside concentrations and fitted to a linear regression: each slope is a differential extinction coefficient (Δε) for deamination of the specific nucleoside substrate. Furthermore, the pH-dependence of differential extinction coefficient (Ae) for this deaminase reaction was obtained by plotting the pairs (Δε; pH) and fitting these to the following supplementary Eq. 2:
where Δε.sub.HIGH pH and Δε.sub.LOW pH are the extinction coefficient measured at optimum wavelengths (i.e. λ for adenosine and λ1 or λ2 for 8-aza-adenosine) for the deaminase reaction at high and low pH, respectively, and −pKa is the logarithm of acid dissociation constant for either inosine or 8-aza-inosine. In summary: adenosine.fwdarw.inosine, 263(Δε.sub.HIGH pH; Δε.sub.LOW pH/M.sup.−1 cm.sup.−1 −4,655±186; −8,076±80), pKa=8.72±0.09; 8-aza-adenosine.fwdarw.8-aza-inosine, 282(Δε.sub.HIGH pH; Δε.sub.LOW pH/M.sup.−1 cm.sup.−1 −2,026±174; −14,975±129), pKa=7.29±0.03, 292(Δε.sub.HIGH pH; Δε.sub.LOW pH/M.sup.−1 cm.sup.−1 −3,016±119; −10,117±87), pKa=7.30±0.03.
Z′-Factor
[0062] The screening window coefficient (Z′-factor) was determined as previously described using various CePRMT5, TbPRMT7, NcDIM-5 and GsSDMT enzyme concentrations (116-1000 nM, 139-1003 nM, 4.28-23.8 nM and 19.5-244 nM, respectively) with saturating concentrations of SAM (25.0, 25.1, 25.8 and 763 μM, respectively) and saturated levels of matching acceptor (acceptor/μM: H4.sub.(1-20)>/200, H4.sub.(1-20)/200, H3.sub.(1-53)/315.8 and sarcosine/5,000, respectively) at either pH=7.60 (50 mM phosphate), pH=7.60 (50 mM phosphate), pH=9.50 (50 mM glycine) or pH=7.80 (50 mM phosphate), respectively (83). Each experiment consisted of 8 sample replicates (s; with both SAM and acceptor included in reactions) and 8 control replicates (c; with SAM and without acceptor in reactions). Statistical analysis of the initial rates using the following supplementary Eq. 3 yields the corresponding Z′-factor:
where μs is the mean value of the initial rates for samples s and as is the standard deviation of the initial rates for samples s (3σ.sub.s corresponds to a 99.73% confidence interval).
UV-Based Coupled Assay for MTases
[0063] Kinetic behavior for peptide H4.sub.(1-20) against CePRMT5 (SAM sat.)—Briefly, kinetic parameters were determined at 20° C. in a UV-Star 96-well flat bottom plate (Greiner Bio-One, #655801) by continuous monitoring of absorbance at 263 nm using a SpectraMax M5 instrument (Molecular Devices). The 250-μL reaction mixtures from a same row contained 50 mM phosphate buffer pH=7.60, 1 mM βME, 10% glycerol, 4 μM coupling deaminase TM0936, 300 nM CePRMT5 and various peptide concentrations (5-180 μM; in the first well, peptide acceptor was omitted to account for background signal—natural decomposition of SAM). The methyltransfer reactions started upon addition of SAM (25 μM saturating final concentration) and absorbance was recorded. Initial rates were first corrected for background signal, then plotted against H4.sub.(1-20) concentrations and fitted to the Morrison kinetic model (Eq. 4) to yield corresponding kinetic parameters (K.sub.m, k.sub.cat) (84):
ν=0.5 k.sub.cat(([MTase]+[H4]+K.sub.m)−√{square root over (([MTase]+[H4]+K.sub.m).sup.2−4[MTase][H4])})
where [MTase] and [H4] are the total concentration of methyltransferase and peptide acceptor, respectively; K.sub.m is the Michaelis constant and k.sub.cat is the turnover for H4.sub.(1-20) substrate.
[0064] Kinetic behavior for SAM against CePRMT5 (H4.sub.(1-20) sat.)—Briefly, the measurements consisted of two experimental subsets: MTase reactions (both SAM and peptide added) and MTase blanks (SAM was added without peptide to account for natural SAM decomposition). The 250-μL reaction mixtures from a same row contained 50 mM phosphate buffer pH=7.60, 1 mM βME, 10% glycerol, 4 μM coupling deaminase TM0936, 300 nM CePRMT5 and various SAM concentrations (2.35-47.0 μM). Absorbance at 263 nm was recorded after addition of either H4.sub.(1-20) (104 μM saturating final concentration; MTase reactions) or water (MTase blanks). Initial rates were first corrected for background signal, then plotted against SAM concentrations and fitted to the Morrison kinetic model to yield corresponding kinetic parameters.
[0065] Kinetic behavior for peptide H4.sub.(1-20) against TbPRMT7 (SAM sat.)—Experiments were conducted following matching CePRMT5 protocol above. Briefly, the 250-μL reaction mixtures from a same row contained 25 mM phosphate buffer pH=7.60, 1 mM βME, 10% glycerol, 4 μM coupling deaminase TM0936, 1.0 μM TbPRMT7 and various peptide concentrations (16.6-243.3 μM; in the first well, peptide acceptor was omitted to account for background signal—natural decomposition of SAM). Reactions started upon addition of SAM (25.8 μM saturating final concentration) and absorbance was recorded. Initial rates were first corrected for background signal, then plotted against H4.sub.(1-20) concentrations. Fit to the Michaelis-Menten model (Eq. 5) provided corresponding kinetic parameters:
where [MTase] and [H4] are the total concentration of methyltransferase and H4 peptide, respectively; K.sub.m is the Michaelis constant and k.sub.cat is the turnover for H4 substrate.
[0066] Kinetic behavior for SAM against 7bPRMT7 (H4.sub.(1-20) sat.)—Experiments were conducted following matching CePRMT5 protocol above. Briefly, the measurements consisted of two experimental subsets: MTase reactions (both SAM and peptide added) and MTase blanks (SAM was added without peptide to account for natural SAM decomposition). The 250-μL reaction mixtures from a same row contained 25 mM phosphate buffer pH=7.60, 1 mM βME, 10% glycerol, 4 μM coupling deaminase TM0936, 402 nM TbPRMT7 and various SAM concentrations (1.53-20.0 μM). Absorbance at 263 nm was recorded after addition of either H4.sub.(1-20) (200 μM saturating final concentration; MTase reactions) or water (MTase blanks). Initial rates were first corrected for background signal, then plotted against SAM concentrations and fitted to the Morrison kinetic model to yield corresponding kinetic parameters.
[0067] Kinetic behavior for peptide H3.sub.(1-53) against NcDIM-S(SAM sat.)—Experiments were conducted following matching CePRMT5 protocol above. Briefly, the 250-μL reaction mixtures from a same row contained 25 mM glycine buffer pH=9.50, 1 mM βME, 10% glycerol, 50 mM NaCl, 4 μM coupling deaminase TM0936, 7.6 nM NcDIM-5 and various peptide concentrations (0.51-12.68 μM; in the first well, peptide acceptor was omitted to account for background signal—natural decomposition of SAM). Reactions started upon addition of SAM (25.8 μM saturating final concentration) and absorbance was recorded. Initial rates were first corrected for background signal, then plotted against H3.sub.(1-53) concentrations. Fit to the Michaelis-Menten equation provided corresponding kinetic parameters.
[0068] Kinetic behavior for sarcosine against GsSDMT (SAM sat.)—Experiments were conducted following matching CePRMT5 protocol above. Briefly, the 100-μL mixtures from a same row contained 100 mM phosphate buffer pH=7.80, 1 mM βME, 5% glycerol, 100 μM MgCl.sub.2, 4 μM coupling deaminase TM0936, 976 nM GsSDMT and various sarcosine concentrations (0.5-12.5 mM; in the first well, sarcosine was omitted to account for background signal—natural decomposition of SAM). Reactions started upon addition of SAM (750 μM saturating final concentration), 60-μL volumes were transferred onto UV plate and absorbance was recorded. Initial rates were first corrected for background signal, and then plotted against sarcosine concentrations. Fit to the Michaelis-Menten equation provided corresponding kinetic parameters.
[0069] Kinetic behavior for SAM against GsSDMT (sarcosine sat.)—Experiments were conducted following matching CePRMT5 protocol above. Briefly, the measurements consisted of two experimental subsets: MTase reactions (both SAM and sarcosine added) and MTase blanks (SAM was added without sarcosine to account for natural SAM decomposition). The 100-μL reaction mixtures from a same row contained 100 mM phosphate buffer pH=7.80, 1 mM βME, 5% glycerol, 100 μM MgCl.sub.2, 4 μM coupling deaminase TM0936, 195 nM GsSDMT and various SAM concentrations (49.9-750.2 μM). Reactions started upon addition of either sarcosine (10 mM saturating final concentration; MTase reactions) or water (MTase blanks), 60-μL volumes were transferred onto UV plate and absorbance was recorded at 263 nm. Initial rates were first corrected for background signal, and then plotted against SAM concentrations. Fit to the Michaelis-Menten equation provided corresponding kinetic parameters.
[0070] Kinetic behavior for 8-aza-SAM against MTases (acceptor sat.)—Briefly, kinetic parameters were determined at 20° C. in a UV-Star 96-well flat bottom plate (Greiner Bio-One, #655801) by continuous monitoring of absorbance at 282 nm using a SpectraMax M5 instrument (Molecular Devices). As for SAM experiments, the measurements consisted of two experimental subsets: MTase reactions (both 8-aza-SAM and acceptor added) and MTase blanks (8-aza-SAM was added without acceptor to account for natural 8-aza-SAM decomposition). The 250-μL (60-μL) reaction mixtures from a same row contained 50 mM phosphate buffer pH=7.60 (7.80), 1 mM βME, 10% glycerol (5% glycerol, 100 μM MgCl.sub.2), 4 μM coupling deaminase TM0936, either 1.5 μM CePRMT5 or 402 nM TbPRMT7 (or 610 nM GsSDMT) and various 8-aza-SAM concentrations. Absorbance at 282 nm was recorded after addition of either H4.sub.(1-20) (104 μM saturating final concentration; MTase reactions) or water (MTase blanks) (of either sarcosine (5 mM saturating final concentration; MTase reactions) or water (MTase blanks)). Initial rates were first corrected for background signal, then plotted against 8-aza-SAM concentrations and fitted to the Michaelis-Menten equation to yield corresponding kinetic parameters. The kinetic data from CePRMT5 were fit to the following Eq. 6 to reflect substrate inhibition observed at higher 8-aza-SAM concentration:
where [MTase] and [8-aza-SAM] are the total concentration of methyltransferase and methyl donor, respectively; K.sub.m is the Michaelis constant, K.sub.f is the substrate inhibition constant and k.sub.cat is the turnover for 8-aza-SAM substrate. Please note that DIM-5 was unable to accept 8-aza-SAM substrate.
Study of GsSDMT Inhibition by Sinefungin (UV-Mode)
[0071] Briefly, kinetic parameters were determined at 20° C. in a UV-Star 96-well flat bottom plate (Greiner Bio-One, #655801) by continuous monitoring of absorbance at 263 nm using a SpectraMax M5 instrument (Molecular Devices). The 100-μL reaction mixtures from a set of two rows contained 100 mM phosphate buffer pH=6.80, 1 mM βME, 5% glycerol, 100 AM MgCl.sub.2, 4 μM coupling deaminase TM0936, 195 nM GsSDMT, saturating level of SAM (763 μM) and various sinefungin concentrations (0.8-244 μM). In the first row, the sarcosine acceptor was omitted to account for background signal (i.e. natural catabolism of sinefungin and SAM decomposition). The methyltransfer reactions started upon addition of sarcosine (5 mM saturating final concentration). Volumes (60-μL) were transferred onto plate and absorbance signals were recorded. The initial rates of the reactions were corrected using data from first row experiments and plotted against sinefungin concentrations. Fit to the following Eq. 7 provided corresponding inhibition constant (K.sub.i):
where V and V.sub.0 are the initial velocity with and without inhibitor, respectively. The Michelis constant for SAM substrate is depicted as K.sub.m and [SAM] is the concentration of this same molecule. The inhibition constant for sinefungin is represented by K.sub.i and [SIN] is the concentration of this inhibitor. The parameter γ is the Hill coefficient.
The Kcat and Kcat/Km pH-Dependence for the GsSDMT Reaction
[0072] Experiments were conducted following GsSDMT protocol above using 100 mM buffer (pH 5.80-9.88), 1 mM βME, 5% glycerol, 100 μM MgCl.sub.2, 4 μM coupling deaminase TM0936, 976 nM GsSDMT and various sarcosine concentrations (0.5-12.5 mM; in the first well, sarcosine was omitted to account for background signal—natural decomposition of SAM). Reactions started upon addition of SAM (750 μM saturating final concentration) and 60-μL volumes were transferred onto UV-plate. Absorbance at 263 nm was recorded. After correction for background signal, initial velocities were plotted against sarcosine concentrations. Fit to the Michaelis-Menten equation provided corresponding K.sub.m and k.sub.cat. Both kinetic parameters were used to plot the corresponding pHdependences using the two following Eq. 8 and Eq. 9 (85):
where Km and kcat are the Michaelis constant and turnover value, respectively, for sarcosine substrate at saturating levels of SAM (750 μM). V.sub.max.sup.MAX is the maximum velocity ever achieved by the GsSDMT enzyme over the full pH-range. The −pK.sub.a.sup.1 and −pK.sub.a.sup.2 are the logarithm of acid dissociation constant for a first and a second ionizable group of important entities: these entities are free sarcosine and GsSDMT•SAM complex.
where k.sub.cat is turnover value for sarcosine substrate at saturating levels of SAM (750 μM); k.sub.cat.sup.MAX is maximum turnover value for sarcosine substrate ever reached; the parameter −pK.sub.a1 is the logarithm of the acid dissociation constant from a crucial ionizable group onto the GsSDMT•SAM•sarcosine complex.
Impact of Ionic Strength onto Km for H4.sub.(1-20) (TbPRMT7)
[0073] Experiments were conducted following TbPRMT7 protocol above. Briefly, the 250-μL reaction mixtures from a same row contained either 25, 50, 75 or 100 mM phosphate buffer pH=7.60, 1 mM βME, 10% glycerol, 4 μM coupling deaminase TM0936, 1.0 μM TbPRMT7 and various peptide concentrations (16.6-243.3 μM; in the first well, peptide acceptor was omitted to account for background signal—natural decomposition of SAM). Reactions started upon addition of SAM (25.8 μM saturating final concentration) and absorbance was recorded. Initial rates were first corrected for background signal, then plotted against H4.sub.(1-20) concentrations. The four fits to the Michaelis-Menten equation (k.sub.cat fixed at 29 h.sup.−1) provided corresponding K.sub.m values and established impact of ionic strength onto this kinetic parameter.
Fluorescence-Based Coupled Assay
[0074] Calibration of fluorescence signal for the 8-aza-A to 8-aza-I reaction—This procedure is very similar to the one described under “Differential Extinction Coefficients (Δε) for Deaminase Reaction”. Briefly, standard solutions (240 μL) of 8-aza-adenosine (0-25 μM; 12 data points) containing 50 mM buffer (pH 5.00-9.50), 10% glycerol and 1 mM βME, were loaded into a %-well black flat bottom plate. 10-μL water per well were added to one data-set (12 concentrations of 8-aza-adensoine); 10-μL TM0936 solution (24.05 μM) were added to the remaining samples (12 concentrations of 8-azaadenosine at various pH values). The loss of fluorescence (Em=360 nm) from 8-azaadenosine standard solutions (Ex=282/292 nm) where recorded with a Spectramax M5 plate reader until no change in signal could be observed.
[0075] At a same pH, the comparison between end-point deaminase reactions and reference well (TM0936 added but no 8-aza-adenosine) provided the pH-dependence of 8-azainosyl fluorescence. Using the Ex/Em pair (282/360 nm), the data fit to the Eq. 2 provided the following parameters: FLUO.sub.LOW pH=0 RLU μM.sup.−1, FLUO.sub.HIGH pH=35.0±0.5 RLU μM.sup.−1, pK.sub.a=7.50±0.03. Likewise, using the Ex/Em pair (292/360 mu), the data fit to the Eq. 2 provided the following parameters: FLUO.sub.LOW pH=1.5±0.3 RLU μM.sup.−1, FLUO.sub.HIGH pH=22.0±0.3 RLU μM.sup.−1, pK.sub.a=7.54±0.04. Furthermore, the comparison between end-point deaminase reactions and reference well (various 8-aza-adenosine concentrations but no TM0936 added) provided the calibration curve of fluorescence signal for the 8-aza-adenosine to 8-aza-ionisine reaction. Using the Ex/Em pairs (282/360 and 292/360 mu), the data fit to the Eq. 10 provided the calibration parameters. ΔFLUO=a[8-aza-A].sup.2+b[8-aza-A]+c These parameters are summarized in Table 2.
[0076] Kinetic behavior for H4.sub.(1-20) against TbPRM77 using 8-aza-SAM—Experiments were conducted following TbPRMT7 protocol above. Briefly, the 250-μL reaction mixtures from a same row contained 25 mM phosphate buffer pH=7.60, 1 mM βME, 10% glycerol, 4 μM coupling deaminase TM0936, 805.2 nM TbPRMT7 and various peptide concentrations (0-144.55 μM. The first well contained only 8-aza-SAM without any coupling enzyme, nor methyltransferase; in the second well, peptide acceptor was omitted to account for background signal—natural decomposition of 8-aza-SAM). Reactions started upon addition of cofactor (25.0 μM saturating final concentration) and absorbance was recorded. Initial rates were first corrected for background signal, then plotted against H4.sub.(1-20) concentrations. The data fit to the Michaelis-Menten equation S5 provided corresponding k.sub.cat of 39±2h.sup.−1 and a Km value of 71±8 μM.
Results and Discussion
[0077] The deaminase TM0936 is a prime-choice candidate for MTase assays. We used a two-step purification of TM0936 as a polyhistidine-tagged protein expressed in bacteria. The high-purity enzyme from the hyperthermophile Thermotoga maritima can sustain multiple freeze/thaw cycles, it remains unable to catabolize SAM and it displays an excellent reactivity towards SAH at room temperature (K.sub.m=0.6±0.2 μM, k.sub.cat=7.1±0.4 s.sup.−1) (41,43).
[0078] Coupled-enzyme assays for MTase reactions are based on the same principal of rapid channeling of SAH to a signal output so that SAH is virtually absent and coupling enzymes are not rate-limiting. Thus, the signal output solely reflects the MTase reaction. In our hands, commercial kits for detection of methyl transfer (
[0079] We previously developed methods for detection of SAH and its derivatives (e.g. adenosine, adenine) (37,45). Although we routinely use these highly sensitive luciferase-based coupled assays (46), we encountered limitations. The preparation of four highly purified recombinant enzymes (i.e. MTAN, APRT, PPDK, FLUC) is a tedious process and batch-to-batch reproducibility may be an issue. Furthermore, the coupling buffer requires 5-phospho-a-D-ribosyl-1-pyrophosphate (PRPP), a highly unstable and expensive substrate to fuel APRT. Therefore, based on the TM0936 performance, we developed the 1-Step EZ-MTase assay to provide a simple and robust method for measuring SAM consumption.
[0080] Spectral signature of the SAH deamination reaction catalyzed by TM0936. To determine the precise relationship between absorbance and concentration for the adenosyl to inosyl conversion, we measured the differential extinction coefficient from the reaction catalyzed by TM0936. A nucleoside absorbance spectrum (i.e. maximum absorption wavelength λ max, extinction coefficient e) is pH-dependent, thus reflects the ionization state of this molecule. The adenosine UV-signature remains unchanged in water under most conditions (neutral species at pH>3.6); however, inosine may behave differently as it becomes deprotonated in alkaline solutions (pK.sub.a=8.9) (47,48).
[0081] We established the Δε=f(pH) relationship for the deamination(
[0082] In addition, similar Δε=f(pH) relationships were established at 282 and 292 nm for the 8-aza-adenosine (8-aza-A) to 8-aza-inosine (8-aza-I) reaction (
[0083] Kinetic parameters from four methyltransferases using 1-Step EZ-MTase. To establish a coupled assay that can sample the vast majority of MTase targets, all having diverse kinetic properties (range of SAM concentrations: 1-1000 mM;
[0084] We tested this coupled assay with four unique methyltransferases. TM0936 (4 μM) was coupled to these transferases to establish their kinetic behavior: determination of Michaelis constant (K.sub.m) and catalytic turnover (k.sub.cat) for either SAM or acceptor substrate. Using the protein arginine methyltransferase from Caenorhabditis elegans (CePRMT5) and saturating levels of SAM (25 μM), we determined the kinetic profile as a function of the peptide H4.sub.(1-20) concentration (6-180 μM, at 300 nM CePRMT5). The data fit to the Morrison equation (52) gives a K.sub.m of 26±2 μM and a k.sub.cat of 32.9±0.8 h.sup.−1 (
[0085] TM0936 activity is resilient to pH variations. Another key limitation to the luciferase-based assays is their sensitivity in different chemical environments, as the detection is optimum at a very narrow pH value (≈7.7) and luminescence output is drastically reduced upon pH variations. As the pH decreases, so does the green component of the luminescence; light was no longer detected under acidic conditions (pH<6.0)(55). Therefore, key mechanistic insights are undetectable with this assay as it is impossible to describe MTase enzymology over a wide pH-range.
[0086] In contrast, TM0936 displays a sustained activity across a broad pH-range (
[0087] Fitted to the Eq. 8, the log k.sub.cat/K.sub.m vs. pH displays a symmetrical bell-shaped curve with an optimum enzymatic activity between pH 7.5-8.5; pK.sub.a values of 6.87±0.05 and 9.2±0.1 were assigned to the ascending and descending limbs, respectively (
[0088] The log k.sub.cat plotted against pH (
[0089] One single structure of SDMT has been reported (54). We successfully superimposed this structure (PDB: 2O57) (54) with the SAH•sarcosine complex of the glycine sarcosine N-methyltransferase from Methanohalophilus portucalensis (MpGSMT; PDB: 5HIL) (61). Both structures display a good alignment of their N-terminus and the cofactor binding site was easily identified within this conserved domain. Indeed, SAM interacts with key conserved amino-acids: π-stacking between adenosine and W115, stabilization of the ribosyl through hydrogen bond with D88 (F141 and N112 from GsSDMT are predicted to be homologous). Likewise, the homocysteyl binding-mode depicted additional groups involved in stabilization of the cofactor. Residues R60, A91 and Q157 from GsSDMT are structurally homologous to R43, A67 and L132 from MpGSMT, respectively; thus we hypothesize their interaction with the homocysteyl moiety from SAM/SAH. Although the sarcosine binding site is located within the most divergent region of the structures (C-terminus), we identified Y242 (Y206 structural homolog in MpGSMT) and H241 from GsSDMT as potential candidates involved in sarcosine stabilization via hydrogen bond with the carboxylate tail. Furthermore, the histidine H162 from GsSDMT, also present in MpGSMT (H138), may influence methyl transfer rate since it is equidistant from both nitrogen and sulfur reactive centers from sarcosine and SAH, respectively.
[0090] TM0936 activity is resilient to variations of ionic strength. We previously established the role of the MEP50 WD-repeat protein in presenting histone substrates to the PRMT5 active site (46). To measure the sub-micromolar affinity between MEP50 and H4.sub.(1-20) peptide, we relieved methyl transfer activity through titration of exogenous MEP50. Many WD-repeat proteins are highly hydrophobic and require high salt concentrations to promote their solubility (62). Although we had monitored methyl transfer with the highly sensitive luciferase coupled assay, it was critical to maintain ionic strength constant throughout MEP50 titration (46). Indeed, a slight increasing in salt concentration drastically decreases FLUC light output, making FLUC-based assays more difficult. Importantly, TM0936 was not affected by increasing levels of salt. In our hands, the deaminase steadily catabolized adenosine (10 AM), even at sodium chloride concentrations as high as 2M (
[0091] To test the utility of this new assay in varied ionic conditions, we measured histone methyltransferase activity. Histone tails are positively charged under physiological conditions, as they are enriched in lysine and arginine residues; this electrostatic property may partially account for binding of these substrates onto MTase target. Using TbPRMT7, we determined the kinetic behavior for H4.sub.(1-20) peptide at four phosphate concentrations (pH=7.60, 25-100 mM). The initial rates were plotted against peptide concentrations (
[0092] 1-Step EZ-MTase is well suited for high-throughput screening. Our analytical tool provides an alternative to overcome major drawbacks from previous MTase assays (
[0093] Sinefingin is a potent, yet non-selective inhibitor of MTAse; so it often serves as positive control during inhibitor screening. On one hand, sinefungin is a known inhibitor of SAHH enzyme (36,65); on the other hand, MTAN catabolizes sinefungin into adenine (
[0094] Taking advantage of this substrate selectivity, we measured (pH=6.80) the inhibition constant (K.sub.i) for sinefungin against GsSDMT (
[0095] 8-aza-SAM and its application to the 1-Step EZ-MTase assay. A second mode of detection, complementary to the current UV-based assay, may present advantages. The use of a fluorescent cofactor analog may improve detection specificity compared with UV absorption. 8-aza-adenosine is an isosteric and fluorescent analog of the nucleoside. When excited at 282 nm, this probe exhibits a strong fluorescence signature with a maximum at 360 nm (50). This characteristic is not shared with the 8-aza-inosine and this deaminated product is a weak fluorophore (50). Several SAM analogs, including the 8-aza modification, are biologically active and display affinity with the SAM-III riboswitch, the EcoRI methyltransferase and other MTases (44,66). Therefore, we anticipated this probe may be used in place of the natural cofactor.
[0096] We successfully resynthesized 8-aza-SAM through reaction between 8-aza-ATP and L-methionine (66). SAM isomerizes readily at the sulfonium center and only the S(S)-epimer is biologically active. Thus, with performed a short reaction at 35° C. (enzyme:triphosphate, 1:400) to limit such epimerization and yield 8-aza-SAM (65% yield, 5% S(R)-epimer; cf. NMR analysis). Although 8-aza-ATP was commercially available (TriLink Biotechnologies, #N-1004), this molecule is extremely expensive; thus, we synthesize this chemical through multiple phosphorylation of the more affordable 8-aza-adenosine. This approach is reminiscent of a strategy we previously applied towards the preparation of a C-P lyase inhibitor (67). Performed on a 50-mg scale and in a 2-mL tube, this one-pot synthesis provides an easy access to high quantities of pure 8-aza-ATP (95%; cf. Enzymatic Syntheses).
[0097] We further assayed the reactivity of 8-aza-SAM towards our methyltransferases. This analog was well tolerated by our candidates since only NcDIM-5 was unable to process this cofactor. Likewise, the 8-aza-SAH product of methyltransfer reactions (λmax=280 nm) was successfully converted into the deaminated 8-aza-SIH (λmax=254 nm;
[0098] With the relevance of 8-aza-SAM validated, we then calibrated the fluorescence signal at 360 nm for the 8-aza-adenosine (8-aza-A) to 8-aza-inosine (8-aza-I) reaction using two excitation wavelengths (i.e. 282 and 292 nm). The 282 nm excitation provided a higher limit of detection for 8-aza-A and fluorescence signal was most intense (≈2-fold;
[0099] Glycine N-methyltransferase (GNMT) is a key component of SAM homeostasis. As a methionine-rich diet replenishes the SAM pool, the increasing concentration of methyl donor inhibits the 5,10-methylene-tetrahydrofolate reductase, thus impairing the 5-methyltetrahydrofolate (5-CH.sub.3-THF) synthesis. GNMT is a folate-binding protein and 5-CH.sub.3-THF is deleterious to its activity. Within this feedback mechanism, the alleviating GNMT inhibition promotes SAM consumption through sarcosine synthesis. GNMT establishes the cross talk between the one carbon folate pathway and the methionine cycle, thereby maintaining a healthy SAM/SAH ratio, which is indicative of methylator potential.
[0100] Development of improved assays for probing GNMT activity within biological samples is important to accelerate understanding of the interplay among metabolic pathways, energetics, epigenetics and cancer metabolism. However, classical methods using tritiated SAM, and the detection of radioactive sarcosine within crude protein extracts is a tedious and discontinuous approach. Furthermore, valuable tissue samples from animal studies may be limited and the requirement for large amounts of extract (e.g. 250 μg total protein) may be challenging when using this method. To overcome these drawbacks, we optimized the 1-Step EZ-MTase platform and made it compatible with biological samples. Using protein extracts from rat liver, we successfully quantitated GNMT activity within these crude biological samples (
[0101] The deamination reaction catalyzed by TM0936 only occurs with SAH, methylthioadenosine and adenosine. The substrate specificity of our coupling enzyme makes it compatible with the highly complex content of biological samples. Luciferase-based assays are not suited for such a type of sample where adenine and phosphorylated adenosine species generate high background signal. Likewise, endogenous thiol species (e.g. glutathione, homocysteine, cysteine residues from proteins) preclude the continuous detection of GNMT activity through efficient derivatization of homocysteine (e.g. Ellman's reagent, ThioGlo®-1). In addition to reacting with these thiol species, the 5,5′-dithio-bis-(2-nitrobenzoic acid) completely inactivates the methyltransferase upon reaction with its cysteine residues.
[0102] In our hand, GNMT activity was not affected by the tissue lysis buffer (150 mM NaCl, 20 mM Tris-HCl pH=7.4, 1% Triton X-100, 1 mM orthovanadate, 1 mM EDTA, 10 mM NaF, 1× protease inhibitor cocktail, and 1 mM PMSF), thus establishing the compatibility between this universal reagent and the 1-Step EZ-MTase (
[0103] The decrease of absorbance at 263 nm is concentration dependent and levels as low as 30 μg of total protein were sufficient to monitor sarcosine synthesis over an extended period (
Conclusion
[0104] Epigenetic modifications catalyzed by methyltransferases play a central role in gene transcription and parental imprinting. A correlation between dysregulation of methylation patterns and occurrence of human diseases (e.g. cancer, diabetes) is becoming more obvious. Several methyltransferases are now validated therapeutic targets. The regulation of these enzymatic activities by specific and potent inhibitors may offer new opportunities for patients. To promote our understanding of methyltransferases and the discovery of new chemotherapeutics, we have developed a simple and straightforward assay to study this class of enzymes. Unlike anything else available, this analytical tool harnesses the power of one single protein: the SAH-deaminase TM0936. The coupling enzyme is easily accessible, it is also a powerful and sturdy catalyst that allows for quick and facile determination of enzymatic rates through monitoring of absorbance at 263 nm. We demonstrated its use by coupling it to a panel of four enzymes including lysine and arginine methyltransferases. A 96-well plate format allowed high-throughput performance of the assay. It detects transfer rates as low as 2 mM h.sup.−1, accommodates nanomolar MTase concentration and display high Z′-factors, thus reflecting the overall quality of this assay. Furthermore, sinefungin is compatible with this coupled assay, so the tool may have a significant impact on the identification of new inhibitors using high throughput screening. We implemented a second mode of detection, providing users with the option to detect methyl transfer through monitoring the loss of fluorescence at 360 nm. This approach relies on 8-aza-SAM, a fluorescent analog of the universal methyl donor. We established the relevance of this alternative cofactor and determine kinetic properties of the PRMT7 from Trypanosoma brucei using H4.sub.(1-20) peptide.
TABLE-US-00004 TABLE 1 The kinetic parameters K.sub.m and k.sub.cat for several methyltransferases, using SAM and 8-aza-SAM as methyl donor and several methyl acceptors. K.sub.m K.sub.cat CePRMT5 SAM 6.8 ± 0.3 μM 31.9 ± 0.5 h.sup.−1 H4.sub.(1-20) 26 ± 2 μM 32.9 ± 0.8 h.sup.−1 8-aza-SAM 35 ± 20 μM 15 ± 6 h.sup.−1 TbPRMT7 SAM 1.1 ± 0.2 μM 22.3 ± 0.6 h.sup.−1 H4.sub.(1-20) 39 ± 3 μM 28.2 ± 0.7 h.sup.−1 8-aza-SAM 15.3 ± 0.7 μM 23.0 ± 0.4 h.sup.−1 NcDIM-5 SAM.sup.a 0.68 ± 0.20 μM 3.1 h.sup.−1 H3.sub.(1-53) 0.9 ± 0.1 μM 30 ± 1 min.sup.−1 8-aza-SAM NOT A NOT A GsSDMT SAM 95 ± 18 μM 42 ± 2 min.sup.−1 Sarcosine 1.7 ± 0.2 μM 90 ± 5 min.sup.−1 8-aza-SAM 443 ± 33 μM 81 ± 3 min.sup.−1 .sup.aFrom P. Rathert, X. Cheng and A. Jeltsch, BioTechniques, 2007, 43, 602, 604, 606.
TABLE-US-00005 TABLE 2 Parameters for data fit regarding calibration of fluorescence signal for the 8-aza-adenosine to 8-aza-inosine reaction. Experiments performed at pH = 5.00 and pH = 9.50. ΔFLUO (RFU) = a [8-aza-A].sup.2 + b [8-aza-A] + c CURVES Ex/Em 282/360 nm pH = 5.00 −3.4 ± 0.2 450 ± 4 185 pH = 9.50 −3.2 ± 0.1 414 ± 2 185 Ex/Em 282/360 nm pH = 5.00 −1.3 ± 0.1 253 ± 3 118 pH = 9.50 −1.32 ± 0.06 236 ± 1 118
REFERENCES
[0105] 1. F. Wold, Annual review of biochemistry, 1981, 50, 783-814. [0106] 2. T. Hitosugi and J. Chen, Oncogene, 2014, 33, 4279-4285. [0107] 3. A. P. Lothrop, M. P. Torres and S. M. Fuchs, FEBS letters, 2013, 587, 1247-1257. [0108] 4. G. L. Cantoni, Journal of the American Chemical Society, 1952, 74, 2942-2943. [0109] 5. J. Axelrod and R. Tomchick, The Journal of biological chemistry, 1958, 233, 702-5. [0110] 6. G. L. Cantoni, The Journal of biological chemistry, 1951, 189, 203-216. [0111] 7. J. Song, M. Teplova, S. Ishibe-Murakami and D. J. Patel, Science, 2012, 335, 709-12. [0112] 8. S. S. Wolf, Cellular and molecular life sciences: CMLS, 2009, 66, 2109-2121. [0113] 9. Y. Yang and M. T. Bedford, Nature reviews. Cancer, 2013, 13, 37-50. [0114] 10. A. J. Ruthenburg, C. D. Allis and J. Wysocka, Molecular cell, 2007, 25, 15-30. [0115] 11. H. Chen, B. Lorton, V. Gupta and D. Shechter, Oncogene, 2016, DOI: 10.1038/onc.2016.205. [0116] 12. P. Chi, C. D. Allis and G. G. Wang, Nature reviews. Cancer, 2010, 10, 457-469. [0117] 13. C. Sawan and Z. Herceg, Advances in genetics, 2010, 70, 57-85. [0118] 14. X. Bao, S. Zhao, T. Liu, Y. Liu, Y. Liu and X. Yang, The journal of histochemistry and cytochemistry: official journal of the Histochemistry Society, 2013, 61, 206-217. [0119] 15. K. Mathioudaki, A. Scorilas, A. Ardavanis, P. Lymberi, E. Tsiambas, M. Devetzi, A. Apostolaki and M. Talieri, Tumour biology: the journal of the International Society for Oncodevelopmental Biology and Medicine, 2011, 32, 575-582. [0120] 16. C. Milite, A. Feoli, M. Viviano, D. Rescigno, A. Cianciulli, A. L. Balzano, A. Mai, S. Castellano and G. Sbardella, Clinical epigenetics, 2016, 8, 102. [0121] 17. A. T. Nguyen and Y. Zhang, Genes & development, 2011, 25, 1345-1358. [0122] 18. L. Wang, Z. Zhao, M. B. Meyer, S. Saha, M. Yu, A. Guo, K. B. Wisinski, W. Huang, W. Cai, J. W. Pike, M. Yuan, P. Ahlquist and W. Xu, Cancer cell, 2014, 25, 21-36. [0123] 19. S. R. Daigle, E. J. Olhava, C. A. Therkelsen, A. Basavapathruni, L. Jin, P. A. Boriack-Sjodin, C. J. Allain, C. R. Klaus, A. Raimondi, M. P. Scott, N. J. Waters, R. Chesworth, M. P. Moyer, R. A. Copeland, V. M. Richon and R. M. Pollock, Blood, 2013, 122, 1017-1025. [0124] 20. E. Chan-Penebre, K. G. Kuplast, C. R. Majer, P. A. Boriack-Sjodin, T. J. Wigle, L. D. Johnston, N. Rioux, M. J. Munchhof, L. Jin, S. L. Jacques, K. A. West, T. Lingaraj, K. Stickland, S. A. Ribich, A. Raimondi, M. P. Scott, N. J. Waters, R. M. Pollock, J. J. Smith, O. Barbash, M. Pappalardi, T. F. Ho, K. Nurse, K. P. Oza, K. T. Gallagher, R. Kruger, M. P. Moyer, R. A. Copeland, R. Chesworth and K. W. Duncan, Nature chemical biology, 2015, 11, 432-437. [0125] 21. A. Finley and R. A. Copeland, Chemistry & biology, 2014, 21, 1196-1210. [0126] 22. H. Gowher and A. Jeltsch, Journal of molecular biology, 2001, 309, 1201-1208. [0127] 23. M. S. Kareta, Z. M. Botello, J. J. Ennis, C. Chou and F. Chedin, The Journal of biological chemistry, 2006, 281, 25893-25902. [0128] 24. B. B. Suh-Lailam and J. M. Hevel, Analytical biochemistry, 2010, 398, 218-224. [0129] 25. C. Wilczek, R. Chitta, E. Woo, J. Shabanowitz, B. T. Chait, D. F. Hunt and D. Shechter, The Journal of biological chemistry, 2011, 286, 42221-42231. [0130] 26. N. Gauthier, M. Caron, L. Pedro, M. Arcand, J. Blouin, A. Labonte, C. Normand, V. Paquet, A. Rodenbrock, M. Roy, N. Rouleau, L. Beaudet, J. Padros and R. Rodriguez-Suarez, Journal of biomolecular screening, 2012, 17, 49-58. [0131] 27. K. Devkota, B. Lohse, C. N. Jakobsen, J. Berthelsen and R. P. Clausen, Analytical biochemistry, 2015, 476, 78-80. [0132] 28. G. Ibanez, J. L. McBean, Y. M. Astudillo and M. Luo, Analytical biochemistry, 2010, 401, 203-210. [0133] 29. I. Hemeon, J. A. Gutierrez, M. C. Ho and V. L. Schramm, Analytical chemistry, 2011, 83, 4996-5004. [0134] 30. K. M. Dorgan, W. L. Wooderchak, D. P. Wynn, E. L. Karschner, J. F. Alfaro, Y. Cui, Z. S. Zhou and J. M. Hevel, Analytical biochemistry, 2006, 350, 249-255. [0135] 31. S. Duchin, Z. Vershinin, D. Levy and A. Aharoni, Epigenetics & chromatin, 2015, 8, 56. [0136] 32. C. L. Hendricks, J. R. Ross, E. Pichersky, J. P. Noel and Z. S. Zhou, Analytical biochemistry, 2004, 326, 100-105. [0137] 33. E. Collazo, J. F. Couture, S. Bulfer and R. C. Trievel, Analytical biochemistry, 2005, 342, 86-92. [0138] 34. C. Wang, S. Leffler, D. H. Thompson and C. A. Hrycyna, Biochemical and biophysical research communications, 2005, 331, 351-356. [0139] 35. T. A. Klink, M. Staeben, K. Twesten, A. L. Kopp, M. Kumar, R. S. Dunn, C. A. Pinchard, K. M. Kleman-Leyer, M. Klumpp and R. G. Lowery, Journal of biomolecular screening, 2012, 17, 59-70. [0140] 36. K. M. Drake, V. G. Watson, A. Kisielewski, R. Glynn and A. D. Napper, Assay and drug development technologies, 2014, 12, 258-271. [0141] 37. E. S. Burgos, S. A. Gulab, M. B. Cassera and V. L. Schramm, Analytical chemistry, 2012, 84, 3593-3598. [0142] 38. T. L. Graves, Y. Zhang and J. E. Scott, Analytical biochemistry, 2008, 373, 296-306. [0143] 39. J. K. Coward and F. Y. Wu, Analytical biochemistry, 1973, 55, 406-410. [0144] 40. F. Schlenk, C. R. Zydek-Cwick and N. K. Hutson, Archives of biochemistry and biophysics, 1971, 142, 144-149. [0145] 41. J. C. Hermann, R. Marti-Arbona, A. A. Fedorov, E. Fedorov, S. C. Almo, B. K. Shoichet and F. M. Raushel, Nature, 2007, 448, 775-779. [0146] 42. R. Guan, M. C. Ho, R. F. Frohlich, P. C. Tyler, S. C. Almo and V. L. Schramm, Biochemistry, 2012, 51, 9094-9103. [0147] 43. D. S. Hitchcock, H. Fan, J. Kim, M. Vetting, B. Hillerich, R. D. Seidel, S. C. Almo, B. K. Shoichet, A. Sali and F. M. Raushel, Journal of the American Chemical Society, 2013, 135, 13927-13933. [0148] 44. R. T. Borchardt, J. A. Huber and Y. S. Wu, J Med Chem, 1974, 17, 868-873. [0149] 45. K. Thomas, A. M. Haapalainen, E. S. Burgos, G. B. Evans, P. C. Tyler, S. Gulab, R. Guan and V. L. Schramm, Biochemistry, 2012, 51, 7541-7550. [0150] 46. E. S. Burgos, C. Wilczek, T. Onikubo, J. B. Bonanno, J. Jansong, U. Reimer and D. Shechter, The Journal of biological chemistry, 2015, 290, 9674-9689. [0151] 47. J. J. Christensen, J. H. Rytting and R. M. Izatt, Biochemistry, 1970, 9, 4907-4913. [0152] 48. J. Saevels, A. Zanoletty Perez, A. Salvat Jauma, A. Van Schepdael and J. Hoogmartens, Chromatographia, 1998, 47, 225-229. [0153] 49. G. Cercignani, Analytical biochemistry, 1987, 166, 418-423. [0154] 50. J. Wierzchowski, B. Wielgus-Kutrowska and D. Shugar, Biochimica et biophysica acta, 1996, 1290, 9-17. [0155] 51. J. Wierzchowski, J. M. Antosiewicz and D. Shugar, Molecular bioSystems, 2014, 10, 2756-2774. [0156] 52. J. F. Morrison and C. T. Walsh, Advances in enzymology and related areas of molecular biology, 1988, 61, 201-301. [0157] 53. H. Gowher, X. Zhang, X. Cheng and A. Jeltsch, Analytical biochemistry, 2005, 342, 287-291. [0158] 54. J. G. McCoy, L. J. Bailey, Y. H. Ng, C. A. Bingman, R. Wrobel, A. P. Weber, B. G. Fox and G. N. Phillips, Jr., Proteins, 2009, 74, 368-377. [0159] 55. Y. Wang, H. Akiyama, K. Terakado and T. Nakatsu, Scientific reports, 2013, 3, 2490. [0160] 56. V. Vanek, M. Budesinsky, P. Kabeleova, M. Sanda, M. Kozisek, I. Hanclova, J. Mladkova, J. Brynda, I. Rosenberg, M. Koutmos, T. A. Garrow and J. Jiracek, J Med Chem, 2009, 52, 3652-3665. [0161] 57. A. Sakamoto and N. Murata, Plant, cell & environment, 2002, 25, 163-171. [0162] 58. A. Nyyssola, T. Reinikainen and M. Leisola, Applied and environmental microbiology, 2001, 67, 2044-2050. [0163] 59. R. Waditee, Y. Tanaka, K. Aoki, T. Hibino, H. Jikuya, J. Takano, T. Takabe and T. Takabe, The Journal of biological chemistry, 2003, 278, 4932-4942. [0164] 60. J. P. Kallio, J. Janis, A. Nyyssola, N. Hakulinen and J. Rouvinen, Acta crystallographica. Section F, Structural biology and crystallization communications, 2009, 65, 805-808. [0165] 61. Y. R. Lee, T. S. Lin, S. J. Lai, M. S. Liu, M. C. Lai and N. L. Chan, Scientific reports, 2016, 6, 38071. [0166] 62. T. F. Smith, C. Gaitatzes, K. Saxena and E. J. Neer, Trends in biochemical sciences, 1999, 24, 181-185. [0167] 63. E. W. Debler, K. Jain, R. A. Warmack, Y. Feng, S. G. Clarke, G. Blobel and P. Stavropoulos, Proceedings of the National Academy of Sciences of the United States of America, 2016, 113, 2068-2073. [0168] 64. J. H. Zhang, T. D. Chung and K. R. Oldenburg, Journal of biomolecular screening, 1999, 4, 67-73. [0169] 65. K. Fabianowska-Majewska, J. A. Duley and H. A. Simmonds, Biochemical pharmacology, 1994, 48, 897-903. [0170] 66. O. M. Ottink, F. H. Nelissen, Y. Derks, S. S. Wijmenga and H. A. Heus, Analytical biochemistry, 2010, 396, 280-283. [0171] 67. S. S. Kamat, E. S. Burgos and F. M. Raushel, Biochemistry, 2013, 52, 7366-7368. [0172] 68. R. M. McCarty, C. Krebs and V. Bandarian, Biochemistry, 2013, 52, 188-198. [0173] 69. B. R. Branchini, M. H. Murtiashaw, R. A. Magyar and S. M. Anderson, Biochemistry, 2000, 39, 5433-5440. [0174] 70. M. B. Cassera, M. C. Ho, E. F. Merino, E. S. Burgos, A. Rinaldo-Matthis, S. C. Almo and V. L. Schramm, Biochemistry, 2011, 50, 1885-1893. [0175] 71. Z. J. Lu and G. D. Markham, The Journal of biological chemistry, 2002, 277, 16624-16631. [0176] 72. F. Garrido, C. Alfonso, J. C. Taylor, G. D. Markham and M. A. Pajares, Biochimica et biophysica acta, 2009, 1794, 1082-1090. [0177] 73. J. G. McCoy, L. J. Bailey, Y. H. Ng, C. A. Bingman, R. Wrobel, A. P. Weber, B. G. Fox and G. N. Phillips, Jr., Proteins, 2009, 74, 368-377. [0178] 74. L. Sun, M. Wang, Z. Lv, N. Yang, Y. Liu, S. Bao, W. Gong and R. M. Xu, Proceedings of the National Academy of Sciences of the United States of America, 2011, 108, 20538-20543. [0179] 75. M. Wang, R. M. Xu and P. R. Thompson, Biochemistry, 2013, 52, 5430-5440. [0180] 76. E. W. Debler, K. Jain, R. A. Warmack, Y. Feng, S. G. Clarke, G. Blobel and P. Stavropoulos, Proceedings of the National Academy of Sciences of the United States of America, 2016, 113, 2068-2073. [0181] 77. X. Zhang, H. Tamaru, S. I. Khan, J. R. Horton, L. J. Keefe, E. U. Selker and X. Cheng, Cell, 2002, 111, 117-127. [0182] 78. E. S. Burgos, C. Wilczek, T. Onikubo, J. B. Bonanno, J. Jansong, U. Reimer and D. Shechter, The Journal of biological chemistry, 2015, 290, 9674-9689. [0183] 79. J. C. Hermann, R. Marti-Arbona, A. A. Fedorov, E. Fedorov, S. C. Almo, B. K. Shoichet and F. M. Raushel, Nature, 2007, 448, 775-779. [0184] 80. A. M. Haapalainen, K. Thomas, P. C. Tyler, G. B. Evans, S. C. Almo and V. L. Schramm, Structure, 2013, 21, 963-974. [0185] 81. Y. Wang, H. Akiyama, K. Terakado and T. Nakatsu, Scientific reports, 2013, 3, 2490. [0186] 82. G. Cercignani, Analytical biochemistry, 1987, 166, 418-423. [0187] 83. J. H. Zhang, T. D. Chung and K. R. Oldenburg, Journal of biomolecular screening, 1999, 4, 67-73. [0188] 84. J. F. Morrison, Biochimica et biophysica acta, 1969, 185, 269-286. [0189] 85. I. H. Segel, Enzyme kinetics. Behavior and analysis of rapid equilibrium and steady-state enzyme systems, John Wiley & Sons, Inc., New York, 1993.