LINKED AND OTHER pH-TRIGGERED COMPOUNDS
20240042063 ยท 2024-02-08
Inventors
- Yana K. Reshetnyak (Saunderstown, RI, US)
- Oleg A. Andreev (Saunderstown, RI, US)
- Donald M. Engelman (New Haven, CT)
Cpc classification
A61K47/65
HUMAN NECESSITIES
A61K47/42
HUMAN NECESSITIES
C07K2319/10
CHEMISTRY; METALLURGY
A61K47/64
HUMAN NECESSITIES
C07K14/00
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K47/65
HUMAN NECESSITIES
A61K47/42
HUMAN NECESSITIES
A61B5/00
HUMAN NECESSITIES
A61K47/64
HUMAN NECESSITIES
Abstract
Provided herein are, inter alia, pH-triggered compounds and compositions comprising one or more peptides that are capable of inserting into a lipid bilayer below a certain pH. Treatment, imaging, diagnostic, and other uses of such compounds and compositions are also provided.
Claims
1-43. (canceled)
44. A method of treating cancer in a subject, comprising administering to the subject an effective amount of a pH-triggered compound comprising a cargo compound that is covalently attached to a pH-triggered peptide that is covalently attached to at least one other pH-triggered peptide via a linker or a covalent bond.
45. The method of claim 44, wherein the pH-triggered compound comprises the following structure:
A-L-B wherein A is a first pH-triggered peptide comprising the sequence DDQNPWRAYLDLLFPTDTLLLDLLW (SEQ ID NO: 1), B is a second pH-triggered peptide comprising the sequence DDQNPWRAYLDLLFPTDTLLLDLLW (SEQ ID NO: 1), L is a polyethylene glycol linker, and each - is a covalent bond.
46. The method of claim 44, wherein the pH-triggered compound comprises at least one pH-triggered peptide comprising one or more of the following sequences: AYLDLLFP (SEQ ID NO: 4), YLDLLFPT (SEQ ID NO: 5), LDLLFPTD (SEQ ID NO: 6), DLLFPTDT (SEQ ID NO: 7), LLFPTDT (SEQ ID NO: 8), LFPTDTLL (SEQ ID NO: 9), FPTDTLLL (SEQ ID NO: 10), PTDTLLLD (SEQ ID NO: 11), TDTLLLDL (SEQ ID NO: 12), DTLLLDLL (SEQ ID NO: 13), or TLLLDLLW (SEQ ID NO: 14).
47. The method of claim 44, wherein the pH-triggered compound comprises at least one pH-triggered peptide comprising the sequence DDQNPWRAYLDLLFPTDTLLLDLLW (SEQ ID NO: 1).
48. The method of claim 44, wherein the pH-triggered compound has the following structure:
[A]k-linker wherein k is an integer from 2 to 32, and each A is, individually, a pH-triggered peptide comprising at least 8 consecutive amino acids, wherein (i) at least 4 of the at least 8 consecutive amino acids are non-polar amino acids, (ii) at least 1 of the at least 8 consecutive amino acids is protonatable, and (iii) the pH-triggered peptide has a higher affinity for a membrane lipid bilayer at pH 5.0 compared to the affinity at pH 8.0.
49. The method of claim 44, wherein the pH-triggered compound comprises at least two pH-triggered peptides with different amino acid sequences or wherein each pH-triggered peptide comprises the same amino acid sequence.
50. The method of claim 44, wherein (a) the cargo compound is polar or nonpolar; (b) the cargo compound comprises a marker; (c) the cargo compound comprises a prophylactic, therapeutic, diagnostic, radiation-enhancing, radiation-sensitizing, imaging, gene regulation, immune activation, cytotoxic, apoptotic, or research agent; (d) the cargo compound comprises a dye, a fluorescent dye, a fluorescence quencher, or a fluorescent protein; (e) the cargo compound comprises a magnetic resonance, positron emission tomography, single photon emission computed tomography, fluorescent, optoacoustic, ultrasound, or X-ray contrast imaging agent; (f) the cargo compound comprises a peptide, a protein, an enzyme, or a polysaccharide; (g) the cargo compound comprises an aptamer, an antigen, a protease, an amylase, a lipase, a Fc receptor, a tissue factor, or a complement component 3 (C3) protein; (h) the cargo compound comprises a toxin, an inhibitor, a DNA intercalator, an alkylating agent, an antimetabolite, an anti-microtubule agents, a topoisomerase inhibitor, or an antibiotic compound; (i) the cargo compound comprises an amanita toxin, a vinca alkaloid, a taxane, an anthracycline, a bleomycin, a nitrogen mustard, a nitrosourea, a tetrazine, an aziridine, a platinum-containing chemotherapeutic agent, cisplatin or a cisplatin derivative, a procarbazine, or a hexamethylmelamine; (j) the cargo compound comprises a DNA, a DNA analog, a RNA, a RNA analog; (k) the cargo compound comprises a peptide nucleic acid (PNA), a bis PNA, a gamma PNA, a locked nucleic acid (LNA), or a morpholino; (l) the cargo compound comprises a chemotherapeutic compound; (m) the cargo compound comprises an antimicrobial compound; or (n) the cargo compound comprises a gene-regulation compound.
51. The method of claim 44, wherein the linker is attached to the cargo compound via a covalent bond, wherein (a) the covalent bond is an ester bond, a disulfide bond, a bond between two selenium atoms, a bond between a sulfur and a selenium atom, or an acid-liable bond; (b) the covalent bond is a bond that has been formed by a click chemistry reaction; or (c) the covalent bond is a bond that has been formed by a reaction between an azide and an alkyne, an alkyne and a strained difluorooctyne, a diaryl-strained-cyclooctyne and a 1,3-nitrone, a cyclooctene, trans-cycloalkene, or oxanorbornadiene and an azide, tetrazine, or tetrazole, an activated alkene or oxanorbornadiene and an azide, a strained cyclooctene or other activated alkene and a tetrazine, or a tetrazole that has been activated by ultraviolet light and an alkene.
52. A method for ex vivo diagnostics, comprising a fluorescent pH-triggered compound comprising a pH-triggered peptide that is covalently attached to at least one other pH-triggered peptide via a linker or a covalent bond, and further comprising: (a) contacting a biological sample from a subject with a fluorescent pH-triggered compound comprising a fluorophore; (b) contacting the biological sample with electromagnetic radiation comprising an excitation wavelength of the fluorophore; and (c) detecting electromagnetic radiation emitted from the fluorescent pH-triggered compound.
53. The method of claim 52, wherein the compound comprises the following structure:
A-L-B wherein A is a first pH-triggered peptide comprising the sequence DDQNPWRAYLDLLFPTDTLLLDLLW (SEQ ID NO: 1), B is a second pH-triggered peptide comprising the sequence DDQNPWRAYLDLLFPTDTLLLDLLW (SEQ ID NO: 1), L is a polyethylene glycol linker, and each - is a covalent bond.
54. The method of claim 52, wherein the fluorescent pH-triggered compound comprises at least one pH-triggered peptide comprising one or more of the following sequences: AYLDLLFP (SEQ ID NO: 4), YLDLLFPT (SEQ ID NO: 5), LDLLFPTD (SEQ ID NO: 6), DLLFPTDT (SEQ ID NO: 7), LLFPTDT (SEQ ID NO: 8), LFPTDTLL (SEQ ID NO: 9), FPTDTLLL (SEQ ID NO: 10), PTDTLLLD (SEQ ID NO: 11), TDTLLLDL (SEQ ID NO: 12), DTLLLDLL (SEQ ID NO: 13), or TLLLDLLW (SEQ ID NO: 14).
55. The method of claim 52, wherein the fluorescent pH-triggered compound has the following structure:
[A]k-linker wherein k is an integer from 2 to 32, and each A is, individually, a pH-triggered peptide comprising at least 8 consecutive amino acids, wherein (i) at least 4 of the at least 8 consecutive amino acids are non-polar amino acids, (ii) at least 1 of the at least 8 consecutive amino acids is protonatable, and (iii) the pH-triggered peptide has a higher affinity for a membrane lipid bilayer at pH 5.0 compared to the affinity at pH 8.0.
56. The method of claim 52, wherein the pH-triggered compound comprises at least two pH-triggered peptides with different amino acid sequences or wherein each pH-triggered peptide comprises the same amino acid sequence.
57. The method of claim 52, further comprising a cargo compound, wherein (a) the cargo compound is polar or nonpolar; (b) the cargo compound comprises a marker; (c) the cargo compound comprises a prophylactic, therapeutic, diagnostic, radiation-enhancing, radiation-sensitizing, imaging, gene regulation, immune activation, cytotoxic, apoptotic, or research agent; (d) the cargo compound comprises a dye, a fluorescent dye, a fluorescence quencher, or a fluorescent protein; (e) the cargo compound comprises a magnetic resonance, positron emission tomography, single photon emission computed tomography, fluorescent, optoacoustic, ultrasound, or X-ray contrast imaging agent; (f) the cargo compound comprises a peptide, a protein, an enzyme, or a polysaccharide; (g) the cargo compound comprises an aptamer, an antigen, a protease, an amylase, a lipase, a Fc receptor, a tissue factor, or a complement component 3 (C3) protein; (h) the cargo compound comprises a toxin, an inhibitor, a DNA intercalator, an alkylating agent, an antimetabolite, an anti-microtubule agents, a topoisomerase inhibitor, or an antibiotic compound; (i) the cargo compound comprises an amanita toxin, a vinca alkaloid, a taxane, an anthracycline, a bleomycin, a nitrogen mustard, a nitrosourea, a tetrazine, an aziridine, a platinum-containing chemotherapeutic agent, cisplatin or a cisplatin derivative, a procarbazine, or a hexamethylmelamine; (j) the cargo compound comprises a DNA, a DNA analog, a RNA, a RNA analog; (k) the cargo compound comprises a peptide nucleic acid (PNA), a bis PNA, a gamma PNA, a locked nucleic acid (LNA), or a morpholino; (l) the cargo compound comprises a chemotherapeutic compound; (m) the cargo compound comprises an antimicrobial compound; or (n) the cargo compound comprises a gene-regulation compound.
58. The method of claim 57, wherein a linker is attached to the cargo compound via a covalent bond, wherein (a) the covalent bond is an ester bond, a disulfide bond, a bond between two selenium atoms, a bond between a sulfur and a selenium atom, or an acid-liable bond; (b) the covalent bond is a bond that has been formed by a click chemistry reaction; or (c) the covalent bond is a bond that has been formed by a reaction between an azide and an alkyne, an alkyne and a strained difluorooctyne, a diaryl-strained-cyclooctyne and a 1,3-nitrone, a cyclooctene, trans-cycloalkene, or oxanorbornadiene and an azide, tetrazine, or tetrazole, an activated alkene or oxanorbornadiene and an azide, a strained cyclooctene or other activated alkene and a tetrazine, or a tetrazole that has been activated by ultraviolet light and an alkene.
59. A pH-triggered compound comprising a pH-triggered peptide that is covalently attached to at least one other pH-triggered peptide via a linker or a covalent bond.
60. The pH-triggered compound of claim 59, wherein pH-triggered compound comprises the following structure:
A-L-B wherein A is a first pH-triggered peptide comprising the sequence DDQNPWRAYLDLLFPTDTLLLDLLW (SEQ ID NO: 1), B is a second pH-triggered peptide comprising the sequence DDQNPWRAYLDLLFPTDTLLLDLLW (SEQ ID NO: 1), L is a polyethylene glycol linker, and each - is a covalent bond.
61. The pH-triggered compound of claim 59, wherein the pH-triggered compound comprises at least one pH-triggered peptide comprising one or more of the following sequences: TABLE-US-00038 (SEQIDNO:4) AYLDLLFP, (SEQIDNO:5) YLDLLFPT, (SEQIDNO:6) LDLLFPTD, (SEQIDNO:7) DLLFPTDT, (SEQIDNO:8) LLFPTDT, (SEQIDNO:9) LFPTDTLL, (SEQIDNO:10) FPTDTLLL, (SEQIDNO:11) PTDTLLLD, (SEQIDNO:12) TDTLLLDL, (SEQIDNO:13) DTLLLDLL, or (SEQIDNO:14) TLLLDLLW
62. The pH-triggered compound of claim 59, wherein the pH-triggered compound comprises at least one pH-triggered peptide comprising the sequence TABLE-US-00039 (SEQIDNO:1) DDQNPWRAYLDLLFPTDTLLLDLLW
63. The pH-triggered compound of claim 59, further comprising a cargo compound, wherein (a) the cargo compound is polar or nonpolar; (b) the cargo compound comprises a marker; (c) the cargo compound comprises a prophylactic, therapeutic, diagnostic, radiation-enhancing, radiation-sensitizing, imaging, gene regulation, immune activation, cytotoxic, apoptotic, or research agent; (d) the cargo compound comprises a dye, a fluorescent dye, a fluorescence quencher, or a fluorescent protein; (e) the cargo compound comprises a magnetic resonance, positron emission tomography, single photon emission computed tomography, fluorescent, optoacoustic, ultrasound, or X-ray contrast imaging agent; (f) the cargo compound comprises a peptide, a protein, an enzyme, or a polysaccharide; (g) the cargo compound comprises an aptamer, an antigen, a protease, an amylase, a lipase, a Fc receptor, a tissue factor, or a complement component 3 (C3) protein; (h) the cargo compound comprises a toxin, an inhibitor, a DNA intercalator, an alkylating agent, an antimetabolite, an anti-microtubule agents, a topoisomerase inhibitor, or an antibiotic compound; (i) the cargo compound comprises an amanita toxin, a vinca alkaloid, a taxane, an anthracycline, a bleomycin, a nitrogen mustard, a nitrosourea, a tetrazine, an aziridine, a platinum-containing chemotherapeutic agent, cisplatin or a cisplatin derivative, a procarbazine, or a hexamethylmelamine; (j) the cargo compound comprises a DNA, a DNA analog, a RNA, a RNA analog; (k) the cargo compound comprises a peptide nucleic acid (PNA), a bis PNA, a gamma PNA, a locked nucleic acid (LNA), or a morpholino; (l) the cargo compound comprises a chemotherapeutic compound; (m) the cargo compound comprises an antimicrobial compound; or (n) the cargo compound comprises a gene-regulation compound.
Description
DESCRIPTION OF THE DRAWINGS
[0233] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0234]
[0235] A 2-Arm and 4-Arm PEG-Azide were used for (A) and (B) respectively (each available from Creative PEGWorks, Chapel Hill, NC, USA):
##STR00004##
(Azide-PEG-Azide; Bifunctional PEG azide, N3-PEG-N3; Creative PEGWorks Cat No. PSB-325)
##STR00005##
(4-Arm PEG-Azide; Four arm PEG for azido alkyne click chemistry; Creative PEGWorks Cat. No. PSB-491).
[0236]
[0237]
[0238]
[0239]
[0240]
[0241]
[0242]
[0243]
[0244]
[0245]
[0246]
[0247]
[0248]
[0249]
[0250]
[0251]
[0252]
[0253]
[0254]
[0255]
[0256]
[0257]
[0258]
[0259]
[0260]
[0261]
[0262]
[0263]
DETAILED DESCRIPTION
[0264] The present subject matter provides, inter alia, pH-triggered compounds and compositions comprising one or more peptides that are capable of inserting into a lipid bilayer below a certain pH (e.g., one or more pH-triggered polypeptides). A pH-triggered polypeptide (pHLIP peptides, also known as pH-triggered pH (Low) Insertion Peptides) is a water-soluble membrane peptide that interacts weakly with a cell membrane at neutral pH, without insertion into the lipid bilayer, but inserts into the cell membrane and forms a stable transmembrane alpha-helix at acidic pH (e.g., at a pH of less than about 7.0, 6.75, 6.5, 6.25, 6, 5.75, 5.5, 5.25, 5.0, 4.75, 4.5, 4.25, 4.0, 3.75, 3.5, 3.25, or 3.0). Treatment, imaging, diagnostic, and other uses of such compounds and compositions are also provided.
[0265] A compound is pH-triggered if it has, e.g., a higher affinity to a membrane lipid bilayer at pH 5.0 compared to at pH 8.0. In some embodiments, a pH-triggered compound is or includes a peptide, which may optionally be attached to a cargo compound. In certain embodiments, a pH-triggered compound comprises multiple peptides and, e.g., a linker and/or one or more cargo compounds.
[0266] Included herein are improved pHLIP peptides, as well as compounds comprising multiple pHLIP peptides (e.g., linked pHLIPs and pHLIP bundles). As used herein, a pHLIP bundle is a compound comprising at least two pHLIP peptides. For example, a pHLIP bundle includes 2, 3, 4, 5, 6, or more individual pHLIP peptides covalently linked to one another. In various embodiments, the pHLIP peptides are covalently linked directly (e.g., via a covalent bond) or indirectly (e.g., via a linker moiety to which each of the pHLIP peptides are covalently bound). In certain embodiments, the pHLIP peptides are not within the same stretch of amino acids. In some embodiments, assembling pHLIP peptides into bundles (e.g., by linking them together) alters the pH-dependent intracellular delivery of molecules (i.e., cargo compounds) and targeting of acidic diseased tissue, such as cancer. Non-limiting examples of pH-triggered compounds include pHLIP peptides containing standard and/or non-standard amino acids, as well as conjugates (bundles) thereof comprising 2, 3, 4, or more pHLIP peptides linked together by, e.g., polyethelyne glycol. Non-limiting data provided herein correlates the biophysical properties of the membrane interactions of different pHLIP peptides and their bundles to the ability of these constructs to move polar cargo (e.g., cyclic cell-impermeable peptide, mushroom toxin, amanitin) across the cell membrane and to target acidic tumors. pHLIP peptides assembled into the bundles demonstrated surprising new properties of pH-dependent interactions with lipid bilayer of membrane, which led to the enhancement of intracellular delivery of molecules into cancer cells.
[0267] In various embodiments, a pH-triggered compound (e.g., a peptide such as a pHLIP peptide, or a compound comprising multiple pHLIP peptides) has a net neutral charge at a low pH and a net negative charge at a neutral or high pH. In some embodiments, a pH-triggered compound has a net neutral charge at a pH of less than about 7, 6.5, 6.0, 5.5, 5.0, 4.5, or 4.0 and a net negative charge at a pH of about 7, 7.25, 7.5, or 7.75 in water, e.g., distilled water. In certain embodiments, a pH-triggered compound has a net neutral charge at a pH of less than about 7 and a net negative charge at a pH of about 7 in water. In some embodiments, a pH-triggered compound has a net neutral charge at a pH of less than about 6.5 and a net negative charge at a pH of about 7 in water. In various embodiments, a pH-triggered compound has a net neutral charge at a pH of less than about 6.0 and a net negative charge at a pH of about 7. In some embodiments, a pH-triggered compound has a net neutral charge at a pH of less than about 5.5 and a net negative charge at a pH of about 7 in water. In certain embodiments, a pH-triggered compound has a net neutral charge at a pH of less than about 5.0 and a net negative charge at a pH of about 7 in water. In various embodiments, a pH-triggered compound has a net neutral charge at a pH of less than about 4.5 and a net negative charge at a pH of about 7 in water. In some embodiments, a pH-triggered compound has a net neutral charge at a pH of less than about 4.0 and a net negative charge at a pH of about 7 in water.
[0268] In various embodiments, a pH-triggered compound that comprises multiple pHLIP peptides may comprise any pHLIP peptide (or any combination thereof) disclosed herein.
[0269] In some embodiments, a pHLIP peptide monomer or a compound comprising multiple pHLIP peptides has a net negative charge at a pH of about 7, 7.25, 7.5, or 7.75 in water. Alternatively or in addition, the pHLIP peptide or compound comprising multiple pHLIP peptides may have an acid dissociation constant at logarithmic scale (pKa) of less than about 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, or 7.
[0270] In various embodiments, a protonatable amino acid is an amino acid with a pKa of less than about 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, or 7. In certain embodiments, a protonatable amino acid is an amino acid with a pKa of less than about 6.5. In some embodiments, a protonatable amino acid is an amino acid with a pKa of less than about 5.5. In certain embodiments, a protonatable amino acid is an amino acid with a pKa of less than about 4.5. In various embodiments, a protonatable amino acid is an amino acid with a pKa of less than about 4.0. In some embodiments, a protonatable amino acid comprises a carboxyl group.
[0271] Aspects of the present subject matter relate to pHLIP peptides of various sizes. For example, a pHLIP peptide may have 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50 or more amino acids; 8 to 15 amino acids; 8 to 50 amino acids; 8 to 40 amino acids; 8 to 30 amino acids; 8 to 20 amino acids; 8 to 10 amino acids; less than about 20 amino acids; less than 9, 10, 11, 12, 13, 14, or 15 amino acids; 10 amino acids; 9 amino acids, or 8 amino acids. In some embodiments, less than 1, 2, 3, 4, or 5 of the amino acids in the pHLIP peptide have a net positive charge at a pH of 7, 7.25, 7.5, or 7.75 in water. In certain embodiments, the pHLIP peptide comprises 0 amino acids having a net positive charge at a pH of about 7, 7.25, 7.5, or 7.75 in water.
[0272] In various implementations of the present subject matter, a pH-triggered compound has a functional group (e.g., 1 or more functional groups) to which a cargo compound may be attached. In a non-limiting example, the functional group is a side chain of an amino acid of the pH-triggered compound. In certain embodiments, the functional group is an amino acid side chain to which a cargo compound may be attached via a disulfide bond. In some embodiments, the functional group to which a cargo compound may be attached comprises a free sulfhydryl (SH) or selenohydryl (SeH) group. For example, a functional group may be present within a sidechain of a cysteine, homocysteine, selenocysteine, or homoselenocysteine, or a derivative thereof having at least one, e.g., 1, 2, 3, 4, 5, or more, free SH and/or SeH groups. In various embodiments, the functional group comprises a primary amine. For example, a functional group may be present within a sidechain of a lysine or a derivative thereof having at least one, e.g., 1, 2, 3, 4, 5, or more, primary amines.
[0273] In certain embodiments, a pHLIP peptide has about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more aromatic amino acids. For example, the aromatic amino acids may be one or more of a tryptophan, a tyrosine, a phenylalanine, and an artificial aromatic amino acid.
[0274] pHLIP peptides of the present subject matter have at least 1 protonatable amino acid. For example, a pHLIP peptide may comprise 1 protonatable amino acid which is aspartic acid, glutamic acid, or gamma-carboxyglutamic acid; or at least 2, 3, 4, 5, 6, 7, 8, 9, 10 or more protonatable amino acids, wherein the protonatable amino acids comprise one or more of aspartic acid, glutamic acid, and gamma-carboxyglutamic acid. In some embodiments, the protonatable amino acid is an artificial amino acid. In a non-limiting example, a pHLIP peptide has at least 2, 3, 4, 5, 6, 7, 8, 9, 10 or more protonatable amino acids, wherein the protonatable amino acids comprise aspartic acid, glutamic acid, gamma-carboxyglutamic acid, or any combination thereof.
[0275] Aspects of the present subject matter provide pHLIP peptides having artificial amino acids, such as at least 1 artificial protonatable amino acid. In various embodiments, the artificial protonatable amino acid comprises at least 1, 2, 3, 4 or 5 carboxyl groups and/or the pHLIP peptide may have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 carboxyl groups. In some embodiments, a pHLIP peptide has at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 artificial amino acids. In a non-limiting example, every amino acid of the pHLIP peptide is an artificial amino acid. In certain embodiments, a pHLIP peptide may include at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 D-amino acids.
[0276] Various implementations of the present subject matter relate to pHLIP peptides having at least one artificial amino acid which is a cysteine derivative, an aspartic acid derivative, a glutamic acid derivative, a phenylalanine derivative, a tyrosine derivative, or a tryptophan derivative. For example, a pHLIP peptide may contain a cysteine derivative selected from the group consisting of D-Ethionine, Seleno-L-cystine, S-(2-Thiazolyl)-L-cysteine, and S-(4-Tolyl)-L-cysteine; an aspartic acid derivative which is a N-phenyl(benzyl)amino derivative of aspartic acid; a glutamic acid derivative selected from the group consisting of -Carboxy-DL-glutamic acid, 4-Fluoro-DL-glutamic acid, and (4S)-4-(4-Trifluoromethyl-benzyl)-L-glutamic acid; a phenylalanine derivative selected from the group consisting of (S)N-acetyl-4-bromophenylalanine, N-Acetyl-2-fluoro-DL-phenylalanine, N-Acetyl-4-fluoro-DL-phenylalanine, 4-Chloro-L-phenylalanine, DL-2,3-Difluorophenylalanine, DL-3,5-Difluorophenylalanine, 3,4-Dihydroxy-L-phenylalanine, 3-(3,4-Dimethoxyphenyl)-L-alanine, 4-(Hydroxymethyl)-D-phenylalanine, N-(3-Indolylacetyl)-L-phenylalanine, p-Iodo-D-phenylalanine, -Methyl-DL-phenylalanine, 4-Nitro-DL-phenylalanine, and 4-(Trifluoromethyl)-D-phenylalanine; a tyrosine derivative selected from the group consisting of -Methyl-DL-tyrosine, 3-Chloro-L-tyrosine, 3-Nitro-L-tyrosine, and DL-o-Tyrosine; and/or a tryptophan derivative selected from the group consisting of 5-Fluoro-L-tryptophan, 5-Fluoro-DL-tryptophan, 5-Hydroxy-L-tryptophan, 5-Methoxy-DL-tryptophan, or 5-Methyl-DL-tryptophan.
[0277] In various embodiments, a pHLIP peptide has at least 8 consecutive amino acids, wherein, at least 2, 3, 4, 5, or 6 of the 8 consecutive amino acids of the pHLIP peptide are non-polar, and at least 1 or 2 of the at least 8 consecutive amino acids of the pHLIP peptide is protonatable. For example, the pHLIP peptide may have 8-10 consecutive amino acids, including at least 2, 3, 4, 5, or 6 amino acids that are non-polar, and at least 1 or 2 amino acids that are protonatable.
[0278] Aspects of the present disclosure provide pHLIP peptides that are linked together and/or to a cargo compound. In various implementations, the pHLIP peptide is directly linked to a linker compound, another pHLIP peptide, and/or a cargo compound by a covalent bond. In some non-limiting examples, the covalent bond is an ester bond, a disulfide bond, a bond between two selenium atoms, a bond between a sulfur and a selenium atom, or an acid-liable bond.
[0279] In some embodiments, the covalent bond between the pHLIP peptide, a linker compound, another pHLIP peptide, and/or and the cargo compound is a bond that has been formed by a click reaction. Non-limiting examples of click reactions include reactions between an azide and an alkyne; an alkyne and a strained difluorooctyne; a diaryl-strained-cyclooctyne and a 1,3-nitrone; a cyclooctene, trans-cycloalkene, or oxanorbornadiene and an azide, tetrazine, or tetrazole; an activated alkene or oxanorbornadiene and an azide; a strained cyclooctene or other activated alkene and a tetrazine; or a tetrazole that has been activated by ultraviolet light and an alkene.
[0280] Some implementations provide a pHLIP peptide that is attached to a linker compound by a covalent bond, wherein the linker compound is attached to the cargo compound or another pHLIP peptide (or, e.g., each of 2 or more pHLIP peptides) by a covalent bond. In non-limiting examples, the covalent bond between a pHLIP peptide and a linker compound and/or the covalent bond between a linker compound and a cargo compound is a disulfide bond, a bond between two selenium atoms, a bond between a sulfur and a selenium atom, or a bond that has been formed by a click reaction.
[0281] In various embodiments, the cargo has a weight of (a) at least about 0.5, 1, 1.5, 2, 2.5, 5, 6, 7, 8, 9, or 10 kilodaltons (kDa); or (b) less than about 0.5, 1, 1.5, 2, 2.5, 5, 6, 7, 8, 9, or 10 kDa. In a non-limiting example, a pHLIP peptide is linked to a cargo compound having a weight of at least about 15 kDa. In another non-limiting example, a pHLIP peptide is linked to a cargo compound having a weight of less than about 15 kDa. The cargo may be, e.g., polar or nonpolar.
[0282] In certain embodiments, the cargo is a marker and/or a therapeutic, diagnostic, radiation-enhancing, radiation-sensitizing, imaging, gene regulation, cytotoxic, apoptotic, or research reagent. In some embodiments, a pHLIP peptide or linker is linked to one or more cargo molecules used as a therapeutic, diagnostic, imaging, immune activation, gene regulation or cell function regulation agent, radiation-enhancing agent, radiation-sensitizing agent, or as a research tool. In various non-limiting examples, the cargo comprises a dye, a fluorescent dye, a fluorescent protein, a nanoparticle, or a radioactive isotope. For example, the cargo may include, e.g., phalloidin, phallo toxin, amanitin toxin, a DNA intercalator, or a peptide nucleic acid. In some embodiments, the cargo comprises a magnetic resonance agent, positron emission tomography agent, X-ray contrast agent, single photon emission computed tomography agent, or fluorescence imaging agent.
[0283] In some implementations of the present subject matter, 1 or more of the amino acid side chains of the pHLIP peptide are chemically modified to be radioactive or detectable by probing radiation. In various embodiments one or more atoms of a pHLIP peptide are replaced by a radioactive isotope or a stable isotope.
[0284] Aspects of the present subject matter relate to the use of a pH-triggered compound as an agent to deliver a cargo molecule across a cell membrane to a cell in a diseased tissue with a naturally acidic extracellular environment or in a tissue with an artificially induced acidic extracellular environment relative to normal physiological pH. In a non-limiting example, the diseased tissue is selected from the group consisting of inflamed tissue, ischemic tissue, arthritic tissue, tissue infected with a microorganism, and atherosclerotic tissue.
[0285] In various embodiments, artificially inducing an acidic extracellular environment relative to normal physiological pH comprises administering glucose or an acidic solution to the subject. For example, glucose or an acidic solution (e.g., comprising lactic acid) may be administered to the skin or a tissue (e.g., tumor) site.
[0286] Alternatively or in addition, a pH-triggered compound may be used as an agent to facilitate the attachment of a cargo molecule to the surface of skin. For example, a pH-triggered compound may be linked to a cargo molecule that is an antibiotic compound.
[0287] In some embodiments, the cargo is a chemotherapeutic agent.
[0288] Various implementations of the present subject matter relate to a diagnostic conjugate comprising a pH-triggered compound and a pharmaceutically acceptable detectable marker linked thereto. In some embodiments, the detectable marker comprises a dye or a nanoparticle.
[0289] In various embodiments, the compound has a higher affinity for a membrane lipid bilayer at low pH compared to that at normal pH. In some embodiments, the affinity is at least 5 times higher at pH 5.0 than at pH 8.0. In some embodiments, the affinity is at least 10 times higher at pH 5.0 than at pH 8.0. In some embodiments, the binding/association/partitioning of a pH-triggered compound with a membrane lipid bilayer is stronger at low pH (e.g., pH<6.5 or 7.0) compared to a higher pH (e.g., pH>6.5 or 7.0).
[0290] In some embodiments, the non-polar amino acid or amino acids comprise alanine, valine, isoleucine, leucine, methionine, phenylalanine, tyrosine, tryptophan, or any combination thereof. In some embodiments, a polar amino acid or amino acids comprise serine, threonine, asparagine, glutamine, or any combination thereof. In some embodiments, the non-polar amino acid is an artificial amino acid such as 1-methyl-tryptophan.
[0291] In various embodiments, a non-polar amino acid is defined as one having a side-chain solvation energy0.5 kcal/mol. The values of solvation energy (G.sub.X.sup.corr) for the 20 common natural amino acids are known, e.g., as determined by Wimley W C, Creamer T P & White S H (1996) Biochemistry 35, 5109-5124 or by Moon and Fleming, (2011) Proc. Nat. Acad. Sci. USA 101:10174-10177 (hereinafter Wimley et al. 2011), the entire content of which is incorporated herein by reference. The table below provides exemplary side chain solvation energies for naturally occurring amino acids.
TABLE-US-00017 TABLE 1 Solvation Free Energies of the Side Chains (X) of the 20 Natural Amino Acids in AcWL-X-LL (SEQ ID NO: 329). Non-polar residues are shown in bold and defined as residues with G.sub.X.sup.cor > +0.50. Gly was used as a reference, its energy G.sub.X.sup.cor was set as zero. Residue Charge G.sub.X.sup.cor Ala 0 +0.65 Arg +1 0.66 Asn 0 +0.30 Asp 1 2.49 Cys 0 +1.17 Gln 0 +0.38 Glu 1 2.48 Gly 0 0 His +1 1.18 Ile 0 +2.27 Leu 0 +2.40 Lys +1 1.65 Met 0 +1.82 Phe 0 +2.86 Pro 0 +1.01 Ser 0 +0.69 Thr 0 +0.90 Trp 0 +3.24 Tyr 0 +1.86 Val 0 +1.61
Residue solvation free energies of the 20 natural amino acids relative to glycine calculated from the data in Table 1 of Wimley et al. 2011. Free energies were corrected for the occlusion of neighboring residue areas (see text of Wimley et al. 2011) and for the anomalous properties of glycine (see text of Wimley et al. 2011). Residue solvation free energies calculated with mole-fraction units. Residue solvation free energies for the X residue in the context of a AcWL-X-LL (SEQ ID NO: 329) peptide calculated from the free energies in Table 1 or Wimley et al. 2011 using the virtual glycine (Gly) as the reference (see text of Wimley et al. 2011) (SEQ ID NOS 329-330, 329, and 329 are disclosed below, respectively, in order of appearance).
G.sub.X.sup.cor=G.sub.WLXLLG.sub.WLG*LL+.sub.npA.sub.host,
A.sub.host(X)=A.sub.Tnp(WLXLL)A.sub.Xnp(WLXLL)
These corrected values account for X-dependent changes in the nonpolar ASA of the host peptide. Values for Arg and Lys were calculated from experimental free energies measured at pH 1 where the ionic interaction between the side chain and carboxyl group does not occur. G.sub.X.sup.cor is the best estimate of the solvation energy of residues occluded by neighboring residues of moderate size.
[0292] Coded amino acids and exemplary non-coded amino acids are listed below in Table 2.
[0293] In some embodiments, a pHLIP peptide (e.g., a monomer or within a compound that comprises multiple pHLIP peptides) comprises one or more cysteine residues. The cysteine residue(s) may serve as a point of conjugation of cargo, e.g., using thiol linkage. Other means of linking cargo to a pHLIP peptide include esters and/or acid-liable linkages. Ester linkages are particularly useful in humans, the cells of which contain esterases in the cytoplasm to liberate the cargo inside the cells. In certain embodiments, this system is less useful in the mouse or other rodents, which species are characterized by a high level of esterases in the blood (thereby leading to premature release of cargo molecules). Non-cleavable covalent chemical linkages may also be made to secure a cargo permanently to a pHLIP peptide.
[0294] pH-triggered compounds provided herein are useful for topical, dermatological and internal medical applications, e.g., as therapeutic, diagnostic, prophylactic, imaging, gene regulation, or as research reagents/tools, e.g., to evaluate cell function regulation, apoptosis, or other cell activities. For such applications, the composition further comprises a moiety attached to a functional group. Exemplary moieties include imaging agents, dyes, or other detectable labels; and prophylactic, therapeutic and cytotoxic agents. For example, in some implementations, pH-triggered compounds translocate cell permeable and/or cell impermeable cargo molecules (such as nanoparticles, organic dyes, peptides, peptide nucleic acids and toxins) across the membrane. In certain embodiments, the pH-triggered compounds target cargo (e.g., an imaging agent such as a dye or another detectable label) to cell surfaces in tissues such as acidic tissues. For example, a pH-triggered compound linked to an imaging cargo such as a dye or stain can be used during a chromoendoscopy procedure (such as during a colonoscopy) to enhance tissue differentiation or characterization. In various embodiments, the pH-triggered compound itself is non-toxic, especially when an effective amount of the pH-triggered compound is used. Non-limiting examples of cargo molecules include magnetic resonance (MR) agents, positron emission tomography (PET) agents, single photon emission computed tomography (SPECT) agents, x-ray contrast agents, fluorescence imaging agents, natural toxins, deoxyribonucleic acid (DNA) intercalators, peptide nucleic acids (PNA), morpholinos (e.g., morpholino oligomers), peptides, and naturally-occurring or synthetic drug molecules. Other examples of therapeutic or diagnostic moieties or cargo compounds include radiation-enhancing or radiation-sensitizing compounds such as nanogold particles to enhance imaging or cell destruction, e.g., tumor cell killing, by radiation or boron-containing compounds such as Disodium mercapto-closo-dodecaborate (BSH) for boron neutron capture therapy (BNCT) that kills labeled target cells while sparing unlabeled non-target (non-diseased) cells. For imaging or other applications for which detection is desired, one or more atoms are optionally replaced by radioactive isotopes. For example, one or more of the amino acid side chains may be chemically modified to render them radioactive or detectable by probing radiation.
[0295] In various embodiments, the moiety or cargo molecule comprises a marker. As used herein, a marker may be any compound that provides an identifiable signal. Non-limiting examples of markers include fluorescent dyes, phosphorescent dyes, and quantum dots.
[0296] In some embodiments, the marker is a fluorophore. In various embodiments, 1, 2, 3, 4, 5 or more fluorophores are attached to a pHLIP compound provided herein.
[0297] Non-limiting examples of fluorophores include but are not limited to fluorescent dyes, phosphorescent dyes, quantum dots, xanthene derivatives, cyanine derivatives, naphthalene derivatives, coumarin derivatives, oxadiaxol derivatives, pyrene derivatives, acridine derivatives, arylmethine derivatives, and tetrapyrrole derivatives. Xanthene derivatives include but are not limited to fluorescein, rhodamine, Oregon green, eosin, Texas red, and Cal Fluor dyes. Cyanine derivatives include but are not limited to cyanine, indocarbocyanine, indocyanine green (ICG), oxacarbocyanine, thiacarbocyanine, merocyanine, and Quasar dyes. Naphthalene derivatives include but are not limited to dansyl and prodan derivatives. Oxadiazole derivatives include but are not limited to pyridyloxazol, nitrobenzoxadiazole, and benzoxadiazole. A non-limiting example of a pyrene derivative is cascade blue. Oxadine derivatives include but are not limited to Nile red, Nile blue, cresyl violet, and oxazine 170. Acridine derivatives include but are not limited to proflavin, acridine orange, and acridine yellow. Arylmethine derivatives include but are not limited to auramine, crystal violet, and malachite green. Tetrapyrrole derivatives include but are not limited to porphin, phtalocyanine, and bilirubin.
[0298] In various embodiments, the moiety is covalently attached to the pH-triggered compound via a linkage such as a thiol linkage or ester linkage or acid-liable linkage. Other types of linkages, chemical bonds, or binding associations may also be used. Exemplary linkages or associations are mediated by a disulfide, and/or a peptide with a protein binding motif, and/or a protein kinase consensus sequence, and/or a protein phosphatase consensus sequence, and/or a protease-reactive sequence, and/or a peptidase-reactive sequence, and/or a transferase-reactive sequence, and/or a hydrolase-reactive sequence, and/or an isomerase-reactive sequence, and/or a ligase-reactive sequence, and/or an extracellular metalloprotease-reactive sequence, and/or a lysosomal protease-reactive sequence, and/or a beta-lactamase-reactive sequence, and/or an oxidoreductase-reactive sequence, and/or an esterase-reactive sequence, and/or a glycosidase-reactive sequence, and/or a nuclease-reactive sequence.
[0299] In certain embodiments, the moiety or cargo compound is covalently attached to the pH-triggered compound via a non-cleavable linkage. In various embodiments, a non-cleavable linkage is a covalent bond that is not cleaved by an enzyme expressed by a mammalian cell, and/or not cleaved by glutathione and/or not cleaved at conditions of low pH. Non-limiting examples of non-cleavable linkages include maleimide linkages, linkages resulting from the reaction of a N-hydroxysuccinimide ester with a primary amine (e.g., a primary amine of a lysine side-chain), linkages resulting from a click reaction, thioether linkages, or linkages resulting from the reaction of a primary amine (NH.sub.2) or thio (SH) functional group with succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC). Exemplary non-cleavable linkages include a maleimide alkane linker,
##STR00006##
and a maleimide cyclohexane linker,
##STR00007##
[0300] In some embodiments, a linker comprises one or more linear or branched poly(ethylene glycol) (PEG) and/or maleimide structures. In certain embodiments, the PEG has two arms. In various embodiments, the PET has four arms. In some embodiments, each of the PEG arms of a linker comprises a maleimide structure. In certain embodiments, a linker having one of the following structures is used to covalently attach a pHLIP peptide to at least one other pHLIP peptide and/or at least one cargo compound:
##STR00008##
[0301] Exemplary uses of the environmentally-sensitive compositions is to tether molecules to a membrane and/or shuttle molecules across a membrane. For example, in some embodiments, a pHLIP compound is used as an agent to deliver a functional moiety (diagnostic or therapeutic) to or across a cell membrane to a cell in a tissue with a naturally acidic extracellular environment or in a tissue with an artificially or disease induced acidic extracellular environment relative to normal physiological pH. Many diseased tissues and normal skin are characterized by an acidic microenvironment. However, acidity in tumors or non-tumor target tissues is optionally induced by co-injection of glucose or a diluted solution of acid at the tissue site at which therapy using the compositions is desired. For example, an acidifying composition (e.g., glucose or dilute acid) may be administered, e.g., injected subcutaneously, before delivery of the pH sensitive compositions (e.g., about 30 s, 1 min, 5 min, 10 min, 30 min, 1 hr, 2 hrs, 6 hrs, 12 hrs, 24 hrs, 48 hrs, or more prior to administration of the environmentally sensitive composition to the target tissue site). Alternatively or in addition, the tissue acidifying agent and the pH-triggered compound composition are co-administered. In some embodiments, the diseased tissue is selected from the group consisting of cancer, inflammation/inflamed tissue, ischemia/ischemic tissue, tissue affected by stroke, arthritis, infection with a microorganism (e.g., a bacteria, virus, or fungus), or atherosclerotic plaques. Compositions provided herein are also useful to deliver a functional moiety to cell surfaces in a diseased tissue with a naturally acidic extracellular environment or in a tissue with an artificially induced acidic extracellular environment relative to normal physiological pH. In certain embodiments, administration of a neutralizing agent to an acidic site, e.g., a bicarbonate solution, is used to reduce pH-triggered compound binding/insertion and pH-triggered compound labeling or targeting of cells at that site. Compounds and compositions provided herein are also useful to tether and deliver a therapeutic compound to the surface of skin with a naturally acidic environment or to a skin with an artificially induced acidic environment.
[0302] As is described herein, the compositions may be used in a clinical setting for diagnostic and therapeutic applications in humans as well as animals (e.g., companion animals such as dogs and cats as well as livestock such as horses, cattle, goats, sheep, llamas). In various embodiments, a diagnostic conjugate comprises an environmentally (e.g., pH sensitive) pHLIP compound and a pharmaceutically-acceptable detectable marker linked thereto. Exemplary detectable markers include fluorescent dyes, as well as MR, PET, SPECT, optoacoustic, X-ray, CT and other imaging agents. Such conjugates are used in a variety of clinical diagnostic methods, including real-time image-guided therapeutic interventions. For example, a method of guiding surgical tumor excision is carried out by administering a pHLIP compound disclosed herein to an anatomical site comprising a tumor, removing a primary tumor from the site, and detecting residual tumor cells by virtue of binding of the compound to residual tumor cells.
[0303] Included herein are compositions that are administered to the body for diagnostic and therapeutic use, e.g., using administration methods known in the art. For example, in some embodiments the methods are carried out by infusing into a vascular lumen, e.g., intravenously, via a jugular vein, peripheral vein or the perivascular space. In some embodiments, the composition is infused into the lungs of said mammal, e.g., as an aerosol or lavage. In certain embodiments, the composition is administered by injection, e.g., into an anatomical region of interest such as a tumor site or site of another pathological condition or suspected pathological condition. In various embodiments, the composition is administered by intravesical instillation into a human or animal bladder, oral cavity, intestinal cavity, esophagus, or trachea. In some embodiments, the injection can be into the peritoneal cavity of the mammal, subdermally, or subcutaneously. The compositions can also be administered transdermally. Solutions containing the imaging conjugates or therapeutic conjugates are administered intravenously, by lavage of the area (e.g., peritoneal tissue or lung tissue), topically, transdermally, by inhalation, or by injection (e.g., directly into a tumor or tumor border area). In certain embodiments, 1-50 mg in 100 mL is used for lavage and 0.1-100 mg/kg is used for other routes of administration.
[0304] Targeting of acidity provides a predictive marker for tumor invasiveness and disease development. In addition to image-guided therapies, compounds and compositions provided herein are useful to diagnose or measure the severity of a pathological condition. In various embodiments, a method of determining the aggressiveness of a primary tumor is carried out by contacting the tumor with the environmentally-sensitive composition (e.g., comprising a pHLIP compound disclosed herein), wherein an increased level of binding of the composition compared to a control level of binding indicates an increased risk of metastasis from the primary tumor. Thus, a compositions included herein aid the physician in determining a prognosis for disease progression and appropriately tailoring therapy based on the severity or aggressiveness of the disease.
[0305] A method of preferentially inhibiting proliferation of tumor cells is carried out by administering to a subject suffering from or at risk of developing a tumor the therapeutic conjugate compositions described above to the subject. Tumor cells are preferentially inhibited compared to normal non-tumor cells. The pH-triggered compound delivery system, e.g., exemplified by the therapeutic conjugates, are therefore used in a method of manufacturing a pharmaceutical composition or medicament for treatment of tissues characterized by disease or an acid microenvironment.
Non-Limiting Variants of Non-Limiting Exemplified Peptides
[0306] pH-triggered compounds provided herein may contain one or more pHLIP peptides, e.g. any one of, or (in the case of compounds having more than one pHLIP peptide) any combination of the non-limiting examples pHLIP peptides provided herein or variants thereof. Variants of the membrane insertion peptides exemplified or otherwise disclosed herein may be designed using substitution techniques that are well understood in the art. Neither the membrane insertion peptides exemplified herein nor the variants discussed below limit the full scope of the subject matter disclosed herein. Non-limiting examples of variants of the specific membrane insertion disclosed herein include peptides having the reverse amino acid sequence of the specific membrane insertion peptides disclosed. For example, a disclosure of a membrane insertion peptide comprising the sequence WARYADWL (SEQ ID NO: 256) also provides the disclosure of a pHLIP peptide comprising the sequence LWDAYRAW (SEQ ID NO: 257).
[0307] Aspects of the present subject matter relate to pHLIP peptides that result from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more conservative amino acid substitutions compared to a pHLIP peptide exemplified herein. A conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a residue in a pH-triggered peptide sequence (e.g., corresponding to a location relative to a SEQ ID NO disclosed herein) may be replaced with another amino acid residue from the same side chain family. In certain embodiments, conservative amino acid substitutions may be made using a natural amino acid or a non-natural amino acid.
TABLE-US-00018 TABLE 2 Coded and exemplary non-coded amino acids including L-isomers, D- isomers, alpha-isomers, beta-isomers, glycol-, and methyl- modifications. No. Abbrev Name 1 Ala Alanine 2 Arg Arginine 3 Asn Asparagine 4 Asp Aspartic acid 5 Cys Cysteine 6 Gln Glutamine 7 Glu Glutamic acid 8 Gly Glycine 9 His Histidine 10 Ile Isoleucine 11 Leu Leucine 12 Lys Lysine 13 Met Methionine 14 Phe Phenylalanine 15 Pro Proline 16 Ser Serine 17 Thr Threonine 18 Trp Tryptophan 19 Tyr Tyrosine 20 Val Valine 21 Sec Selenocysteine 22 Sem Selenomethionine 23 Pyl Pyrrolysine 24 Aad Alpha-aminoadipic acid 25 Acpa Amino-caprylic acid 26 Aecys Aminoethyl cysteine 27 Afa Aminophenyl acetate 28 Gaba Gamma-aminobutyric acid 29 Aiba Aminoisobutyric acid 30 Aile Alloisoleucine 31 AIg Allylglycine 32 Aba Amino-butyric acid 33 Aphe Amino-phenylalanine 34 Brphe Bromo-phenylalanine 35 Cha Cyclo-hexylalanine 36 Cit Citrulline 37 Clala Chloroalanine 38 Cie Cycloleucine 39 Clphe Fenclonine (or chlorophenylalanine) 40 Cya Cysteic acid 41 Dab Diaminobutyric acid 42 Dap Diaminopropionic acid 43 Dap Diaminopimelic acid 44 Dhp Dehydro-proline 45 Dhphe DOPA (or 3,4-dihydroxyphenylalanine) 46 Fphe Fluorophenylalanine 47 Gaa Glucosaminic acid 48 Gla Gamma-carboxyglutamic acid 49 Hag Homoarginine 50 Hlys Hydroxylysine 51 Hnvl Hydroxynorvaline 52 Hog Homoglutamine 53 Hoph Homophenylalanine 54 Has Homoserine 55 Hse Homocysteine 56 Hpr Hydroxyproline 57 Iphe Iodo-phenylalanine 58 Ise Isoserine 59 Mle Methyl-leucine 60 Msmet Methionine-methylsulfonium chloride 61 Nala Naphthyl-alanine 62 Nle Norleucine (or 2-aminohexanoic acid) 63 Nmala N-methyl-alanine 64 Nva Norvaline (or 2-aminopentanoic acid) 65 Obser O-benzyl-serine 66 Obtyr O-benzyl-tyrosine 67 Oetyr O-ethyl-tyrosine 68 Omser O-methyl-serine 69 Omthr O-methy-threonine 70 Omtyr O-methyl-tyrosine 71 Orn Ornithine 72 Pen Penicillamine 73 Pga Pyroglutamic acid 74 Pip Pipecolic acid 75 Sar Sarcosine 76 Tfa Trifluoro-alanine 77 Thphe Hydroxy-Dopa 78 Vig Vinylglycine 79 Aaspa Amino-aminoethylsulfanylpropanoic acid 80 Ahdna Amino-hydroxy-dioxanonanolic acid 81 Ahoha Amino-hydroxy-oxahexanoic acid 82 Ahsopa Amino-hydroxyethylsulfanylpropanoic acid 83 Tyr(Me) Methoxyphenyl-methylpropanyl oxycarbonylamino propanoic acid 84 MTrp Methyl-tryptophan 85 pTyr Phosphorylated Tyr 86 pSer Phosphorylated Ser 87 pThr Phosphorylated Thr 88 BLys BiotinLys 89 Hyp Hydroproline 90 Phg Phenylglycine 91 Cha Cyclohexyl-alanine 92 Chg Cyclohexylglycine 93 Nal Naphthylalanine 94 Pal Pyridyl-alanine 95 Pra Propargylglycine 96 Gly(allyl) Pentenoic acid 97 Pen Penicillamine 98 MetO Methionine sulfoxide 99 Pca Pyroglutamic acid 100 Ac-Lys Acetylation of Lys
TABLE-US-00019 TABLE 3 Non-limiting examples of protonatable residues and their substitutions including L- isomers, D- isomers, alpha-isomers, and beta-isomers. Original Residue Exemplary amino acids substitution Asp (D) Glu (E); Gla (Gla); Aad (Aad) Glu (E) Asp (D); Gla (Gla); Aad (Aad)
TABLE-US-00020 TABLE 4 Examples of coded amino acid substitutions Original Residue Substitution Ala (A) Gly; Ile; Leu; Met; Phe; Pro; Trp; Tyr; Val Arg (R) Lys Asn (N) Gln; His Asp (D) Glu Cys (C) Ser; Met Gln (Q) Asn; His Glu (E) Asp Gly (G) Ala; Ile; Leu; Met; Phe; Pro; Trp; Tyr; Val His (H) Asn; Gln Ile (I) Ala; Gly; Leu; Met; Phe; Pro; Trp; Tyr; Val Leu (L) Ala; Gly; Ile; Met; Phe; Pro; Trp; Tyr; Val Lys (K) Arg Met (M) Ala; Gly; Leu; Ile; Phe; Pro; Trp; Tyr; Val Phe (F) Ala; Gly; Leu; Ile; Met; Pro; Trp; Tyr; Val Pro (P) Ala; Gly; Leu; Ile; Met; Phe; Trp; Tyr; Val Ser (S) Thr Thr (T) Ser Trp (W) Ala; Gly; Leu; Ile; Met; Pro; Phe; Tyr; Val Tyr (Y) Ala; Gly; Leu; Ile; Met; Pro; Phe; Trp; Val Val (V) Ala; Gly; Leu; Ile; Met; Pro; Phe; Trp; Tyr
TABLE-US-00021 TABLE5 Non-limitingexamplesofmembrane-insertingsequencesbelongingto differentgroupsofpHLIPpeptides.Eachprotonatableresidue(shown inbold)couldbereplacedbyitssubstitutionfromTable3.Each non-polarresiduecouldbereplacedbyitscodedaminoacidsubsti- tutionfromTable4,and/ornon-codedaminoacidsubstitutionsfrom Table2. Groups Sequences WT-BRC WARYADWLFTTPLLLLDLALL(SEQIDNO:57) YARYADWLFTTPLLLLDLALL(SEQIDNO:58) WARYSDWLFTTPLLLYDLGLL(SEQIDNO:59) WARYTDWFTTPLLLYDLALLA(SEQIDNO:60) WARYTDWLFTTPLLLYDLGLL(SEQIDNO:61) WARYADWLFTTPLLLLDLSLL(SEQIDNO:62) WT-BRCReverse LLALDLLLLPTTFLWDAYRAW(SEQIDNO:63) LLALDLLLLPTTFLWDAYRAY(SEQIDNO:64) LLGLDYLLLPTTFLWDSYRAW(SEQIDNO:65) ALLALDYLLLPTTFWDTYRAW(SEQIDNO:66) LLGLDYLLLPTTFLWDTYRAW(SEQIDNO:67) LLSLDLLLLPTTFLWDAYRAW(SEQIDNO:328) ATRAM GLAGLLGLEGLLGLPLGLLEGLWLGL(SEQIDNO:68) ATRAMReverse LGLWLGELLGLPLGLLGELGLLGALG(SEQIDNO:69) Var3 WRAYLDLLFPTDTLLLDLLW(SEQIDNO:70) Var3Reverse WLLDLLLTDTPFLLDLYARW(SEQIDNO:71) Var7 WARYLEWLFPTETLLLEL(SEQIDNO:72) WAQYLELLFPTETLLLEW(SEQIDNO:73) Var7Reverse LELLLTETPFLWELYRAW(SEQIDNO:74) WELLLTETPFLLELYQAW(SEQIDNO:75) SingleD/E WLFTTPLLLLNGALLVE(SEQIDNO:76) WLFTTPLLLLPGALLVE(SEQIDNO:77) WARYADLLFPTTLAW(SEQIDNO:78) SingleD/EReverse EVLLAGNLLLLPTTFLW(SEQIDNO:79) EVLLAGPLLLLPTTFLW(SEQIDNO:80) WALTTPFLLDAYRAW(SEQIDNO:81) pHLIP-Rho NLEGFFATLGGEIALWSLVVLAIE(SEQIDNO:82) EGFFATLGGEIALWSDVVLAIE(SEQIDNO:83) EGFFATLGGEIPLWSDVVLAIE(SEQIDNO:84) pHLIP-RhoReverse EIALVVLSWLAIEGGLTAFFGELN(SEQIDNO:85) EIALVVDSWLAIEGGLTAFFGE(SEQIDNO:86) EIALVVDSWLPIEGGLTAFFGE(SEQIDNO:87) pHLIP-CA9 ILDLVFGLLFAVTSVDFLVQW(SEQIDNO:88) pHLIP-CA9Reverse WQVLFDVSTVAFLLGFVLDLI(SEQIDNO:89)
TABLE-US-00022 TABLE 6 Non-limiting examples of linkers and components thereof ID Name 1 Peptide bond, (CONH) 2 Polypeptide 3 Polylysine 4 Polyarginine 5 Polyglutamic acid 6 Polyaspartic acid 7 Polycysteine 8 Collagen 9 Fibrinogen 10 Avidin 11 Streptavidin 12 Albumin 13 Antibody 14 Protein with 1 or more Lys, Arg, Cys, 15 Asp, Glu 16 Polynucleotide 17 Polysaccharide 18 Alginate 19 Chitosan 20 Poly(ethylene glycol) (PEG) 21 Poly(lactic acid) (PLA) 22 Poly(glycolic acid) (PGA) 23 Poly(lactic-co-glycolic acid) (PLGA) 24 Poly(malic acid) (PMA) 25 Polyorthoesters (POE) 26 Poly(vinylalcohol) (PVOH, PVA, 27 or PVAl) 28 Poly(vinylpyrrolidone) (PVP) 29 Poly(methyl methacrylate) (PMMA) 30 Poly(acrylic acid) (PAA) 31 Poly(acrylamide) (PAM) 32 Poly(methacrylic acid) (PMAA) 33 Poly(amidoamine) (PAMAM) 34 Polyanhydrides 35 Polycyanoacrylate 36 Particle 37 Metallic particle 38 Polymeric particle 39 Virus-like particle 40 Nanoparticle 41 Metallic nanoparticle 42 Lipid-based nanoparticle 43 Surfactant-based nanoparticle 44 Polymeric nanoparticle 45 Peptide-based nanoparticle
TABLE-US-00023 TABLE7 Non-limitingexamplesofpHLIPsequences.Acysteine,alysine,an azido-modifiedaminoacid,oranalkynylmodifiedaminoacidcanbe incorporatedattheN-terminal(first6residues)orC-terminal(last 6residues)partsofthepeptidesforconjugationwithacargo,and alinker. SEQIDNO Name Sequence SEQIDNO:258 WT-2D AEQNPIYWARYADWLFTTPLLLLDLALLVDADET SEQIDNO:154 WT-6E AEQNPIYWARYAEWLFTTPLLLLELALLVEAEET SEQIDNO:155 WT-3D ADDQNPWRAYLDLLFPDTTDLLLLDLLWDADET SEQIDNO:156 WT-9E AEEQNPWRAYLELLFPETTELLLLELLWEAEET SEQIDNO:259 WT-GlaD AEQNPIYWARYAGlaWLFTTPLLLLDLALLVDADET SEQIDNO:260 WT-DGla AEQNPIYWARYADWLFTTPLLLLGlaLALLVDADET SEQIDNO:157 WT-2Gla AEQNPIYWARYAGlaWLFTTPLLLLGlaLALLVDADET SEQIDNO:261 WT-AadD AEQNPIYWARYAAadWLFTTPLLLLDLALLVDADET SEQIDNO:262 WT-DAad AEQNPIYWARYADWLFTTPLLLLAadLALLVDADET SEQIDNO:158 WT-2Aad AEQNPIYWARYAAadWLFTTPLLLLAadLALLVDADET SEQIDNO:263 WT-GlaAad AEQNPIYWARYAGlaWLFTTPLLLLAadLALLVDADET SEQIDNO:159 WT-AadGla AEQNPIYWARYAAadWLFTTPLLLLGlaLALLVDADET SEQIDNO:264 WT-1 GGEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT SEQIDNO:265 WT-2 GGEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT SEQIDNO:266 WT-3 AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT SEQIDNO:267 WT-4 AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT SEQIDNO:323 WT-2N AEQNPIYWARYANWLFTTPLLLLNLALLVDADEGT SEQIDNO:268 WT-2K AEQNPIYWARYAKWLFTTPLLLLKLALLVDADEGT SEQIDNO:269 WT-2DNANQ GGEQNPIYWARYADWLFTTPLLLLDLALLVNANQGT SEQIDNO:270 WT-D25A AAEQNPIYWARYADWLFTTPLLLLALALLVDADEGT SEQIDNO:271 WT-D14A AAEQNPIYWARYAAWLFTTPLLLLDLALLVDADEGT SEQIDNO:272 WT-P20A AAEQNPIYWARYADWLFTTALLLLDLALLVDADEGT SEQIDNO:273 WT-D25E AAEQNPIYWARYADWLFTTPLLLLELALLVDADEGT SEQIDNO:274 WT-D14E AAEQNPIYWARYAEWLFTTPLLLLDLALLVDADEGT SEQIDNO:275 WT-3D-2 AAEQNPIIYWARYADWLFTDLPLLLLDLLALLVDADEGT SEQIDNO:276 WT-R11Q GEQNPIYWAQYADWLFTTPLLLLDLALLVDADEG SEQIDNO:277 WT-D25Up GGEQNPIYWARYADWLFTTPLLLDLLALLVDADEG SEQIDNO:278 WT-D25Down GGEQNPIYWARYADWLFTTPLLLLLDALLVDADEG SEQIDNO:279 WT-D14Up GGEQNPIYWARYDAWLFTTPLLLLDLALLVDADEGT SEQIDNO:280 WT-D14Down GGEQNPIYWARYAWDLFTTPLLLLDLALLVDADEG SEQIDNO:281 WT-P20G AAEQNPIYWARYADWLFTTGLLLLDLALLVDADEGT SEQIDNO:282 WT-DH DDDEDNPIYWARYADWLFTTPLLLLHGALLVDAD SEQIDNO:283 WT-2H DDDEDNPIYWARYAHWLFTTPLLLLHGALLVDADE SEQIDNO:160 WT-L16H CEQNPIYWARYADWHFTTPLLLLDLALLVDADE SEQIDNO:284 WT-1Wa AEQNPIYWARYADFLFTTPLLLLDLALLVDADET SEQIDNO:285 WT-1Wb AEQNPIYFARYADWLFTTPLLLLDLALLVDADE SEQIDNO:286 WT-1Wc AEQNPIYFARYADFLFTTPLLLLDLALLWDADET SEQIDNO:161 WT-W6 ADNNPWIYARYADLTTFPLLLLDLALLVDFDD SEQIDNO:162 WT-W17 ADNNPFIYARYADLTTWPLLLLDLALLVDFDD SEQIDNO:163 WT-W30 ADNNPFIYARYADLTTFPLLLLDLALLVDWDD SEQIDNO:164 WT-W17-P7 ADNNPFPYARYADLTTWILLLLDLALLVDFDD SEQIDNO:165 WT-W39-R11 ADNNPFIYAYRADLTTFPLLLLDLALLVDWDD SEQIDNO:166 WT-W30-R15 ADNNPFIYATYADLRTFPLLLLDLALLVDWDD SEQIDNO:287 WT-Rev Ac-TEDADVLLALDLLLLPTTFLWDAYRAWYPNQEA-Am SEQIDNO:288 Van-3D AEDQNPYWARYADWLFTTPLLLLDLALLVD SEQIDNO:289 Var1-1D2E AEDQNPYWARYADWLFTTPLLLLELALLVE SEQIDNO:290 Var2-3D AEDQNPYWRAYADLFTPLTLLDLLALWD SEQIDNO:46 Var3-3D ADDQNPWRAYLDLLFPTDTLLLDLLW SEQIDNO:167 Var3-WT ADDQNPWRAYLDLLFPTDTLLLDLLWDADE SEQIDNO:47 Var3-Gla2D ADDQNPWRAYLGlaLLFPTDTLLLDLLW SEQIDNO:168 Var3-DGlaD ADDQNPWRAYLDLLFPTGlaTLLLDLLW SEQIDNO:169 Var3-2DGla ADDQNPWRAYLDLLFPTDTLLLGlaLLW SEQIDNO:170 Var3-2GlaD ADDQNPWRAYLGlaLLFPTGlaTLLLDLLW SEQIDNO:171 Var3-GlaDGla ADDQNPWRAYLGlaLLFPTDTLLLGlaLLW SEQIDNO:172 Var3-D2Gla ADDQNPWRAYLDLLFPTGlaTLLLGlaLLW SEQIDNO:173 Var3-3Gla ADDQNPWRAYLGlaLLFPTGlaTLLLGlaLLW SEQIDNO:174 Var3-Aad2D ADDQNPWRAYLAadLLFPTDTLLLDLLW SEQIDNO:175 Var3-DAadD ADDQNPWRAYLDLLFPTAadTLLLDLLW SEQIDNO:176 Var3-2DAad ADDQNPWRAYLDLLFPTDTLLLAadLLW SEQIDNO:177 Var3-2AadD ADDQNPWRAYLAadLLFPTAadTLLLDLLW SEQIDNO:178 Var3-AadDAad ADDQNPWRAYLAadLLFPTDTLLLAadLLW SEQIDNO:179 Var3-D2Aad ADDQNPWRAYLDLLFPTAadTLLLAadLLW SEQIDNO:180 Var3-3Aad ADDQNPWRAYLAadLLFPTAadTLLLAadLLW SEQIDNO:181 Var3-GlaAadD ADDQNPWRAYLGlaLLFPTAadTLLLDLLW SEQIDNO:182 Var3-GlaDAad ADDQNPWRAYLGlaLLFPTDTLLLAadLLW SEQIDNO:183 Var3-2GlaAad ADDQNPWRAYLGlaLLFPTGlaTLLLAadLLW SEQIDNO:184 Var3-AadGlaD ADDQNPWRAYLAadLLFPTGlaTLLLDLLW SEQIDNO:185 Var3-AadDGla ADDQNPWRAYLAadLLFPTDTLLLGlaLLW SEQIDNO:186 Var3-GlaAadGla ADDQNPWRAYLGlaLLFPTAadTLLLGlaLLW SEQIDNO:187 Var3-GLL GEEQNPWLGAYLDLLFPLELLGLLELGLW SEQIDNO:291 Var3-M ADDDDDDPWQAYLDLLFPTDTLLLDLLW SEQIDNO:292 Var4-3E AEEQNPWRAYLELLFPTETLLLELLW SEQIDNO:293 Var5-3Da ADDQNPWARYLDWLFPTDTLLLDL SEQIDNO:294 Var6-3Db DNNNPWRAYLDLLFPTDTLLLDW SEQIDNO:295 Var7-3E AEEQNPWARYLEWLFPTETLLLEL SEQIDNO:296 Var7-M DDDDDDPWQAYLDLFPTDTLALDLW SEQIDNO:297 Var8-3E EEQQPWAQYLELLFPTETLLLEW SEQIDNO:298 Var9-3E EEQQPWRAYLELLFPTETLLLEW SEQIDNO:299 Var10-2D AEDQNPWARYADWLFPTTLLLLD SEQIDNO:300 Var11-2E AEEQNPWARYAEWLFPTTLLLLE SEQIDNO:301 Var12-1D AEDQNPWARYADLLFPTTLAW SEQIDNO:302 Var13-1E AEEQNPWARYAELLFPTTLAW SEQIDNO:303 Var15-2N DDDDDNPNYWARYANWLFTTPLLLLNGALLVEAEET SEQIDNO:304 Var16-2P DDDDDNPNYWARYAPWLFTTPLLLLPGALLVEAEET SEQIDNO:305 Var17 AEQNPIYFARYADFLFTTPLLLLDLALLWDADET SEQIDNO:306 Var18 AEQNPIYWARYADFLFTTPLLLLDLALLVDADET SEQIDNO:307 Var19a AEQNPIYWARYADWLFTTPL SEQIDNO:308 Var20 AEQNPIYFARYADLLFPTTLAW SEQIDNO:309 Var21 AEQNPIYWARYADLLFPTTLAF SEQIDNO:310 Var22 AEQNPIYWARYADLLFPTTLAW SEQIDNO:311 Var23 AEQNPIYFARYADWLFTTPL SEQIDNO:312 Var24 EDQNPWARYADLLFPTTLAW SEQIDNO:3 ATRAM GLAGLAGLLGLEGLLGLPLGLLEGLWLGLELEGN SEQIDNO:188 pHLIP-CA9 EQNPIYILDLVFGLLFAVTSVDFLVQWDDAGD SEQIDNO:82 pHLIP-Rho NLEGFFATLGGEIALWSLVVLAIE SEQIDNO:189 pHLIP-RhoM1 NNEGFFATLGGEIALWSDVVLAIE SEQIDNO:190 pHLIP-RhoM2 DNNEGFFATLGGEIPLWSDVVLAIE
[0308] Substitutions with natural amino acids may alternatively or additionally be characterized using a BLOcks SUbstitution Matrix (a BLOSUM matrix). An example of a BLOSUM matrix is the BLOSUM62 matrix, which is described in Styczynski et al. (2008) BLOSUM62 miscalculations improve search performance Nat Biotech 26 (3): 274-275, the entire content of which is incorporated herein by reference. The BLOSUM62 matrix is shown in
[0309] Substitutions scoring at least 4 on the BLOSUM62 matrix are referred to herein as Class I substitutions; substitutions scoring 3 on the BLOSUM62 matrix are referred to herein as Class II substitutions; substitutions scoring 2 or 1 on the BLOSUM62 matrix are referred to herein as Class III substitutions; substitutions scoring 0 or 1 on the BLOSUM62 matrix are referred to herein as Class IV substitutions; substitutions scoring 2, 3, or 4 on the BLOSUM62 matrix are referred to herein as Class V substitutions.
[0310] Various embodiments of the subject application include pH-triggered peptides that have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more Class I, II, III, IV, or V substitutions compared to a pH-triggered peptide exemplified herein, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more of any combination of Class I, II, III, IV, and/or V substitutions compared to a pH-triggered peptide exemplified herein.
[0311] Aspects of the present subject matter also relate to pHLIP peptides having 1, 2, 3, 4, 5, or more amino acid insertions or deletions compared to pHLIP peptides exemplified herein. Also provided are pHLIP peptide variants having no insertions or deletions compared to a pHLIP peptide exemplified herein.
D-Amino Acids
[0312] Of the standard -amino acids, all but glycine can exist in either of two optical isomers, called L or D amino acids, which are mirror images of each other. While L-amino acids represent all of the amino acids found in proteins during translation in the ribosome, D-amino acids are found in some proteins produced by enzyme posttranslational modifications after translation and translocation to the endoplasmic reticulum. D amino acids are abundant components of the peptidoglycan cell walls of bacteria, and D-serine acts as a neurotransmitter in the brain. The L and D convention for amino acid configuration refers not to the optical activity of the amino acid itself, but rather to the optical activity of the isomer of glyceraldehyde from which that amino acid can be synthesized (D-glyceraldehyde is dextrorotary; L-glyceraldehyde is levorotary).
[0313] pHLIP peptides either fully or partially built of D-amino acids possess advantages over L-pHLIP peptides. For example, D-pHLIP peptides are biodegraded slower than their levorotary counterparts leading to enhanced activity and longer biological half lives (Sela and Zisman, 1997 FASEB J, 11: 449-456, incorporated herein by reference). Thus, D-pHLIP peptides may be used in the methods disclosed herein. Included herein are pHLIP peptides that comprise solely L-amino acids or solely D-amino acids, or a combination of both D-amino acids and L-amino acids.
Isotopes
[0314] pHLIP peptides and/or cargo compounds optionally contain radioactive elements or stable isotopes, or a combination of both. Stable isotopes are chemical isotopes that may or may not be radioactive, but if radioactive, have half-lives too long to be measured. Different isotopes of the same element (whether stable or unstable) have nearly the same chemical characteristics and therefore behave almost identically in biology (a notable exception is the isotopes of hydrogen). The mass differences, due to a difference in the number of neutrons, will result in partial separation of the light isotopes from the heavy isotopes during chemical reactions and during physical processes such as diffusion and vaporization. This process is called isotope fractionation. Examples of stable isotopes include oxygen, carbon, nitrogen, hydrogen and sulfur. Heavier stable isotopes include iron, copper, zinc, and molybdenum.
[0315] Gamma cameras are used in e.g. scintigraphy, SPECT and PET to detect regions of biologic activity that may be associated with disease. In various embodiments, a relatively short lived isotope, such as .sup.123I is administered to the patient.
[0316] Scintigraphy (scint) is a form of diagnostic test wherein radioisotopes are taken internally, for example intravenously or orally. Then, gamma cameras capture and form two-dimensional images from the radiation emitted by the radiopharmaceuticals.
[0317] Single-photon emission computed tomography (SPECT) is a 3D tomographic technique that uses gamma camera data from many projections and can be reconstructed in different planes. A dual detector head gamma camera combined with a CT scanner, which provides localization of functional SPECT data, is termed a SPECT/CT camera, and has shown utility in advancing the field of molecular imaging. In SPECT imaging, the patient is injected with a radioisotope, most commonly Thallium .sup.201TI, Technetium .sup.99mTC, Iodine .sup.123I and Gallium .sup.67Ga.
[0318] Positron emission tomography (PET) uses coincidence detection to image functional processes. Short-lived positron emitting isotope, such as .sup.18F, is incorporated with an organic substance such as glucose, creating F18-fluorodeoxyglucose, which can be used as a marker of metabolic utilization. Images of activity distribution throughout the body can show rapidly growing tissue, like tumor, metastasis, or infection. PET images can be viewed in comparison to computed tomography scans to determine an anatomic correlate. Other radioisotopes used in nuclear medicine thallium-201, tellurium-123, cadmium-113, cobalt-60, and strontium-82.
Chemotherapeutic Agents
[0319] Various chemotherapeutic agents may serve as pH-triggered compound cargo compounds. Non-limiting examples include alkylating agents (such as nitrogen mustards, notrisoureas, alkyl sulfonates, triazines, ethylenimines, and platinum-based compounds); antimetabolites (such as 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), capecitabine (Xeloda), cytarabine (Ara-C), floxuridine, fludarabine, gemcitabine (Gemzar), hydroxyurea, methotrexate, and pemetrexed (Alimta)); topoisomerase inhibitors (e.g., topotecan, irinotecan, etoposide, and teniposide); taxanes (such as paclitaxel and docetaxel); platinum-based chemotherapeutics (such as cisplatin and carboplatin); anthracyclines (such as daunorubicin, doxorubicin (Adriamycin), epirubicin, and idarubicin); epothilones (e.g., ixabepilone); vinca alkaloids (e.g., vinblastine (Velban), vincristine (Oncovin), and vinorelbine (Navelbine)); estramustine; actinomycin-D; bleomycin; mitomycin-C; mitoxantrone; imatinib; lenalidomide; pemetrexed; bortezomib; leuprorelin; and abiraterone.
Antimicrobial Cargo Compounds
[0320] Various antimicrobial agents may serve as pH-triggered compound cargo compounds. For example, the antimicrobial agent may be an antibacterial agent, an antifungal agent, or an antiprotozoal agent. In some embodiments, an antibacterial agent is also effective at killing fungi and/or protozoans, or slowing the growth thereof. In some embodiments, a composition comprising a pH-triggered compound linked to an antimicrobial cargo is applied to the skin or a mucous membrane to prevent or control a microbial infection. In various embodiments, the infection is a bacterial or a fungal infection. In certain embodiments, the infection is a protozoan infection, such as leishmaniasis.
[0321] Non-limiting examples of microbial infections include diaper rashes, vaginal yeast infections, opportunistic skin infections, tineal fungal infections, superficial skin infections, acne, athlete's foot, thrush (candidiasis), and the like. In various embodiments, a cargo compound inhibits the growth of one or more microbe species selected from the group consisting of Staphylococcus species, Streptococcus species, Pseudomonas species, Escherichia coli, Gardnerella vaginalis, Propionibacterium acnes, Blastomyces species, Pneumocystis carinii, Aeromonas hydrophilia, Trichosporon species, Aspergillus species, Proteus species, Acremonium species, Cryptococcus neoformans, Microsporum species, Aerobacter species, Clostridium species, Klebsiella species, Candida species and Trichophyton species.
[0322] Non-limiting examples of antibacterial agents include penicillins (e.g., methicillin, nafcillin, oxacillin, cloxacillin, ampicillin, amoxicillin, pivampicillin, hetacillin, bacampicillin, metampicillin, talampicillin, epicillin, dicloxacillin, carbenicillin, ticarcillin, mezlocillin, piperacillin, penicillin G, and penicillin V); cephalosporins (e.g., cefaclor, cefonicid, cefprozil, cefuroxime, cefuzonam, cefmetazole, cefotetan, cefoxitin, cefacetrile, cefadroxil, cephalexin, cefaloglycin, cefalonium, cefaloridine, cefalotin, cefapirin, cefatrizine, cefazaflur, cefazedone, cefazolin, cefradine, cefroxadine, ceftezole, cefcapene, cefdaloxime, cefdinir, cefditoren, cefetamet, cefixime, cefmenoxime, cefodizime, cefotaxime, cefovecin, cefpimizole, cefpodoxime, cefteram, ceftamere, ceftibuten, ceftiofur, ceftiolene, ceftizoxime, ceftriaxone, cefclidine, cefepime, cefluprenam, cefoselis, cefozopran, cefpirome, cefquinome ceftobiprole, ceftaroline, ceftolozane, cefaloram, cefaparole, cefcanel, cefedrolor, cefempidone, cefetrizole, cefivitril, cefmatilen, cefmepidium, cefoxazole, cefrotil, cefsumide, ceftioxide, cefuracetime, and nitrocefin); carbapenems (e.g., meropenem, ertapenem, doripenem, biapenem, panipenem, betamipron); rifamycins (e.g., rifamycin B, rifamycin SV, rifampicin, rifabutin, rifapentine, and rifaximin); lipiarmycins (e.g., lipiarmycin B, fidaxomicin); quinolones (e.g., cinoxacin, nalidixic acid, oxolinic acid, piromidic acid, pipemidic acid, rosoxacin, ciprofloxacin, enoxacin, fleroxacin, lomefloxacin, nadifloxacin, norfloxacin, ofloxacin, pefloxacin, rufloxacin balofloxacin, grepafloxacin, levofloxacin, pazufloxacin, sparfloxacin, temafloxacin, tosufloxacin, clinafloxacin, gatifloxacin, gemifloxacin, moxifloxacin, sitafloxacin, trovafloxacin, nemonoxacin, delafloxacin, and prulifloxacin); sulfonamides (e.g., sulfacetamide, sulfadiazine, sulfadimidine, sulfafurazole, sulfisomidine, sulfadoxine, sulfamethoxazole, sulfamoxole, sulfanitran, sulfadimethoxine, sulfamethoxypyridazine, sulfametoxydiazine, sulfadoxine, and sulfametopyrazine); macrolides (e.g., azithromycin, clarithromycin, erythromycin, fidaxomicin, telithromycin, carbomycin A, josamycin, kitasamycin, midecamycin, midecamycin acetate, oleandomycin, solithromycin, spiramycin, troleandomycin, tylosin, tylocine, and roxithromycin); lincosamides (e.g., lincomycin and clindamycin); tetracyclines (e.g., tetracycline); aminoglycosides (e.g., streptomycin, kanamycin, amikacin, dibekacin, sisomicin, netilmicin, tobramycin, gentamicin, and neomycin); cyclic lipopeptides (such as daptomycin); glycylcyclines (such as tigecycline); oxazolidinones (such as linezolid); and lipiarmycins (such as fidaxomicin); arsphenamine; prontosil; trimethoprim (TMP); sulfamethoxazole (SMX); co-trimoxaxole (a combination of TMP and SMX); meclocycline; neomycin B, C, or E; poymyxin B; bacitracin; tazobactam; a combination of ceftolozane and tazobactam; ceftazidime; avibactam; a combination of ceftazidime and avibactam; ceftaroline; andavibactam; a combination of ceftaroline and andavibactam; imipenem; plazomicin; eravacycline; and brilacidin. In some embodiments, two or more pH-triggered compounds, each comprising a different antibiotic, are combined to deliver a combination of antibiotics to a site.
[0323] Non-limiting examples of antifungal agents include polyene antifungals (e.g., amphotericin B, candicidin, filipin, hamycin, natamycin, nystatin, and rimocidin); imidazoles (bifonazole, butoconazole, clotrimazole, econazole, fenticonazole, isoconazole, ketoconazole, luliconazole, miconazole, omoconazole, oxiconazole, sertaconazole, sulconazole, and tioconazole); triazoles (albaconazole, efinaconazole, epoxiconazole, fluconazole, isavuconazole, itraconazole, posaconazole, propiconazole, ravuconazole, terconazole, voriconazole); thiazoles (e.g., abafungin); allylamines (e.g., amorolfin, butenafine, naftifine, and terbinafine); echinocandins (e.g., anidulafungin, caspofungin, and micafungin); ciclopirox; 5-fluorocytosine; griseofulvin; haloprogin; tolnaftate, undecylenic acid, Crystal violet, and balsam of Peru.
[0324] Non-limiting examples of antiprotozoal agents include metronidazole, co-trimoxaxole, eflornithine, furazolidone, melarsoprol, metronidazole, ornidazole, paromomycin sulfate, pentamidine, pyrimethamine, tinidazole, and nifursemizone.
[0325] An antimicrobial composition can be formulated to be suitable for application in a variety of ways, for example in a cream for skin (e.g., ringworm or athlete's foot), in a wash for the mouth (e.g., oral thrush), in a douche for vaginal application (e.g., vaginitis), in a powder for chaffing (e.g., dermatitis), in a liquid for toe nails (e.g., tinea pedis), in a bath salt or bath powder for treating genital, foot or other tissue infections in a bath, and the like.
[0326] Antimicrobial compositions can be formulated to be suitable for application in a variety of ways, for example in a cream for skin (e.g., ringworm or athlete's foot), in a wash for the mouth (e.g., oral thrush), in a douche for vaginal application (e.g., vaginitis), in a powder for chaffing (e.g., dermatitis), in a liquid for toe nails (e.g., tinea pedis), in a bath salt or bath powder for treating genital, foot or other tissue infections in a bath, and the like. In various embodiments of the invention, there is provided a method of inhibiting growth of or a pathogenic microbe, including applying a pH-triggered compound or a composition comprising a pH-triggered compound to a solid surface, contacting the solid surface with the applied pH-triggered compound thereon to skin or a mucous membrane of a mammal, and allowing the solid surface to contact the skin or mucous membrane for sufficient time to allow the pH-triggered compound to inhibit growth the pathogenic microbe adjacent to or on the skin or mucous membrane. In some embodiments, the applying step includes applying the composition to a diaper, pliable material for wiping skin or a mucous membrane, dermal patch, adhesive tape, absorbent pad, tampon or article of clothing. In another embodiment, the applying step includes impregnating the composition into a fibrous or non-fibrous solid matrix.
[0327] The term topical is broadly utilized herein to include both epidermal and/or skin surfaces, as well as mucosal surfaces of the body.
Fluorescent pH-Triggered Compounds
[0328] Included herein are pH-triggered compounds comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or more pHLIP peptides and 1 or more fluorophores. As used herein, the term fluorophore includes any compound that emits energy. The energy may be in the form of, e.g., acoustic energy (such as sound waves), heat, or electromagnetic radiation. In various embodiments, the electromagnetic radiation may be visible or non-visible to the human eye. In some embodiments, the electromagnetic radiation is infrared or near-infrared. Non-limiting examples of fluorophores include luminescent compounds, fluorescent compounds, phosphorescent compounds, chemiluminescent compounds, optoacoustic compounds, and quencher compounds (e.g., fluorescent quencher compounds). Fluorophores may comprise, e.g., small molecule compounds (e.g., organic compounds having a molecular weight of less than about 2000, 1000, or 500 daltons), proteins, or chelated metals (e.g., a chelator attached to a metal via covalent or non-covalent coordination bonds, wherein the combination of the chelator and the metal is fluorescent). In some embodiments, a chelated metal is within a cage formed by a chelator, and the combination of the chelator and the metal is fluorescent. In certain embodiments, the emission of energy (e.g., electromagnetic radiation such as luminescence, acoustic energy such as sound waves, or heat) does not involve the absorption and then emission of energy. In some embodiments, the emission of energy involves the absorbance and then the emission of energy.
[0329] As used herein, a compound that transfers greater than 50% the energy of absorbed light into the heat is called a quencher. In some embodiments, a quencher transfers all of the energy of absorbed light into heat. In various embodiments, a quencher can emit some amount of light, but most of the absorbed energy (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% of the absorbed energy) is transferred into the heat. Non-limiting examples of quenchers include: i) Dabsyl (dimethylaminoazobenzenesulfonic acid); ii) Black Hole Quenchers (which can quench in wide range of practically the entire visible spectrum); and iii) IRDye QC-1 [which can quench in the range for visible to NIR (500-900 nm)]. A main principle of optoacoustic imaging is the following: Absorption of light by a fluorophore or quencher, and the transfer of energy into heat, which leads to thermal expansion and the generation of acoustic waves, which are detected. In general, fluorophores transfer some, e.g., a minimal amount, of energy to heat; however most of the energy of a fluorophore is emitted in a form of light. In certain preferred embodiments relating to luminescent fluorophores (e.g., fluorophores that emit electromagnetic radiation such as light), a fluorophore emits more energy in the form of electromagnetic radiation (e.g., light), and less energy is transferred to heat. In certain preferred embodiments relating to quenchers, a quencher emits less energy in the form of electromagnetic radiation (e.g., light), and more energy is transferred to heat. Therefore, ICG can be used as a fluorophore in fluorescent imaging, as well as in optoacoustic imaging, due its property of transferring some energy to the heat.
[0330] In embodiments, the pHLIP compound is attached to one or more fluorophores (e.g., a fluorophore, a quencher such as a fluorophore quencher, or a combination comprising a fluorophore-quencher pair) to form a pH-triggered compound that is used as a diagnostic, imaging, ex vivo imaging agent, or as a research tool. In various embodiments, the pH-triggered compound comprises one or more fluorophores attached to a functional group used as a diagnostic, imaging, ex vivo imaging agent, or as a research tool.
[0331] In some embodiments, the fluorophore comprises a fluorescent dye, or a fluorescent quencher, or a combination of both.
[0332] In some embodiments, a fluorophore-quencher system used in fluorescence-guided imaging. For non-limiting descriptions of such systems, see, e.g., www.bachem.com/service-support/newsletter/peptide-trends-july-2016/. A non-limiting example of the use of a fluorophore-quencher system is described in Karabadzhak et al. (2014) ACS Chem Biol. 9(11):2545-53, the entire content of which is incorporated herein by reference. In certain embodiments, when the distance between a fluorophore and a quencher increases [e.g., because of a conformational change or due to the breakage of a bond (such as a peptide or other bond) connecting the fluorophore and the quencher], then the intensity of emission of fluorophore increases. In certain embodiments, the efficiency of fluorescence increases when the distance between the fluorophore and the quencher increases, which results in increased of fluorescent intensity.
[0333] In some embodiments, a pH-triggered compound comprising a fluorophore or a quencher (e.g., a pHLIP-quencher) is used for optoacoustic imaging. In various embodiments, optoacoustic imaging comprises a compound or moiety that absorbs light and transfers it to heat (e.g., with a optoacoustic imaging agent), which is measured by ultrasound, as opposed to fluorescence. In embodiments, fluorescence comprises a compound of moiety that absorbs light and emits it in the form of fluorescence or phosphorescence. In some embodiments, a fluorophore (e.g., a fluorophore that emits more energy in the form of light than heat) is used for optoacoustic imaging. In certain embodiments, an ICG-pH-triggered compound is used for optoacoustic imaging. Anon-limiting example of the use of a compound comprising a pH-triggered compound and a fluorescent dye as a multispectral optoacoustic tomography (MSOT) imaging agent is described in Kimbrough et al. (2015) Clin Cancer Res. 21(20):4576-85, the entire content of which is incorporated herein by reference.
[0334] In certain embodiments, the fluorophore comprises a near-infrared (NIR) fluorescent dye, e.g., indocyanine green (ICG), which operates in (e.g., has a peak emission wavelength within) NIR wavelengths. Infrared radiation extends from the nominal red edge of the visible spectrum at 700 nanometers (nm) to 1 mm. NIR radiation comprises a wavelength of 750 nm to 1.4 m. In some embodiments, the ICG has a peak emission wavelength between 810 nm and 880 nm (e.g., in the context of a pH-triggered compound). In certain embodiments, the ICG has a peak emission wavelength between 810 nm and 860 nm. In various embodiments, the ICG has a peak emission wavelength of about 800, 805, 810, 815, 820, 825, 830, 835, 840, 845, 850, 855, 860, 865, 870, or 880 nm. In some embodiments, a 805 nm laser is used for ICG excitation. In certain embodiments, a 801, 802, 803, 804, 804, 805, 806, 807, 808, 809, 810, 800-805, 804-806, or 802-807 nm laser is used for ICG excitation.
[0335] Non-limiting examples of NIR imaging systems (which may be useful in, e.g., clinical and diagnostic applications) include INFRARED 800, available from Carl Zeiss Meditec AG; Artemis, available from Quest Medical Imaging BV; HyperEye Medical System, available from Mizuho Medical Co. Ltd.; Near infrared fluorescence imager PDE C9830, available from Hamamatsu Photonics K.K.; SPECTROPATH Image-Guided Surgery System, available from Spectropath Inc.; the following from NOVADAQ Technologies Inc.: SPY Elite (imaging for open surgery), PINPOINT (endoscopic fluorescence imaging), LUNA (Fluorescence Angiography for Wound Care); Firefly Fluorescence imaging for the da Vinci Si System, available from Intuitive Surgical Inc.; NIR Leica FL800, available from Leica Microsystems; Fluobeam, available from Fluoptics Minatec-BHT; KG, Storz Karl Storz-Endoskope (Near-Infrared/Indocyanine Green), available from Karl Storz GmbH & Co.; and InfraVision Imaging System, available from Stryker Corporation.
[0336] In various embodiments, the fluorophore comprises an agent that operates at a wavelength (e.g., has a peak emission wavelength within) of from about 670 nm to about 750 nm, e.g., methylene blue.
[0337] In certain embodiments, the fluorophore comprises a cyanine dye. In embodiments, a cyanine dye operates at a wavelength (e.g., has a peak emission wavelength within) of 550-620 nm, 590-700 nm, 650-730 nm, 680-770 nm, 750-820 nm, or 770-850 nm. Non-limiting examples of cyanine dyes include Cy2, Cy3, Cy3B, Cy3.5, Cy5, Cy5.5, Cy7, and Cy7.5. In some embodiments, the cyanine dye is Cy3, Cy3.5, Cy5, Cy5.5, Cy7, or Cy7.5. In certain embodiments, the Cy3 has a peak emission wavelength between 550 and 620 nm (e.g., in the context of a pH-triggered compound). In various embodiments, the Cy3.5 has a peak emission wavelength between 590 and 700 nm (e.g., in the context of a pH-triggered compound). In some embodiments, the Cy5 has a peak emission wavelength between 650 and 730 nm (e.g., in the context of a pH-triggered compound). In certain embodiments, the Cy5.5 has a peak emission wavelength between 680 and 770 nm (e.g., in the context of a pH-triggered compound). In various embodiments, the Cy7 has a peak emission wavelength between 750 and 820 nm (e.g., in the context of a pH-triggered compound). In certain embodiments, the Cy7.5 has a peak emission wavelength between 770 and 850 nm (e.g., in the context of a pH-triggered compound).
[0338] In some embodiments, the peak emission wavelength of a fluorophore may vary (e.g., by about 5, 6, 7, 8, 9, or 10%) based on the environment and/or solvent around the fluorophore.
[0339] In some embodiments, the fluorophore comprises a fluorescent, or an optoacoustic contrast imaging agent. In certain embodiments, an optoacoustic imaging agent is fluorescent. In various embodiments, an optoacoustic imaging agent is not fluorescent. In certain embodiments, an optoacoustic imaging agent absorbs light, and transfers most of the light's energy (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% of the light's energy) into heat. In various embodiments, the heat is detected by ultrasound. In some embodiments, a quencher is be a fluorophore with a very low quantum yield, such that most of the energy absorbed by the quencher is transferred to heat rather than electromagnetic radiation (such as light).
[0340] Non-limiting examples of optoacoustic contrast imaging agents include ICG (which can be used for fluorescent imaging as well as for optoacoustic imaging), Alexa Fluor 750, Evans blue, BHQ3 (Black Hole Quencher-3; commercially available from, e.g., Biosearch Technologies, California, United States), QXL@680 (commercially available from, e.g., Cambridge Bioscience, Cambridge, United Kingdom), IRDye@800CW (commercially available from, e.g., LI-COR, Nebraska, United States), MMPSense750 FAST (commercially available from, e.g., PerkinElmer Inc., Texas, United States), diketopyrrolopyrrole cyanine, cypate-C18, Au nanoparticles (such as Au nanospheres, Au nanoshells, Au nanorods, Au nanocages, Au nanoclusters, Au nanostars, and Au nanobeacons), nanoparticles comprising a gold core covered with the Raman molecular tag trans-1,2-bis(4-pyridyl)-ethylene, Ag nanoplates, Ag nanosystems, quantum dots, nanodiamonds, polypyrrole nanoparticles, copper sulfide, graphene nanosheets, iron oxide-gold core-shells, Gd203, single-walled carbon nanotubules, dye-loaded perfluorocarbon-based nanoparticles, AuMBs, triggered nanodroplets, cobalt nanowontons, nanoroses, goldsilica core shell nanorods, superparamagnetic iron oxide, and methylene blue. Non-limiting examples and descriptions of optoacoustic contrast imaging agents are described in Wu et al. (2014) Int. J. Mol. Sci., 15, 23616-23639 (see, e.g., Table 1), the entire contents of which are incorporated herein by reference.
[0341] A pH-triggered compound comprising a fluorophore may optionally be referred to herein as a fluorescent pH-triggered compound.
[0342] In various embodiments, a fluorescent pH-triggered compound provided herein is for use as an agent in preoperative, intraoperative and postoperative settings.
[0343] In some embodiments, a fluorescent pH-triggered compound provided herein is for use as an agent for ex vivo imaging, and ex vivo diagnostics.
[0344] In various embodiments, a fluorescent pH-triggered compound provided herein is used to detect or image diseased tissue. Non-limiting examples of diseased tissue include cancerous tissue, inflamed tissue, ischemic tissue, arthritic tissue, cystic fibrotic tissue, tissue infected with a microorganism, and atherosclerotic tissue.
[0345] In some embodiments, a fluorescent pH-triggered compound provided herein is for use as an agent in fluorescence angiography. Fluorescence angiography is a procedure in which a fluorescent compound (such as a fluorescent pH-triggered compound disclosed herein) is injected into the bloodstream. The fluorescent pH-triggered compound highlights the blood vessels. In various embodiments, the vessels are in the back of the eye. In some embodiments the vessels are imaged or photographed. In non-limiting examples, fluorescence angiography is used to identify, detect image, or manage an eye disorder. In certain embodiments relating to ophthalmology, fluorescence angiography may be used to look at blood flow in, e.g., the retina and choroid.
[0346] In various embodiments, fluorescence angiography provides real-time imaging of blood vessels to follow changes during surgical procedures. Some non-limiting examples include the use of fluorescence in ophthalmology to evaluate the chorioretinal vasculature; in cardiothoracic surgery to assess the effectiveness of a coronary artery bypass; in neurovascular surgery to assess the effect of a superficial temporal artery-middle cerebral artery bypass graft in cerebral revascularization procedure; in hepatobiliary surgery to identify the haptic segment and subsegment for anatomical hepatic resection; in reconstructive surgeries; and in cholecystectomy and colorectal resection. In non-limiting examples of diagnostic applications, fluorescence angiography is used for imaging of hemodynamics in the brain; circulatory features of rheumatoid arthritis; muscle perfusion; burns and to assess various other effects of trauma.
[0347] In certain embodiments, a fluorescent pH-triggered compound provided herein is for visualization of blood circulation in ophthalmology, cardiothoracic surgery, bypass coronary surgery, neurosurgery, hepatobiliary surgery, reconstructive surgery, cholecystectomy, colorectal resection, brain surgery, muscle perfusion, wound and trauma surgery, and laparoscopic surgery.
[0348] In various embodiments, a fluorescent pH-triggered compound provided herein is for visualization of lymph nodes.
[0349] In some embodiments, a fluorescent pH-triggered compound provided herein is for visualization or detection of pre-cancerous tissue or cancerous lesions.
[0350] In certain embodiments, a fluorescent pH-triggered compound provided herein is for visualization or detection of pre-cancerous tissue or cancerous lesions in bladder, upper urinary tract, kidney, prostate, breast, head and neck, oral, pancreatic, lungs, liver, cervical, ovarian, or brain tumors.
[0351] In various embodiments, a fluorescent pH-triggered compound provided herein for real-time assessment of blood flow and tissue perfusion during intraoperative procedures.
[0352] In an aspect, provided herein is a composition for parenteral, local, or systemic administration comprising a fluorescent pH-triggered compound.
[0353] In an aspect, included herein is a composition for intravenous, intraarterial, intraperitoneal, intracerebral, intracerebroventricular, intrathecal, intracardiac, intracavernous, intraosseous, intraocular, intravitreal administration of a fluorescent pH-triggered compound.
[0354] In an aspect, provided herein is composition for intramuscular, intradermal, transdermal, transmucosal, intralesional, subcutaneous, topical, epicutaneous, extra-amniotic, intravaginal, intravesical, nasal, or oral administration of a fluorescent pH-triggered compound.
[0355] In an aspect, included herein is a composition for an ex vivo treatment of biopsy specimens, liquid biopsy specimens, surgically removed tissue, surgically removed liquids, or blood comprising a fluorescent pH-triggered compound.
[0356] In an aspect, a subject's blood is contacted with the fluorescent pH-triggered compound (e.g., in vivo or ex vivo).
[0357] In various embodiments, a lower dose of a fluorophore (such as ICG) is effective when the fluorophore is part of a fluorescent pH-triggered compound, e.g., conjugate, compared to the effective dose (e.g., for imaging or detection) of the free fluorophore, e.g., the non-conjugated fluorophore. In some embodiments, administration of a lower effective dose of the fluorophore as part of a fluorescent pH-triggered compound results in lower side effects. In certain embodiments, a fluorophore may make a subject more sensitive to solar radiation after administration such that the subject develops a greater degree of sunburn following exposure to solar radiation compared to a subject to which a fluorophore such as ICG has not been administered. In various embodiments, a fluorophore is delivered as part of a fluorescent pH-triggered compound to subject in a lower dose than would be necessary if the fluorophore was administered in free form, thereby reducing or minimizing phototoxicity (e.g., toxicity to the skin/sunburn) from exposure to solar radiation than if the free form of the fluorophore was administered.
[0358] In some embodiments, the fluorescent pH-triggered compound comprises a pHLIP compound and ICG (e.g., an ICG-pHLIP peptide such as ICG-Var3). In certain embodiments, the fluorescent pH-triggered compound is administered at a dose of about 0.01-0.5 mg/kg of a subject. In various embodiments, the fluorescent pH-triggered compound is administered at a dose of about 0.02-0.2 mg/kg of a subject. In some embodiments, the fluorescent pH-triggered compound is administered at a dose of about 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.125, 0.15, 0.175, 0.2, 0.25, or 0.5 mg/kg of a subject. In certain embodiments, the fluorescent pH-triggered compound is administered at a dose of at least about 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.125, 0.15, 0.175, or 0.2 mg/kg, but less than about 0.25, 0.5, 1, 2, 3, 4, or 5 mg/kg. In various embodiments, 1-10 mg of the fluorescent pH-triggered compound is administered to a subject. In some embodiments, about 0.5 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 15 mg of the fluorescent pH-triggered compound is administered to a subject. In certain embodiments, at least 0.5, 1, 2, or 3 mg, but less than 10 or 1 mg, of the fluorescent pH-triggered compound is administered to the subject. In various embodiments, about 0.3-3 mol of the fluorescent pH-triggered compound is administered to the subject. In some embodiments, about 0.1, 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mol of the fluorescent pH-triggered compound is administered to the subject. In certain embodiments, at least about 0.1, 0.5, or 1 mol, but less than 3, 4, or 5 mol, of the fluorescent pH-triggered compound is administered to the subject. In various embodiments, the fluorescent pH-triggered compound is administered by intravenous injection for about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 1-10, 1-15, 5-10, 5-15, 5-20, 10-15, 10-20, or 15-20 minutes.
[0359] In certain embodiments, about 0.5 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 15 mg of the fluorescent pH-triggered compound is instilled into an organ or tissue (e.g. a bladder). In certain embodiments, at least 0.5, 1, 2, or 3 mg, but less than 10 or 1 mg, of the fluorescent pH-triggered compound is instilled into an organ or tissue (e.g. a bladder). In various embodiments, about 0.3-3 mol of the fluorescent pH-triggered compound is instilled into an organ or tissue (e.g. a bladder). In some embodiments, about 0.1, 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mol of the fluorescent pH-triggered compound is instilled into an organ or tissue (e.g. a bladder). In certain embodiments, at least about 0.1, 0.5, or 1 mol, but less than 3, 4, or 5 mol, of the fluorescent pH-triggered compound is instilled into an organ or tissue (e.g. a bladder). In various embodiments, the fluorescent pH-triggered compound is instilled into an organ or tissue (e.g. a bladder) for about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 1-10, 1-15, 5-10, 5-15, 5-20, 10-15, 10-20, or 15-20 minutes.
[0360] In certain embodiments, the fluorescent pH-triggered compound further comprises polyethylene glycol. In some embodiments, the fluorescent pH-triggered compound further comprises one or more polyethylene glycol subunits (e.g., 3, 4, 5, 6, 7, 8, 9, 0, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 3-10, 10-20, or 3-20 subunits).
[0361] Included herein is a method for detecting (e.g., imaging) blood flow in a subject, comprising (a) administering a fluorescent pH-triggered compound comprising a fluorophore (such as ICG) disclosed herein to the subject; (b) contacting the subject (e.g., an area, cell, tissue, or organ of the subject, such as an area or tissue that may comprise a portion of the administered fluorescent pH-triggered compound) with electromagnetic radiation comprising an excitation wavelength of the fluorophore; and (c) detecting electromagnetic radiation emitted from the fluorescent pH-triggered compound in the subject. In embodiments, detection of the radiation indicates the presence (e.g., the location or amount at a location) of blood in the subject. In embodiments, an image of the blood in the subject is produced.
[0362] Also provided is a method for detecting (e.g., imaging) a fluorescent pH-triggered compound in a subject, comprising (a) administering a fluorescent pH-triggered compound comprising a fluorophore (such as ICG) disclosed herein to the subject; (b) contacting the subject (e.g., an area or tissue of the subject, such as an area, cell, tissue, or organ that may comprise a portion of the administered fluorescent pH-triggered compound) with electromagnetic radiation comprising an excitation wavelength of the fluorophore; and (c) detecting electromagnetic radiation emitted from the fluorescent pH-triggered compound in the subject. In embodiments, detection of the radiation indicates the presence (e.g., the location or amount at a location) of a bodily fluid such as blood in the subject. In embodiments, an image of the blood in the subject is produced.
[0363] Included herein is a method for optoacoustic detection or imaging of blood flow in a subject, comprising (a) administering a fluorescent pH-triggered compound, wherein the fluorophore is an optoacoustic imaging agents such as a luminescent fluorophore or a quencher; (b) contacting the subject (e.g., an area, cell, tissue, or organ of the subject, such as an area or tissue that may comprise a portion of the administered fluorescent pH-triggered compound) with electromagnetic radiation comprising an excitation wavelength of the fluorophore; and (c) detecting energy such as acoustic energy (e.g., sound waves). In embodiments, detection of the energy indicates the presence (e.g., the location or amount at a location) of blood in the subject. In various embodiments, an image of the blood in the subject is produced. In some embodiments, the presence of acoustic energy is detected by ultrasound (e.g., heat is released and creates expansion, generating sound waves, which is detected).
[0364] The present subject matter also provides a method for detecting (e.g., imaging) a fluorescent pH-triggered compound in a subject, wherein the fluorophore is an optoacoustic imaging agents such as a luminescent fluorophore or a quencher, the method comprising (a) administering the fluorescent pH-triggered compound to the subject; (b) contacting the subject (e.g., an area or tissue of the subject, such as an area, cell, tissue, or organ that may comprise a portion of the administered fluorescent pH-triggered compound) with electromagnetic radiation comprising an excitation wavelength of the fluorophore; and (c) detecting energy such as acoustic energy (e.g., sound waves). In embodiments, detection of the energy indicates the presence (e.g., the location or amount at a location) of a bodily fluid such as blood in the subject. In embodiments, an image of the blood in the subject is produced. In embodiments, the presence of acoustic energy is detected by ultrasound.
[0365] Depending on context, excitation wavelength may be used synonymously with absorption wavelength.
[0366] In various embodiments, the method comprises a fluorescence-guided imaging procedure performed during surgery or during a doctor's visit. In some embodiments, the method comprises fluorescence angiography. In certain embodiments, the method comprises the assessment of the perfusion of tissues and organs. In various embodiments, the method comprises the assessment of hepatic function. In some embodiments, the fluorescence-guided imaging procedure comprises targeting, marking, detecting, or visualization of pre-cancerous tissue, cancerous tissue, inflamed tissue, ischemic tissue, arthritic tissue, tissue infected with a microorganism, and/or atherosclerotic tissue. In certain embodiments, the method comprises assessing patency of a coronary artery bypass during cardiothoracic surgery. In some embodiments, the method comprises assessing the effect of a superficial temporal artery-middle cerebral artery bypass graft during or after neurovascular surgery, e.g., in a cerebral revascularization procedure. In certain embodiments, the method comprises identify the haptic segment and subsegment for anatomical hepatic resection during hepatobiliary surgery. In some embodiments, the method comprises imaging tissue or blood during a reconstructive surgery. In certain embodiments, the method comprises imaging tissue or blood during cholecystectomy or colorectal resection. In some embodiments, the method comprises intraoperatively identifying brain tumors such as malignant gliomas.
[0367] In various embodiments, the method comprises a diagnostic imaging procedure. In some embodiments, the method comprises retinal angiography. In certain embodiments, the method comprises detecting or imaging chorioretinal vasculature.
[0368] In some embodiments, the method comprises mapping and visualization of lymph nodes. In certain embodiments, the method comprises targeting and marking (e.g., visualizing or detecting) pre-cancerous tissue, cancerous lesions and/or assessment of tumor margins.
[0369] In various embodiments, the fluorescent pH-triggered compound is administered by parenteral, local, or systemic administration. In certain embodiments, a fluorescent pH-triggered compound is administered by intravenous, intraarterial, intraperitoneal, intracerebral, intracerebroventricular, intrathecal, intracardiac, intracavernous, intraosseous, intraocular, or intravitreal administration. In various embodiments, fluorescent pH-triggered compound is administered by intramuscular, intradermal, transdermal, transmucosal, intralesional, subcutaneous, topical, epicutaneous, extra-amniotic, intravaginal, intravesical, nasal, or oral administration.
[0370] In an aspect, provided herein is a method for the ex vivo staining of human specimens and ex vivo diagnostics, comprising (a) contacting a biological sample from a subject with a fluorescent pH-triggered compound comprising a fluorophore (such as ICG) disclosed herein; (b) contacting the biological sample with electromagnetic radiation comprising an excitation wavelength of the fluorophore; and (c) detecting electromagnetic radiation emitted from the fluorescent pH-triggered compound. In embodiments, the biological sample comprises a biopsy specimen, a liquid biopsy specimen, surgically removed tissue, a surgically removed liquid, or blood.
[0371] In certain embodiments, a compound comprises multiple (e.g., 2-32, or 2, 3, 4, 5, 6, 7, 8, 9, 10 or more) units, wherein each unit comprises a pHLIP peptide that is connected (e.g., linked by a covalent bond) to a cargo compound. In some embodiments, the cargo compound comprises a fluorophore. In certain embodiments, the fluorophore is ICG.
[0372] In various embodiments, a fluorescent pH-triggered compound comprises two or more of the following compound linked (e.g., covalently) together (SEQ ID NO: 15 is disclosed below):
##STR00009##
[0373] In the sequence above, the pHLIP peptide sequence is NH.sub.2-ACDDQNPWRAYLDLLFPTDTLLLDLLWA-COOH (SEQ ID NO: 15), however the structures of the alanine and the cysteine at the N-terminal end of the peptide are shown.
[0374] In various embodiments, a fluorescent pH-triggered compound comprises two or more of one of or any combination of the following compounds linked (e.g., covalently) together:
##STR00010## ##STR00011##
Indocyanine Green
[0375] The non-invasive near-infrared (NIR) fluorescence imaging dye ICG is approved by the United States Food and Drug administration (FDA) for ophthalmologic angiography to determine cardiac output and liver blood flow and function. This dye is also used in cancer patients for the detection of solid tumors, localization of lymph nodes, and for angiography during reconstructive surgery, visualization of retinal and choroidal vasculature, and photodynamic therapy. In cancer diagnostics and therapeutics, ICG could be used as both an imaging dye and a hyperthermia agent.
[0376] ICG is a tricarbocyanine-type dye with NIR-absorbing properties (peak absorption around 800 nm) and little absorption in the visible range thus exhibit low autofluorescence, tissue absorbance, and scatter at NIR wavelengths (700-900 nm).
[0377] Unconjugated ICG may comprise the following structure:
##STR00012##
[0378] A CAS Registry Number for ICG is 3599-32-4.
[0379] ICG may be modified to, e.g., facilitate attachment the attachment thereof to peptides, such as pHLIPs disclosed herein. Non-limiting examples of commercially available (e.g., from Intrace Medical SA, Lausanne, Switzerland) modified ICG compounds include ICG N-succinimidyl ester (ICG-NHS ester), ICG-CBT, ICG-maleimide, ICG-azide, ICG-alkyne, and ICG-PEG-NHS ester.
[0380] The succinimidyl esters (NHS) of the ICG dye offer the opportunity to develop optimal conjugates. Succinimidyl ester active groups provide an efficient and convenient way to selectively link ICG dyes to primary amines (RNH.sub.2) on various substrates (antibodies, peptides, proteins, nucleic-acid, small molecule drugs, etc.). Succinimidyl esters have very low reactivity with aromatic amines, alcohols, and phenols, including tyrosine and histidine. An example of ICG-NHS ester comprises the following features: [0381] Excitation Class: Near infrared, NIR [0382] Excitation/Emission maximum (nm): 790/830 [0383] Molecular Weight: 828.04 g.Math.mol.sup.1 [0384] Formula: C.sub.49H.sub.53N.sub.3O.sub.7S
[0385] Structure:
##STR00013##
[0386] The circled portion of the structure above indicates the linker moiety.
[0387] A maleimide active group provides an efficient and convenient way to selectively link ICG dye to sulfhydryl groups (free thiol, RSH) on various substrates (antibodies, peptides, proteins, oligonucleotides, small molecule drugs, etc.) at neutral (physiological) pH without any activation. Maleimides have very low reactivity with amines, alcohols, and phenols (such as tyrosine and histidine) and do not react with histidine and methionine, providing a very high labeling selectivity. An example of ICG-maleimide comprises the following features: [0388] Excitation Class: Near infrared, NIR [0389] Excitation/Emission maximum (nm): 790/830 [0390] Molecular Weight: 853.09 g.Math.mol.sup.1 [0391] Formula: C.sub.51H.sub.56N.sub.4O.sub.6S
[0392] Structure:
##STR00014##
[0393] The circled portion of the structure above indicates the linker moiety.
[0394] The 2-cyanobenzothiazole labeling procedure is based on the biocompatible click-reaction between 2-cyanobenzothiazole moiety and any 1, 2- or 1, 3-aminothiols (e.g. free or N-terminal cysteine). This click reaction is 3 orders of magnitude faster than commonly used Staudinger ligation and can provide useful conjugates. Cyanobenzothiazole (CBT) active groups provide an efficient and convenient way to site-selectively link ICG dyes to 1,2- or 1,3-aminothiols on various substrates (antibodies, peptides, proteins, nucleic-acid, small molecule drugs, etc.) without any additional activation. The labeling reaction with aminothiols is selective over reaction with simple thiols. The CBT click chemistry can be used together with all other biocompatible click reactions (like azide, alkyne, triphenylphosphine, tetrazine etc.), as it is very selective. In addition in ICG-CBT labeling procedure no side product is formed as here is no leaving group (unlike NHS esters). An example of an ICG-CBT comprises the following features: [0395] Excitation Class: Near infrared, NIR [0396] Excitation/Emission maximum (nm): 790/830 [0397] Molecular Weight: 931.38 g.Math.mol.sup.1 [0398] Formula: C.sub.55H.sub.57N.sub.5O.sub.5S.sub.2
[0399] Structure:
##STR00015##
[0400] The circled portion of the structure above indicates the linker moiety.
[0401] ICG-azide can be used to label alkyne-tagged biomolecules (like proteins, lipids, nucleic acids, sugars) chemoselectively via click-chemistry. An example of ICG-azide comprises the following features: [0402] Excitation Class: Near infrared, NIR [0403] Excitation/Emission maximum (nm): 790/830 [0404] Molecular Weight: 931.21 g.Math.mol.sup.1 [0405] Formula: C.sub.53H.sub.66N.sub.6O.sub.7S
##STR00016##
[0406] The circled portion of the structure above indicates the linker moiety.
[0407] ICG-alkyne can be used to label azide-tagged molecules via Cu(II)-catalyzed click reaction. The reaction is chemoselective and biocompatible. An example of ICG-alkyne comprises the following features: [0408] Excitation Class: Near infrared, NIR [0409] Excitation/Emission maximum (nm): 790/830 [0410] Solubility: DMSO, DMF, Acetonitrile, Methanol [0411] Molecular Weight: 767.38 g.Math.mol.sup.1 [0412] Formula: C.sub.48H.sub.53N.sub.3O.sub.4S
Cyanine Fluorophores
[0413] Cyanine fluorophores may optionally be referred to herein as cyanine dyes. Cyanine dyes are molecules containing polymethine bridge between two nitrogen atoms with a delocalized charge:
##STR00017##
[0414] Due to their structure, cyanines have outstandingly high extinction coefficients often exceeding 100,000 Lmol.sup.1 cm.sup.1. Different substituents allow to control properties of the chromophore, such as absorbance wavelength, photostability, and fluorescence. For example, absorbance and fluorescence wavelength can be controlled by a choice of polymethine bridge length: longer cyanines possess higher absorbance and emission wavelengths up to near infrared region. Non-limiting examples of cyanine dyes include non-sulfonated cyanines, and sulfonated cyanines.
[0415] Available non-sulfonated dyes include, e.g., Cy3, Cy3.5, Cy5, Cy5.5, Cy7, and Cy7.5. Cy stands for cyanine, and the first digit identifies the number of carbon atoms between the indolenine groups. Cy2 which is an oxazole derivative rather than indolenin, is an exception from this rule. The suffix 0.5 is added for benzo-fused cyanines. In certain embodiments, variation of the structures allows to change fluorescence properties of the molecules, and to cover most important part of visible and NIR spectrum with several fluorophores.
[0416] The structures of Cy3, Cy3.5, Cy5, Cy5.5, Cy7, and Cy7.5 are as follows:
##STR00018## ##STR00019##
[0417] Sulfonated cyanines include additional sulfo-groups which, in some embodiments, facilitate dissolution of dye molecules in aqueous phase. In various embodiments, charged sulfonate groups decrease aggregation of dye molecules and heavily labeled conjugates.
[0418] Non-limiting examples of sulfonated cyanines include sulfo-Cy3, sulfo-Cy5, and sulfo-Cy7.
##STR00020##
IR800
[0419] The structure of IR800 maleimide is as follows:
##STR00021##
[0420] IR800 is also known as IRDye 800CW Infrared Dye, and is available from LI-COR Biosciences (Nebraska, United States).
Additional Definitions
[0421] Unless specifically defined otherwise, all technical and scientific terms used herein shall be taken to have the same meaning as commonly understood by one of ordinary skill in the art (e.g., in cell culture, molecular genetics, and biochemistry).
[0422] As used herein, the term about in the context of a numerical value or range means 10% of the numerical value or range recited or claimed, unless the context requires a more limited range.
[0423] In the descriptions above and in the claims, phrases such as at least one of or one or more of may occur followed by a conjunctive list of elements or features. The term and/or may also occur in a list of two or more elements or features. Unless otherwise implicitly or explicitly contradicted by the context in which it is used, such a phrase is intended to mean any of the listed elements or features individually or any of the recited elements or features in combination with any of the other recited elements or features. For example, the phrases at least one of A and B; one or more of A and B; and A and/or B are each intended to mean A alone, B alone, or A and B together. A similar interpretation is also intended for lists including three or more items. For example, the phrases at least one of A, B, and C; one or more of A, B, and C; and A, B, and/or C are each intended to mean A alone, B alone, C alone, A and B together, A and C together, B and C together, or A and B and C together. In addition, use of the term based on, above and in the claims is intended to mean, based at least in part on, such that an unrecited feature or element is also permissible.
[0424] It is understood that where a parameter range is provided, all integers within that range, and tenths thereof, are also provided by the invention. For example, 0.2-5 mg is a disclosure of 0.2 mg, 0.3 mg, 0.4 mg, 0.5 mg, 0.6 mg etc. up to and including 5.0 mg.
[0425] A small molecule is a compound that is less than 2000 daltons in mass. The molecular mass of the small molecule is preferably less than 1000 daltons, more preferably less than 600 daltons, e.g., the compound is less than 500 daltons, 400 daltons, 300 daltons, 200 daltons, or 100 daltons.
[0426] The transitional term comprising, which is synonymous with including, containing, or characterized by, is inclusive or open-ended and does not exclude additional, unrecited elements or method steps. By contrast, the transitional phrase consisting of excludes any element, step, or ingredient not specified in the claim. The transitional phrase consisting essentially of limits the scope of a claim to the specified materials, compounds, or steps and those that do not materially affect the basic and novel characteristic(s) of the claimed invention.
[0427] The compositions and elements of the compositions (e.g., peptides, moieties, and other components of the compositions) described herein may be purified. For example, purified naturally-occurring, synthetically produced, or recombinant compounds, e.g., polypeptides, nucleic acids, small molecules, or other agents, are separated from compounds with which they exist in nature. Purified compounds are at least 60% by weight (dry weight) the compound of interest. Preferably, the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99% or 100%, by weight the compound of interest. Purity is measured by any appropriate standard method, for example, by column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis.
[0428] Various embodiments of the invention relate to pH-triggered compounds (e.g., pH-triggered peptides) comprising cargo or a moiety. Depending on context, the cargo/moiety or may be referred to by a name or characteristic of an unconjugated form of the cargo/moiety regardless of whether the cargo/moiety is conjugated to a pH-triggered compound. For example, a small molecule known as Small Molecule X when in an unconjugated form may also be referred to herein as Small Molecule X when in a form that is bound to a pH-triggered compound (e.g., a pHLIP compound). Similarly, a toxin that is toxic only when free and unconjugated may still be referred to as a toxin when it is in a form that is bound to a pH-triggered compound (e.g., a pHLIP compound). In some embodiments, a cargo molecule is functional when free from a pH-triggered compound (e.g., after release from a pH-triggered compound, e.g., within a cell). In some embodiments, a cargo molecule is functional while still covalently linked to a pH-triggered compound.
[0429] As used herein, the singular forms a, an, and the include the plural reference unless the context clearly dictates otherwise. Thus, for example, a reference to a pHLIP peptide, a disease, a disease state, or a nucleic acid is a reference to one or more such embodiments, and includes equivalents thereof known to those skilled in the art and so forth.
[0430] As used herein, treating encompasses, e.g., inhibition, regression, or stasis of the progression of a disorder. Treating also encompasses the prevention or amelioration of any symptom or symptoms of the disorder. As used herein, inhibition of disease progression or a disease complication in a subject means preventing or reducing the disease progression and/or disease complication in the subject.
[0431] As used herein, a symptom associated with a disorder includes any clinical or laboratory manifestation associated with the disorder, and is not limited to what the subject can feel or observe.
[0432] As used herein, pharmaceutically acceptable carrier or excipient refers to a carrier or excipient that is suitable for use with humans and/or animals without undue adverse side effects (such as toxicity, irritation, and allergic response) commensurate with a reasonable benefit/risk ratio. It can be, e.g., a pharmaceutically acceptable solvent, suspending agent or vehicle, for delivering the instant compounds to the subject.
Click Reactions
[0433] Compounds described herein (e.g., pHLIP peptides and compounds comprising multiple pHLIP peptides) can include a covalent bond between the compound and a cargo compound, between a linker and a cargo compound, between a pHLIP peptide and a linker, and between two pHLIP peptides. In some embodiments, a covalent bond has been formed by a bio-orthogonal reaction such as a cycloaddition reaction (e.g., a click reaction). Exemplary bio-orthogonal reactions suitable for the preparation for such compounds are described in, e.g., Zheng et al., Development of Bioorthogonal Reactions and Their Applications in Bioconjugation, Molecules, 2015, 20, 3190-3205. The diversity and commercial availability of peptide precursors are attractive for constructing the multifunctional entities described herein. Described herein are exemplary, non-limiting click reactions suitable for, e.g., the preparation of pH-triggered peptide compounds that include a covalent bond between the peptide and a cargo compound.
Huisgen Cycloadditions
[0434] A category of click reactions includes Huisgen 1,3-dipolar additions of acetylenes to azides. See, e.g., Scheme 1.
##STR00022##
[0435] In embodiments, pH-triggered compound corresponds to any peptide or compound comprising multiple peptides disclosed herein. In certain embodiments, CARGO corresponds to any cargo compound described herein.
[0436] In embodiments, L.sup.1 is independently a bond, NR.sup.A, O, S, substituted or unsubstituted alkylene, substituted or unsubstituted alkenylene, substituted or unsubstituted alkynylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or L.sup.1 combines with R.sup.1 to form a substituted or unsubstituted 8-membered cycloalkynylene ring, or L.sup.1 comprises one or more amino acids as described herein.
[0437] In embodiments, R.sup.1 is hydrogen, substituted or unsubstituted alkyl, or R.sup.1 combines with L.sup.1 to form a substituted or unsubstituted 8-membered cycloalkynylene ring, or L.sup.1 comprises one or more amino acids as described herein.
[0438] In embodiments, L.sup.1 combines with R.sup.1 to form a substituted or unsubstituted 8-membered cycloalkynylene ring. In various embodiments, the 8-membered cycloalkynylene ring is unsubstituted. In some embodiments, the 8-membered cycloalkynylene ring comprises two fluoro substitutents (e.g., to the alkynyl).
[0439] In embodiments, L.sup.2 is independently a bond, NR.sup.B, O, S, substituted or unsubstituted alkylene, substituted or unsubstituted alkenylene, substituted or unsubstituted alkynylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or L.sup.2 comprises one or more amino acids as described herein.
[0440] In embodiments, each R.sup.A and R.sup.B is independently hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0441] In embodiments, the Huisgen cycloaddition is that described in Scheme 2 and Scheme 3.
##STR00023##
[0442] In embodiments, pH-triggered compound corresponds to any peptide or compound comprising multiple peptides disclosed herein. In certain embodiments, CARGO corresponds to any cargo compound described herein.
[0443] In embodiments, L.sup.1 is independently a bond, NR.sup.A, O, S, substituted or unsubstituted alkylene, substituted or unsubstituted alkenylene, substituted or unsubstituted alkynylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or L.sup.1 comprises one or more amino acids as described herein.
[0444] In embodiments, L.sup.2 is independently a bond, NR.sup.B, O, S, substituted or unsubstituted alkylene, substituted or unsubstituted alkenylene, substituted or unsubstituted alkynylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or L.sup.2 comprises one or more amino acids as described herein.
##STR00024##
[0445] In embodiments, pH-triggered compound corresponds to any peptide or compound comprising multiple peptides disclosed herein. In various embodiments, CARGO corresponds to any cargo compound described herein.
[0446] In embodiments, L.sup.1 is independently a bond, NR.sup.A, O, S, substituted or unsubstituted alkylene, substituted or unsubstituted alkenylene, substituted or unsubstituted alkynylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or L.sup.1 comprises one or more amino acids as described herein.
[0447] In embodiments, one of R.sup.3, R.sup.4, and R.sup.5 is a cargo compound, and the other two variables are independently hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0448] In embodiments, one of R.sup.3, R.sup.4, and R.sup.5 is a pH-triggered peptide compound, the other two variables are independently hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
Cycloadditions with Alkenes
[0449] In embodiments, certain activated alkenes (e.g., a strained alkene such as cis- or trans-cyclooctene or oxanorbornadiene), which may be represented as compound F or compound F, can undergo cycloaddition reactions with, e.g., an azide (Scheme 4), a tetrazine (Scheme 5), or a tetrazole (Scheme 6).
##STR00025##
[0450] In embodiments, pH-triggered compound corresponds to any peptide or compound comprising multiple peptides disclosed herein. In some embodiments, CARGO corresponds to any cargo compound described herein.
[0451] In embodiments, L.sup.1 is independently a bond, NR.sup.A, O, S, substituted or unsubstituted alkylene, substituted or unsubstituted alkenylene, substituted or unsubstituted alkynylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or L.sup.1 comprises one or more amino acids as described herein.
[0452] In embodiments, L.sup.2 is independently a bond, NR.sup.B, O, S, substituted or unsubstituted alkylene, substituted or unsubstituted alkenylene, substituted or unsubstituted alkynylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or L.sup.2 comprises one or more amino acids as described herein.
##STR00026##
[0453] In embodiments, pH-triggered compound corresponds to any peptide or compound comprising multiple peptides disclosed herein. In certain embodiments, CARGO corresponds to any cargo compound described herein.
[0454] In embodiments, L.sup.1 is independently a bond, NR.sup.A, O, S, substituted or unsubstituted alkylene, substituted or unsubstituted alkenylene, substituted or unsubstituted alkynylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or L.sup.1 comprises one or more amino acids as described herein.
[0455] In embodiments, L.sup.2 is independently a bond, NR.sup.B, O, S, substituted or unsubstituted alkylene, substituted or unsubstituted alkenylene, substituted or unsubstituted alkynylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or L.sup.2 comprises one or more amino acids as described herein.
##STR00027##
[0456] In embodiments, pH-triggered compound corresponds to any peptide or compound comprising multiple peptides disclosed herein. In various embodiments, CARGO corresponds to any cargo compound described herein.
[0457] In embodiments, L.sup.1 is independently a bond, NR.sup.A, O, S, substituted or unsubstituted alkylene, substituted or unsubstituted alkenylene, substituted or unsubstituted alkynylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or L.sup.1 comprises one or more amino acids as described herein.
[0458] In embodiments, L.sup.2 is independently a bond, NR.sup.B, O, S, substituted or unsubstituted alkylene, substituted or unsubstituted alkenylene, substituted or unsubstituted alkynylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or L.sup.2 comprises one or more amino acids as described herein.
[0459] In embodiments, R.sup.6 is independently hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0460] In embodiments, the invention features any of the compounds described herein (e.g., any of Compounds A, A, B, B; C, C, D, D, E, E, F, F, G, GH, or H; a compound according to any one of formulas (I-A), (I-B), (I-C), (I-D), (II-A), (II-B), (II-C), (II-D), (III-A), (III-B), (IV-A), (IV-B), (IV-C), (IV-C), (IV-D), (IV-D), (IV-E), or (IV-F); a compound according to Formula (A) such as any one of Formulas (A4)-(A20); or a compound according to any of SEQ ID NOS: 1-4); or a pharmaceutically acceptable salt thereof.
[0461] In embodiments, the invention features a composition (e.g., a pharmaceutical composition) comprising any of the compounds described herein (e.g., any of Compounds A, A, B, B; C, C, D, D, E, E, F, F, G, GH, or H; a compound according to any one of formulas (I-A), (I-B), (I-C), (I-D), (II-A), (II-B3), (II-C), (II-D3), (III-A), (III-B), (IV-A), (IV-B), (IV-C), (IV-C), (IV-D), (IV-D), (IV-E), or (IV-F); a compound according to Formula (A) such as any one of Formulas (A4)-(A20); or a compound according to any of SEQ ID NOS: 1-4); or a pharmaceutically acceptable salt thereof.
[0462] The term alkyl, by itself or as part of another substituent, means, unless otherwise stated, a non-cyclic straight (i.e., unbranched) or branched chain, or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals, having the number of carbon atoms designated (i.e., C.sub.1-C.sub.10 means one to ten carbons). Examples of saturated hydrocarbon radicals include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, (cyclohexyl)methyl, homologs and isomers of, for example, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like. An unsaturated alkyl group is one having one or more double bonds or triple bonds. Examples of unsaturated alkyl groups include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, 3-(1,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers. An alkoxy is an alkyl attached to the remainder of the molecule via an oxygen linker (O).
[0463] The term alkylene, by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkyl, as exemplified, but not limited by, CH.sub.2CH.sub.2CH.sub.2CH.sub.2. Typically, an alkyl (or alkylene) group will have from 1 to 24 carbon atoms. A lower alkyl or lower alkylene is a shorter chain alkyl or alkylene group, generally having eight or fewer carbon atoms.
[0464] The term heteroalkyl, by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or combinations thereof, consisting of at least one carbon atom and at least one heteroatom (e.g. selected from the group consisting of O, N, P, S, Se and Si, and wherein the nitrogen, selenium, and sulfur atoms may optionally be oxidized, and the nitrogen heteroatom may optionally be quaternized). The heteroatom(s) 0, N, P, S, Se, and Si may be placed at any interior position of the heteroalkyl group or at the position at which the alkyl group is attached to the remainder of the molecule. Examples include, but are not limited to: CH.sub.2CH.sub.2OCH.sub.3, CH.sub.2CH.sub.2NHCH.sub.3, CH.sub.2CH.sub.2N(CH.sub.3)CH.sub.3, CH.sub.2SCH.sub.2CH.sub.3, CH.sub.2CH.sub.2, S(O)CH.sub.3, CH.sub.2CH.sub.2S(O).sub.2CH.sub.3, CHCHOCH.sub.3, Si(CH.sub.3).sub.3, CH.sub.2CHNOCH.sub.3, CHCHN(CH.sub.3)CH.sub.3, OCH.sub.3, OCH.sub.2CH.sub.3, and CN. Up to two heteroatoms may be consecutive, such as, for example, CH.sub.2NHOCH.sub.3.
[0465] Similarly, the term heteroalkylene, by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from heteroalkyl, as exemplified, but not limited by, CH.sub.2CH.sub.2SCH.sub.2CH.sub.2 and CH.sub.2SCH.sub.2CH.sub.2NHCH.sub.2. For heteroalkylene groups, heteroatoms can also occupy either or both of the chain termini (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like). Still further, for alkylene and heteroalkylene linking groups, no orientation of the linking group is implied by the direction in which the formula of the linking group is written. For example, the formula C(O).sub.2R represents both C(O).sub.2R- and RC(O).sub.2. As described above, heteroalkyl groups, as used herein, include those groups that are attached to the remainder of the molecule through a heteroatom, such as C(O)R, C(O)NR, NRR, OR, SeR, SR, and/or SO.sub.2R. Where heteroalkyl is recited, followed by recitations of specific heteroalkyl groups, such as NRR or the like, it will be understood that the terms heteroalkyl and NRR are not redundant or mutually exclusive. Rather, the specific heteroalkyl groups are recited to add clarity. Thus, the term heteroalkyl should not be interpreted herein as excluding specific heteroalkyl groups, such as NRR or the like.
[0466] The terms cycloalkyl and heterocycloalkyl, by themselves or in combination with other terms, mean, unless otherwise stated, cyclic versions of alkyl and heteroalkyl, respectively. Additionally, for heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule. Examples of cycloalkyl include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3-cyclohexenyl, cycloheptyl, and the like. Examples of heterocycloalkyl include, but are not limited to, 1-(1,2,5,6-tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4-morpholinyl, 3-morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothien-2-yl, tetrahydrothien-3-yl, 1-piperazinyl, 2-piperazinyl, and the like. A cycloalkylene and a heterocycloalkylene, alone or as part of another substituent, means a divalent radical derived from a cycloalkyl and heterocycloalkyl, respectively.
[0467] The term aryl means, unless otherwise stated, a polyunsaturated, aromatic, hydrocarbon substituent, which can be a single ring or multiple rings (preferably from 1 to 3 rings) that are fused together (i.e., a fused ring aryl) or linked covalently. A fused ring aryl refers to multiple rings fused together wherein at least one of the fused rings is an aryl ring. The term heteroaryl refers to aryl groups (or rings) that contain from one to four heteroatoms (e.g. selected from N, O, and S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized). Thus, the term heteroaryl includes fused ring heteroaryl groups (i.e., multiple rings fused together wherein at least one of the fused rings is a heteroaromatic ring). A 5,6-fused ring heteroarylene refers to two rings fused together, wherein one ring has 5 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. Likewise, a 6,6-fused ring heteroarylene refers to two rings fused together, wherein one ring has 6 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. And a 6,5-fused ring heteroarylene refers to two rings fused together, wherein one ring has 6 members and the other ring has 5 members, and wherein at least one ring is a heteroaryl ring. A heteroaryl group can be attached to the remainder of the molecule through a carbon or heteroatom. Non-limiting examples of aryl and heteroaryl groups include phenyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3-pyrazolyl, 2-imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4-oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2-pyrimidyl, 4-pyrimidyl, 5-benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-isoquinolyl, 5-isoquinolyl, 2-quinoxalinyl, 5-quinoxalinyl, 3-quinolyl, and 6-quinolyl. Substituents for each of the above noted aryl and heteroaryl ring systems are selected from the group of acceptable substituents described below. An arylene and a heteroarylene, alone or as part of another substituent, mean a divalent radical derived from an aryl and heteroaryl, respectively.
[0468] A fused ring heterocyloalkyl-aryl is an aryl fused to a heterocycloalkyl. A fused ring heterocycloalkyl-heteroaryl is a heteroaryl fused to a heterocycloalkyl. A fused ring heterocycloalkyl-cycloalkyl is a heterocycloalkyl fused to a cycloalkyl. A fused ring heterocycloalkyl-heterocycloalkyl is a heterocycloalkyl fused to another heterocycloalkyl. Fused ring heterocycloalkyl-aryl, fused ring heterocycloalkyl-heteroaryl, fused ring heterocycloalkyl-cycloalkyl, or fused ring heterocycloalkyl-heterocycloalkyl may each independently be unsubstituted or substituted with one or more of the substituents described herein. Spirocyclic rings are two or more rings wherein adjacent rings are attached through a single atom. The individual rings within spirocyclic rings may be identical or different. Individual rings in spirocyclic rings may be substituted or unsubstituted and may have different substituents from other individual rings within a set of spirocyclic rings. Possible substituents for individual rings within spirocyclic rings are the possible substituents for the same ring when not part of spirocyclic rings (e.g., substituents for cycloalkyl or heterocycloalkyl rings). Spirocyclic rings may be substituted or unsubstituted cycloalkyl, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heterocycloalkylene and individual rings within a spirocyclic ring group may be any of the immediately previous list, including having all rings of one type (e.g. all rings being substituted heterocycloalkylene wherein each ring may be the same or different substituted heterocycloalkylene). When referring to a spirocyclic ring system, heterocyclic spirocyclic rings means a spirocyclic rings wherein at least one ring is a heterocyclic ring and wherein each ring may be a different ring. When referring to a spirocyclic ring system, substituted spirocyclic rings means that at least one ring is substituted and each substituent may optionally be different.
[0469] Each of the above terms (e.g., alkyl, heteroalkyl, aryl, and heteroaryl) includes both substituted and unsubstituted forms of the indicated radical. Preferred substituents for each type of radical are provided below.
[0470] Substituents for the alkyl and heteroalkyl radicals (including those groups often referred to as alkylene, alkenyl, heteroalkylene, heteroalkenyl, alkynyl, cycloalkyl, heterocycloalkyl, cycloalkenyl, and heterocycloalkenyl) can be one or more of a variety of groups selected from, but not limited to, OR, O, NR, NOR, NRR, SR, -halogen, SiRRR, OC(O)R, C(O)R, CO.sub.2R, CONRR, OC(O)NRR, NRC(O)R, NRC(O)NRR, NRC(O).sub.2R, NRC(NRRR)NR, NRC(NRR)NR, S(O)R, S(O).sub.2R, S(O).sub.2NRR, NRSO.sub.2R, CN, and NO.sub.2 in a number ranging from zero to (2m+1), where m is the total number of carbon atoms in such radical. R, R, R, and R each preferably independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl (e.g., aryl substituted with 1-3 halogens), substituted or unsubstituted alkyl, alkoxy, or thioalkoxy groups, or arylalkyl groups. When a compound of the invention includes more than one R group, for example, each of the R groups is independently selected as are each R, R, R, and R group when more than one of these groups is present. When R and R are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 4-, 5-, 6-, or 7-membered ring. For example, NRR includes, but is not limited to, 1-pyrrolidinyl and 4-morpholinyl. From the above discussion of substituents, one of skill in the art will understand that the term alkyl is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (e.g., CF.sub.3 and CH.sub.2CF.sub.3) and acyl (e.g., C(O)CH.sub.3, C(O)CF.sub.3, C(O)CH.sub.2OCH.sub.3, and the like).
[0471] Similar to the substituents described for the alkyl radical, substituents for the aryl and heteroaryl groups are varied and are selected from, for example: OR, NRR, SR, -halogen, SiRRR, OC(O)R, C(O)R, CO.sub.2R, CONRR, OC(O)NRR, NRC(O)R, NRC(O)NRR, NRC(O).sub.2R, NRC(NRRR)NR, NRC(NRR)NR, S(O)R, S(O).sub.2R, S(O).sub.2NRR, NRSO.sub.2R, CN, NO.sub.2, R, N.sub.3, CH(Ph).sub.2, fluoro(C.sub.1-C.sub.4)alkoxy, and fluoro(C.sub.1-C.sub.4)alkyl, in a number ranging from zero to the total number of open valences on the aromatic ring system; and where R, R, R, and R are preferably independently selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. When a compound of the invention includes more than one R group, for example, each of the R groups is independently selected as are each R, R, R, and R groups when more than one of these groups is present.
[0472] Substituents for rings (e.g. cycloalkyl, heterocycloalkyl, aryl, heteroaryl, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene) may be depicted as substituents on the ring rather than on a specific atom of a ring (commonly referred to as a floating substituent). In such a case, the substituent may be attached to any of the ring atoms (obeying the rules of chemical valency) and in the case of fused rings or spirocyclic rings, a substituent depicted as associated with one member of the fused rings or spirocyclic rings (a floating substituent on a single ring), may be a substituent on any of the fused rings or spirocyclic rings (a floating substituent on multiple rings). When a substituent is attached to a ring, but not a specific atom (a floating substituent), and a subscript for the substituent is an integer greater than one, the multiple substituents may be on the same atom, same ring, different atoms, different fused rings, different spirocyclic rings, and each substituent may optionally be different. Where a point of attachment of a ring to the remainder of a molecule is not limited to a single atom (a floating substituent), the attachment point may be any atom of the ring and in the case of a fused ring or spirocyclic ring, any atom of any of the fused rings or spirocyclic rings while obeying the rules of chemical valency. Where a ring, fused rings, or spirocyclic rings contain one or more ring heteroatoms and the ring, fused rings, or spirocyclic rings are shown with one or more floating substituents (including, but not limited to, points of attachment to the remainder of the molecule), the floating substituents may be bonded to the heteroatoms. Where the ring heteroatoms are shown bound to one or more hydrogens (e.g. a ring nitrogen with two bonds to ring atoms and a third bond to a hydrogen) in the structure or formula with the floating substituent, when the heteroatom is bonded to the floating substituent, the substituent will be understood to replace the hydrogen, while obeying the rules of chemical valency.
[0473] As used herein, the terms heteroatom or ring heteroatom are meant to include oxygen (O), nitrogen (N), sulfur (S), phosphorus (P), and silicon (Si).
[0474] Examples and embodiments are provided below to facilitate a more complete understanding of the invention. The following examples and embodiments illustrate the exemplary modes of making and practicing the invention. However, the scope of the invention is not limited to specific examples and embodiments disclosed, which are for purposes of illustration only, since alternative methods can be utilized to obtain similar results.
EMBODIMENTS
[0475] Embodiments include the following embodiments P1 to P35.
[0476] Embodiment P1. A pH-triggered compound comprising a pH-triggered peptide (pHLIP peptide) that is covalently attached to at least one other pHLIP peptide via a linker or a covalent bond.
[0477] Embodiment P2. The compound of Embodiment P1 having the following structure:
[A].sub.k-linker [0478] wherein [0479] k is an integer from 2 to 32, and [0480] each A is, individually, a pHLIP peptide comprising at least 8 consecutive amino acids, wherein [0481] (i) at least 4 of the at least 8 consecutive amino acids are non-polar amino acids, [0482] (ii) at least 1 of the at least 8 consecutive amino acids is protonatable, and [0483] (iii) the pHLIP peptide has a higher affinity for a membrane lipid bilayer at pH 5.0 compared to the affinity at pH 8.0.
[0484] Embodiment P3. The compound of Embodiment P2, wherein each pHLIP peptide, individually, has the sequence: X.sub.nY.sub.m; Y.sub.mX.sub.n; X.sub.nY.sub.mX.sub.j; Y.sub.mX.sub.nY.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.j; X.sub.nY.sub.mX.sub.jY.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.jY.sub.i; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.jYX.sub.h; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.hY.sub.g; Y.sub.mX.sub.nY.sub.iX.sub.jY.sub.lX.sub.hY.sub.g; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.hY.sub.gX.sub.f; (XY).sub.n; (YX).sub.n; (XY).sub.nY.sub.m; (YX).sub.nY.sub.m; (XY).sub.nX.sub.m; (YX).sub.nX.sub.m; Y.sub.m(XY).sub.n; Y.sub.m(YX).sub.n; X.sub.n(XY).sub.m; X.sub.n(YX).sub.m; (XY).sub.nY.sub.m(XY).sub.i; (YX).sub.nY.sub.m(YX).sub.i; (XY).sub.nX.sub.m(XY).sub.i; (YX).sub.nX.sub.m(YX).sub.i; Y.sub.m(XY).sub.n; Y.sub.m(YX).sub.n; X.sub.n(XY).sub.m; or X.sub.n(YX).sub.m, wherein, [0485] (i) each Y is, individually, a non-polar amino acid with solvation energy, G.sub.X.sup.cor>+0.50, or Gly; [0486] (ii) each X is, individually, a protonatable amino acid, [0487] (iii) n, m, i, j, l, h, g, f are each, individually, an integer from 1 to 8.
[0488] Embodiment P4. The compound of any one of Embodiments P1-P3, comprising at least two pHLIP peptides with different amino acid sequences or wherein each pHLIP peptide comprises the same amino acid sequence.
[0489] Embodiment P5. The compound of any one of Embodiments P1-P4, comprising the following structure:
A-L-B [0490] wherein A is the first pHLIP peptide, B is the second pHLIP peptide, L is the linker, and each - is a covalent bond.
[0491] Embodiment P6. The compound of any one of Embodiments P1-P4, comprising the following structure:
##STR00028##
wherein A is the first pHLIP peptide, B is the second pHLIP peptide, C is the third pHLIP peptide, L is the linker, and each - is a covalent bond.
[0492] Embodiment P7. The compound of any one of Embodiments P1-P4, comprising the following structure:
##STR00029## [0493] wherein A is the first pHLIP peptide, B is the second pHLIP peptide, C is the third pHLIP peptide, D is the fourth pHLIP peptide, L is the linker, and each - is a covalent bond.
[0494] Embodiment P8. The compound of any one of Embodiments P1-P7, comprising k pHLIP peptides, wherein (a) each pHLIP peptide has a unique amino acid sequence compared to each of the other pHLIP peptides in the compound, wherein k2; or (b) each of the k pHLIP peptides has an identical amino acid sequence, wherein each of the k pHLIP peptides is connected to each of the other k pHLIP peptides by a linker, wherein 1<k32.
[0495] Embodiment P9. The compound of any one of Embodiments P1-P8, wherein each pHLIP peptide has a net negative charge at a pH of about 7.25, 7.5, or 7.75 in water.
[0496] Embodiment P10. The compound of any one of Embodiments P1-P9, wherein each pHLIP peptide has an acid dissociation constant on abase 10 logarithmic scale (pKa) of less than about 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, or 7.0.
[0497] Embodiment P11. The compound of any one of Embodiments P1-P10, wherein at least one of the pHLIP peptides comprises: [0498] (a) 1 protonatable amino acid which is aspartic acid, glutamic acid, alpha-aminoadipic acid, or gamma-carboxyglutamic acid; or [0499] (b) at least 2, 3, or 4 protonatable amino acids, wherein the protonatable amino acids comprise aspartic acid, glutamic acid, alpha-aminoadipic acid, gamma-carboxyglutamic acid, or any combination thereof.
[0500] Embodiment P12. The compound of any one of Embodiments P1-P11, wherein [0501] (a) at least one of the pHLIP peptides comprises at least 1 non-native protonatable amino acid; [0502] (b) at least one of the pHLIP peptides comprises at least 1 non-native protonatable amino acid, wherein the non-native protonatable amino acid comprises at least 1, 2, 3, or 4 carboxyl groups; [0503] (c) at least one of the pHLIP peptides comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16 carboxyl groups; [0504] (d) at least one of the pHLIP peptides comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, or 40 coded amino acids; [0505] (e) at least one of the pHLIP peptides comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, or 40 non-coded amino acids; [0506] (f) the amino acids of at least one of the pHLIP peptides are non-native amino acids; [0507] (g) at least one of the pHLIP peptides comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, or 40 D-amino acids; [0508] (h) at least one of the pHLIP peptides comprises at least 1 non-coded amino acid, wherein the non-coded amino acid is an aspartic acid derivative, or a glutamic acid derivative; [0509] (i) at least one of the pHLIP peptides comprises at least 8 consecutive amino acids, wherein, at least 2, 3, or 4 of the at least 8 consecutive amino acids are non-polar, and at least 1, 2, 3, or 4 of the at least 8 consecutive amino acids is protonatable; [0510] (j) at least one of the pHLIP peptides comprises a functional group to which the linker is attached; [0511] (k) the compound comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, or 32 pHLIP peptides that are linked together by the linker; [0512] (l) the compound comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, or 32 pHLIP peptides that are each directly linked to the linker by a covalent bond; or [0513] (m) the pHLIP peptides are attached to the linker by covalent bonds.
[0514] Embodiment P13. The compound of any one of Embodiments P1-P12, comprising at least one pHLIP peptide that is attached to the linker by a covalent bond.
[0515] Embodiment P14. The compound of Embodiment P13, wherein [0516] (a) the covalent bond is a peptide bond; [0517] (b) the covalent bond is a disulfide bond, a bond between two selenium atoms, or a bond between a sulfur and a selenium atom; [0518] (c) the covalent bond is a bond that has been formed by a click chemistry reaction; or [0519] (d) the covalent bond is a bond that has been formed by a reaction between an azide and an alkyne, an alkyne and a strained difluorooctyne, a diaryl-strained-cyclooctyne and a 1,3-nitrone, a cyclooctene, trans-cycloalkene, or oxanorbornadiene and an azide, tetrazine, or tetrazole, an activated alkene or oxanorbornadiene and an azide, a strained cyclooctene or other activated alkene and a tetrazine, or a tetrazole that has been activated by ultraviolet light and an alkene.
[0520] Embodiment P15. The compound of any one of Embodiments P1-P14, wherein [0521] (a) the covalent bond is a peptide bond; [0522] (b) the covalent bond is not a peptide bond; [0523] (c) the linker comprises an artificial polymer or a synthetically produced polymer that has the structure of a polymer that exists in nature; [0524] (d) the linker comprises a polypeptide, a polylysine, a polyarginine, a polyglutamic acid, a polyaspartic acid, a polycysteine, or a polynucleic acid; [0525] (e) the linker does not comprise an amino acid; [0526] (f) the linker comprises a polysaccharide, a chitosan, or an alginate; [0527] (g) the linker comprises a poly(ethylene glycol), a poly(lactic acid), a poly(glycolic acid), a poly(lactic-co-glycolic acid), a poly(malic acid), a polyorthoester, a poly(vinylalcohol), a poly(vinylpyrrolidone), a poly(methyl methacrylate), a poly(acrylic acid), a poly(acrylamide), a poly(methacrylic acid), a poly(amidoamine), a polyanhydrides, or a polycyanoacrylate; [0528] (h) the linker comprises a linear polymer or a branched polymer; [0529] (i) the linker comprises an organic compound structure; [0530] (j) the linker comprises an organic compound structure, wherein the organic compound structure has a molecular weight less than about 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, or 0.5 kilodaltons (kDa); [0531] (k) the linker comprises poly(ethylene glycol); or [0532] (l) the linker comprises poly(ethylene glycol), wherein the poly(ethylene glycol) has a molecular weight of 60 to 100,000 Daltons.
[0533] Embodiment P16. The compound of any one of Embodiments P1-P15, wherein the linker comprises a cell, a particle, a dendrimer, or a nanoparticle.
[0534] Embodiment P17. The compound of any one of Embodiments P1-P6, [0535] (a) comprising at least one pHLIP peptide that comprises a functional group for cargo compound attachment; [0536] (b) wherein the linker comprises a functional group for cargo compound attachment; [0537] (c) comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, or 32 pHLIP peptides that are each individually attached to a cargo compound via a linker; [0538] (d) comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, or 32 pHLIP peptides that are each individually directly attached to a cargo compound by a covalent bond; [0539] (e) wherein at least one of the pHLIP peptides is attached to a cargo compound by a covalent bond, wherein the covalent bond is an ester bond, a disulfide bond, a bond between two selenium atoms, a bond between a sulfur and a selenium atom, or an acid-liable bond; [0540] (f) wherein at least one of the pHLIP peptides is attached to a cargo compound by a covalent bond, wherein the covalent bond is a bond that has been formed by a click chemistry reaction; or [0541] (g) wherein at least one of the pHLIP peptides is attached to a cargo compound by a covalent bond, wherein the covalent bond is a bond that has been formed by a click chemistry reaction.
[0542] Embodiment P18. The compound of Embodiment P17, wherein [0543] (a) the functional group is a side chain of an amino acid of at least one pHLIP peptide; [0544] (b) the functional group is a side chain of an amino acid of at least one pHLIP peptide, wherein the side chain is a side chain to which a cargo compound may be attached via a disulfide bond; [0545] (c) the functional group comprises a free sulfhydryl (SH) or selenohydryl (SeH) group; [0546] (d) the functional group comprises a cysteine, homocysteine, selenocysteine, or homoselenocysteine; [0547] (e) the functional group comprises a primary amine; [0548] (f) the functional group comprises an azido modified amino acid; or [0549] (g) the functional group comprises an alkynyl modified amino acid.
[0550] Embodiment P19. The compound of any one of Embodiments P1-P18, wherein the linker is attached to a cargo compound via a covalent bond.
[0551] Embodiment P20. The compound of Embodiment P19, wherein [0552] (a) the covalent bond is an ester bond, a disulfide bond, a bond between two selenium atoms, a bond between a sulfur and a selenium atom, or an acid-liable bond; [0553] (b) the covalent bond is a bond that has been formed by a click chemistry reaction; [0554] (c) the covalent bond is a bond that has been formed by a reaction between an azide and an alkyne, an alkyne and a strained difluorooctyne, a diaryl-strained-cyclooctyne and a 1,3-nitrone, a cyclooctene, trans-cycloalkene, or oxanorbornadiene and an azide, tetrazine, or tetrazole, an activated alkene or oxanorbornadiene and an azide, a strained cyclooctene or other activated alkene and a tetrazine, or a tetrazole that has been activated by ultraviolet light and an alkene.
[0555] Embodiment P21. The compound of any one of Embodiments P1-P20, further comprising a cargo compound.
[0556] Embodiment P22. The compound of Embodiment P21, wherein [0557] (a) the cargo compound is polar or nonpolar; [0558] (b) the cargo compound comprises a marker; [0559] (c) the cargo compound comprises a prophylactic, therapeutic, diagnostic, radiation-enhancing, radiation-sensitizing, imaging, gene regulation, immune activation, cytotoxic, apoptotic, or research agent; [0560] (d) the cargo compound comprises a dye, a fluorescent dye, a fluorescence quencher, or a fluorescent protein; [0561] (e) the cargo compound comprises a magnetic resonance, positron emission tomography, single photon emission computed tomography, fluorescent, optoacoustic, ultrasound, or X-ray contrast imaging agent; [0562] (f) the cargo compound comprises a peptide, a protein, an enzyme, or a polysaccharide; [0563] (g) the cargo compound comprises an aptamer, an antigen, a protease, an amylase, a lipase, a Fc receptor, a tissue factor, or a complement component 3 (C3) protein; [0564] (h) the cargo compound comprises a toxin, an inhibitor, a DNA intercalator, an alkylating agent, an antimetabolite, an anti-microtubule agents, a topoisomerase inhibitor, or an antibiotic compound; [0565] (i) the cargo compound comprises an amanita toxin, a vinca alkaloid, a taxane, an anthracycline, a bleomycin, a nitrogen mustard, a nitrosourea, a tetrazine, an aziridine, a platinum-containing chemotherapeutic agent, cisplatin or a cisplatin derivative, a procarbazine, or a hexamethylmelamine; [0566] (j) the cargo compound comprises a DNA, a DNA analog, a RNA, a RNA analog; [0567] (k) the cargo compound comprises a peptide nucleic acid (PNA), a bis PNA, a gamma PNA, a locked nucleic acid (LNA), or a morpholino; [0568] (l) the cargo compound comprises a chemotherapeutic compound; [0569] (m) the cargo compound comprises an antimicrobial compound; or [0570] (n) the cargo compound comprises a gene-regulation compound.
[0571] Embodiment P23. The compound of any one of Embodiments P1-P22, wherein at least one of the pHLIP peptides comprises an amino acid side chain that is radioactive or detectable by probing radiation.
[0572] Embodiment P24. The compound of any one of Embodiments P1-P23, wherein one or more atoms of the compound is a radioactive isotope or has been replaced with a stable isotope.
[0573] Embodiment P25. A formulation for a parenteral, a local, or a systemic administration comprising the compound of any one of Embodiments P1-P24.
[0574] Embodiment P26. A compound for the treatment of a superficial or muscle invasive bladder tumor comprising (i) a pHLIP peptide that is attached to at least one other pHLIP peptide via a peptide linker, and (ii) an amanitin toxic cargo.
[0575] Embodiment P27. A formulation for the ex vivo treatment of a biopsy specimen, a liquid biopsy specimen, surgically removed tissue, a surgically removed liquid, or blood, comprising the compound of any one of Embodiments P1-P24.
[0576] Embodiment P28. A pH-triggered peptide (pHLIP peptide) comprising the sequence of at least 8 to 25 consecutive amino acids that is present in any one of the following sequences:
TABLE-US-00024 (SEQIDNO:124) X.sub.2X.sub.2RX.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2, (SEQIDNO:125) X.sub.2X.sub.2RX.sub.2X.sub.3X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2GX.sub.2X.sub.2, (SEQIDNO:126) X.sub.2X.sub.2RX.sub.2X.sub.3X.sub.1X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2, (SEQIDNO:127) X.sub.2X.sub.2RX.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.3X.sub.2X.sub.2, (SEQIDNO:128) X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2RX.sub.2X.sub.2, (SEQIDNO:129) X.sub.2X.sub.2GX.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.1X.sub.3X.sub.2RX.sub.2X.sub.2, (SEQIDNO:130) X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.1X.sub.3X.sub.2RX.sub.2X.sub.2, (SEQIDNO:131) X.sub.2X.sub.2X.sub.3X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2RX.sub.2X.sub.2, (SEQIDNO:132) GX.sub.2X.sub.2GX.sub.2X.sub.2GX.sub.2X.sub.1GX.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.1GX.sub.2X.sub.2X.sub.2GX.sub.2, (SEQIDNO:133) X.sub.2GX.sub.2X.sub.2X.sub.2GX.sub.1X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2GX.sub.1X.sub.2GX.sub.2X.sub.2GX.sub.2X.sub.2G, (SEQIDNO:134) X.sub.2RX.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2, (SEQIDNO:135) X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2RX.sub.2, (SEQIDNO:136) X.sub.2X.sub.2RX.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2XX.sub.2, (SEQIDNO:137) X.sub.2X.sub.2QX.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2, (SEQIDNO:138) X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2RX.sub.2X.sub.2, (SEQIDNO:139) X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2QX.sub.2X.sub.2, (SEQIDNO:140) X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2NGX.sub.2X.sub.2X.sub.2X.sub.2X.sub.1, (SEQIDNO:141) X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2X.sub.2X.sub.1, (SEQIDNO:142) X.sub.2X.sub.2RX.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2, (SEQIDNO:143) X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2GNX.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2, (SEQIDNO:144) X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2, (SEQIDNO:145) X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2RX.sub.2X.sub.2, (SEQIDNO:146) GNX.sub.2X.sub.1GX.sub.2X.sub.2X.sub.2X.sub.3X.sub.2GGX.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1, (SEQIDNO:147) X.sub.1GX.sub.2X.sub.2X.sub.2X.sub.3X.sub.2GGX.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1, (SEQIDNO:147) X.sub.1GX.sub.2X.sub.2X.sub.2X.sub.3X.sub.2GGX.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1, (SEQIDNO:149) X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1GGX.sub.2X.sub.3X.sub.2X.sub.2X.sub.2GX.sub.1X.sub.2NG, (SEQIDNO:150) X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1GGX.sub.2X.sub.3X.sub.2X.sub.2X.sub.2GX.sub.1, (SEQIDNO:151) X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1GGX.sub.2X.sub.3X.sub.2X.sub.2X.sub.2GX.sub.1, (SEQIDNO:152) X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2QX.sub.2, and (SEQIDNO:153) X.sub.2QX.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2, [0577] wherein [0578] each X.sub.1 is, individually, D, E, Gla, or Aad, [0579] each X.sub.2 is, individually, A, I, L, M, F, P, W, Y, V, or G and [0580] each X.sub.3 is, individually, S, T, or G.
[0581] Embodiment P29. A pHLIP peptide comprising at least 8 consecutive amino acids, wherein [0582] (i) at least 4 of the 8 consecutive amino acids are non-polar amino acids, [0583] (ii) at least 1 of the at least 8 consecutive amino acids is protonatable, [0584] (iii) the pHLIP peptide has a higher affinity for a membrane lipid bilayer at pH 5.0 compared to the affinity at pH 8.0, and [0585] (iv) the at least 8 consecutive amino acids comprise 8 consecutive amino acids in a sequence that is identical to a sequence of 8 consecutive amino acids that occurs in a naturally occurring human protein.
[0586] Embodiment P30. A pHLIP peptide having the sequence: [0587] X.sub.nY.sub.m; Y.sub.mX.sub.n; X.sub.nY.sub.mX.sub.j; Y.sub.mX.sub.nY.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.j; X.sub.nY.sub.mX.sub.jY.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.jY.sub.i; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.jY.sub.lX.sub.h; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.hY.sub.g; Y.sub.mX.sub.nY.sub.iX.sub.jY.sub.lX.sub.hY.sub.g; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.hY.sub.gX.sub.f; (XY).sub.n; (YX).sub.n; (XY).sub.nY.sub.m; (YX).sub.nY.sub.m; (XY).sub.nX.sub.m; (YX).sub.nX.sub.m; Y.sub.m(XY).sub.n; Y.sub.m(YX).sub.n; X.sub.n(XY).sub.m; X.sub.n(YX).sub.m; (XY).sub.nY.sub.m(XY).sub.i; (YX).sub.nY.sub.m(YX).sub.i; (XY).sub.nX.sub.m(XY).sub.i; (YX).sub.nX.sub.m(YX).sub.i; Y.sub.m(XY).sub.n; Y.sub.m(YX).sub.n; X.sub.n(XY).sub.m; or X.sub.n(YX).sub.m, wherein, [0588] (i) each Y is, individually, a non-polar amino acid with solvation energy, G.sub.X.sup.cor>+0.50, or Gly; [0589] (ii) each X is, individually, a protonatable amino acid, [0590] (iii) n, m, i, j, l, h, g, f are each, individually, an integer from 1 to 8.
[0591] Embodiment P31. A non-ocular cell comprising an exogenous nucleic acid encoding a pHLIP peptide comprising at least 8 consecutive amino acids with a sequence that is at least 85% identical to (i) a sequence of at least 8 consecutive amino acids that occurs in a naturally occurring human protein; or (ii) the reverse of a sequence of at least 8 consecutive amino acids that occurs in a naturally occurring human protein.
[0592] Embodiment P32. A non-ocular cell comprising a pHLIP peptide comprising at least 8 consecutive amino acids with a sequence that is at least 85% identical to (i) a sequence of at least 8 consecutive amino acids that occurs in a naturally occurring human protein; or (ii) the reverse of a sequence of at least 8 consecutive amino acids that occurs in a naturally occurring human protein expressed on the surface of said cell.
[0593] Embodiment P33. The non-ocular cell of Embodiment P32, wherein the at least 8 consecutive amino acids are located outside of the lipid bilayer of the cell membrane of said cell.
[0594] Embodiment P34. The non-ocular cell of Embodiment P32 or P33, wherein at least 85% of the expressed pHLIP peptide is presented on the exterior of said cell.
[0595] Embodiment P35. The non-ocular cell of any one of Embodiments P32-P34, which is a T-cell, a B-cell, a neutrophil, an eosinophil, a basophil, a lymphocyte, a monocyte, a dendritic cell, a natural killer cell, or a macrophage.
[0596] Further embodiments include the following embodiments 1 to 43.
[0597] Embodiment 1. A pH-triggered compound comprising a pH-triggered peptide (pHLIP peptide) that is covalently attached to at least one other pHLIP peptide via a linker or a covalent bond.
[0598] Embodiment 2. The compound of Embodiment 1, comprising the following structure:
A-L-B
wherein A is a first pHLIP peptide comprising the sequence DDQNPWRAYLDLLFPTDTLLLDLLW (SEQ ID NO: 1), B is a second pHLIP peptide comprising the sequence DDQNPWRAYLDLLFPTDTLLLDLLW (SEQ ID NO: 1), L is a polyethylene glycol linker, and each - is a covalent bond.
[0599] Embodiment 3. The compound of Embodiment 1 or 2, comprising at least one pHLIP peptide comprising one or more of the following sequences: AYLDLLFP (SEQ ID NO: 4), YLDLLFPT (SEQ ID NO: 5), LDLLFPTD (SEQ ID NO: 6), DLLFPTDT (SEQ ID NO: 7), LLFPTDT (SEQ ID NO: 8), LFPTDTLL (SEQ ID NO: 9), FPTDTLLL (SEQ ID NO: 10), PTDTLLLD (SEQ ID NO: 11), TDTLLLDL (SEQ ID NO: 12), DTLLLDLL (SEQ ID NO: 13), or TLLLDLLW (SEQ ID NO: 14).
[0600] Embodiment 4. The compound of any one of Embodiments 1-3, comprising at least one pHLIP peptide comprising the sequence DDQNPWRAYLDLLFPTDTLLLDLLW (SEQ ID NO: 1), ACDDQNPWRAYLDLLFPTDTLLLDLLWA (SEQ ID NO: 15), AKDDQNPWRAYLDLLFPTDTLLLDLLWA (SEQ ID NO: 16), ADDQNPWRAYLDLLFPTDTLLLDLLWCA (SEQ ID NO: 17), ADDQNPWRAYLDLLFPTDTLLLDLLWKA (SEQ ID NO: 18), ACDDQNPWRAYLDLLFPTDTLLLDLLWKA (SEQ ID NO: 19), or AKDDQNPWRAYLDLLFPTDTLLLDLLWCA (SEQ ID NO: 20).
[0601] Embodiment 5. The compound of Embodiment 4, comprising at least one pHLIP peptide comprising the sequence DDQNPWRAYLDLLFPTDTLLLDLLW (SEQ ID NO: 1).
[0602] Embodiment 6. The compound of Embodiment 1, comprising the following structure:
A-L-B
wherein A is a first pHLIP peptide comprising the sequence AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT (SEQ ID NO: 2), B is a second pHLIP peptide comprising the sequence AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT (SEQ ID NO: 2), L is a polyethylene glycol linker, and each - is a covalent bond.
[0603] Embodiment 7. The compound of Embodiment 1, comprising the following structure:
A-L-B
wherein A is a first pHLIP peptide comprising the sequence GLAGLAGLLGLEGLLGLPLGLLEGLWLGLELEGN (SEQ ID NO: 3), B is a second pHLIP peptide comprising the sequence GLAGLAGLLGLEGLLGLPLGLLEGLWLGLELEGN (SEQ ID NO: 3), L is a polyethylene glycol linker, and each - is a covalent bond.
[0604] Embodiment 8. The compound of any one of Embodiment 2 1-7 having the following structure:
[A].sub.k-linker [0605] wherein [0606] k is an integer from 2 to 32, and [0607] each A is, individually, a pHLIP peptide comprising at least 8 consecutive amino acids, wherein [0608] (i) at least 4 of the at least 8 consecutive amino acids are non-polar amino acids, [0609] (ii) at least 1 of the at least 8 consecutive amino acids is protonatable, and [0610] (iii) the pHLIP peptide has a higher affinity for a membrane lipid bilayer at pH 5.0 compared to the affinity at pH 8.0.
[0611] Embodiment 9. The compound of any one of Embodiments 1-8, wherein each pHLIP peptide, individually, has the sequence: [0612] X.sub.nY.sub.m; Y.sub.mX.sub.n; X.sub.nY.sub.mX.sub.j; Y.sub.mX.sub.nY.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.j; X.sub.nY.sub.mX.sub.jY.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.jY.sub.i; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.jY.sub.lX.sub.h; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.hY.sub.g; Y.sub.mX.sub.nY.sub.iX.sub.jY.sub.lX.sub.hY.sub.g; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.hY.sub.gX.sub.f; (XY).sub.n; (YX).sub.n; (XY).sub.nY.sub.m; (YX).sub.nY.sub.m; (XY).sub.nX.sub.m; (YX).sub.nX.sub.m; Y.sub.m(XY).sub.n; Y.sub.m(YX).sub.n; X.sub.n(XY).sub.m; X.sub.n(YX).sub.m; (XY).sub.nY.sub.m(XY).sub.i; (YX).sub.nY.sub.m(YX).sub.i; (XY).sub.nX.sub.m(XY).sub.i; (YX).sub.nX.sub.m(YX).sub.i; Y.sub.m(XY).sub.n; Y.sub.m(YX).sub.n; X.sub.n(XY).sub.m; or X.sub.n(YX).sub.m, wherein, [0613] (i) each Y is, individually, a non-polar amino acid with solvation energy, G>+0.50, or Gly; [0614] (ii) each X is, individually, a protonatable amino acid, [0615] (iii) n, m, i, j, 1, h, g, f are each, individually, an integer from 1 to 8.
[0616] Embodiment 10. The compound of any one of Embodiments 1-9, comprising at least two pHLIP peptides with different amino acid sequences or wherein each pHLIP peptide comprises the same amino acid sequence.
[0617] Embodiment 11. The compound of any one of Embodiments 1-9, comprising the following structure:
A-L-B
wherein A is the first pHLIP peptide, B is the second pHLIP peptide, L is the linker, and each - is a covalent bond.
[0618] Embodiment 12. The compound of any one of Embodiments 1-9, comprising the following structure:
##STR00030##
wherein A is the first pHLIP peptide, B is the second pHLIP peptide, C is the third pHLIP peptide, L is the linker, and each - is a covalent bond.
[0619] Embodiment 13. The compound of any one of Embodiments 1-9, comprising the following structure:
##STR00031## [0620] wherein A is the first pHLIP peptide, B is the second pHLIP peptide, C is the third pHLIP peptide, D is the fourth pHLIP peptide, L is the linker, and each - is a covalent bond.
[0621] Embodiment 14. The compound of any one of Embodiments 1-13, comprising k pHLIP peptides, wherein (a) each pHLIP peptide has a unique amino acid sequence compared to each of the other pHLIP peptides in the compound, wherein k2; or (b) each of the k pHLIP peptides has an identical amino acid sequence, wherein each of the k pHLIP peptides is connected to each of the other k pHLIP peptides by a linker, wherein 1<k32.
[0622] Embodiment 15. The compound of any one of Embodiments 1-14, wherein each pHLIP peptide has a net negative charge at a pH of about 7.25, 7.5, or 7.75 in water.
[0623] Embodiment 16. The compound of any one of Embodiments 1-15, wherein each pHLIP peptide has an acid dissociation constant on abase 10 logarithmic scale (pKa) of less than about 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, or 7.0.
[0624] Embodiment 17. The compound of any one of Embodiments 1-16, wherein at least one of the pHLIP peptides comprises: [0625] (a) 1 protonatable amino acid which is aspartic acid, glutamic acid, alpha-aminoadipic acid, or gamma-carboxyglutamic acid; or [0626] (b) at least 2, 3, or 4 protonatable amino acids, wherein the protonatable amino acids comprise aspartic acid, glutamic acid, alpha-aminoadipic acid, gamma-carboxyglutamic acid, or any combination thereof.
[0627] Embodiment 18. The compound of any one of Embodiments 1-17, wherein [0628] (a) at least one of the pHLIP peptides comprises at least 1 non-native protonatable amino acid; [0629] (b) at least one of the pHLIP peptides comprises at least 1 non-native protonatable amino acid, wherein the non-native protonatable amino acid comprises at least 1, 2, 3, or 4 carboxyl groups; [0630] (c) at least one of the pHLIP peptides comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16 carboxyl groups; [0631] (d) at least one of the pHLIP peptides comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, or 40 coded amino acids; [0632] (e) at least one of the pHLIP peptides comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, or 40 non-coded amino acids; [0633] (f) the amino acids of at least one of the pHLIP peptides are non-native amino acids; [0634] (g) at least one of the pHLIP peptides comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, or 40 D-amino acids; [0635] (h) at least one of the pHLIP peptides comprises at least 1 non-coded amino acid, wherein the non-coded amino acid is an aspartic acid derivative, or a glutamic acid derivative; [0636] (i) at least one of the pHLIP peptides comprises at least 8 consecutive amino acids, wherein, at least 2, 3, or 4 of the at least 8 consecutive amino acids are non-polar, and at least 1, 2, 3, or 4 of the at least 8 consecutive amino acids is protonatable; [0637] (j) at least one of the pHLIP peptides comprises a functional group to which the linker is attached; [0638] (k) the compound comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, or 32 pHLIP peptides that are linked together by the linker; [0639] (l) the compound comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, or 32 pHLIP peptides that are each directly linked to the linker by a covalent bond; or [0640] (m) the pHLIP peptides are attached to the linker by covalent bonds.
[0641] Embodiment 19. The compound of any one of Embodiments 1-18, comprising at least one pHLIP peptide that is attached to the linker by a covalent bond.
[0642] Embodiment 20. The compound of Embodiment 19, wherein [0643] (a) the covalent bond is a peptide bond; [0644] (b) the covalent bond is a disulfide bond, a bond between two selenium atoms, or a bond between a sulfur and a selenium atom; [0645] (c) the covalent bond is a bond that has been formed by a click chemistry reaction; or [0646] (d) the covalent bond is a bond that has been formed by a reaction between an azide and an alkyne, an alkyne and a strained difluorooctyne, a diaryl-strained-cyclooctyne and a 1,3-nitrone, a cyclooctene, trans-cycloalkene, or oxanorbornadiene and an azide, tetrazine, or tetrazole, an activated alkene or oxanorbornadiene and an azide, a strained cyclooctene or other activated alkene and a tetrazine, or a tetrazole that has been activated by ultraviolet light and an alkene.
[0647] Embodiment 21. The compound any one of Embodiments 1-20, wherein [0648] (a) the covalent bond is a peptide bond; [0649] (b) the covalent bond is not a peptide bond; [0650] (c) the linker comprises an artificial polymer or a synthetically produced polymer that has the structure of a polymer that exists in nature; [0651] (d) the linker comprises a polypeptide, a polylysine, a polyarginine, a polyglutamic acid, a polyaspartic acid, a polycysteine, or a polynucleic acid; [0652] (e) the linker does not comprise an amino acid; [0653] (f) the linker comprises a polysaccharide, a chitosan, or an alginate; [0654] (g) the linker comprises a poly(ethylene glycol), a poly(lactic acid), a poly(glycolic acid), a poly(lactic-co-glycolic acid), a poly(malic acid), a polyorthoester, a poly(vinylalcohol), a poly(vinylpyrrolidone), a poly(methyl methacrylate), a poly(acrylic acid), a poly(acrylamide), a poly(methacrylic acid), a poly(amidoamine), a polyanhydrides, or a polycyanoacrylate; [0655] (h) the linker comprises a linear polymer or a branched polymer; [0656] (i) the linker comprises an organic compound structure; [0657] (j) the linker comprises an organic compound structure, wherein the organic compound structure has a molecular weight less than about 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, or 0.5 kilodaltons (kDa); [0658] (k) the linker comprises poly(ethylene glycol); or [0659] (l) the linker comprises poly(ethylene glycol), wherein the poly(ethylene glycol) has a molecular weight of 60 to 100,000 Daltons.
[0660] Embodiment 22. The compound of any one of Embodiments 1-21, wherein the linker comprises a cell, a particle, a dendrimer, or a nanoparticle.
[0661] Embodiment 23. The compound of any one of Embodiments 1-22, [0662] (a) comprising at least one pHLIP peptide that comprises a functional group for cargo compound attachment; [0663] (b) wherein the linker comprises a functional group for cargo compound attachment; [0664] (c) comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, or 32 pHLIP peptides that are each individually attached to a cargo compound via a linker; [0665] (d) comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, or 32 pHLIP peptides that are each individually directly attached to a cargo compound by a covalent bond; [0666] (e) wherein at least one of the pHLIP peptides is attached to a cargo compound by a covalent bond, wherein the covalent bond is an ester bond, a disulfide bond, a bond between two selenium atoms, a bond between a sulfur and a selenium atom, or an acid-liable bond; [0667] (f) wherein at least one of the pHLIP peptides is attached to a cargo compound by a covalent bond, wherein the covalent bond is a bond that has been formed by a click chemistry reaction; or [0668] (g) wherein at least one of the pHLIP peptides is attached to a cargo compound by a covalent bond, wherein the covalent bond is a bond that has been formed by a click chemistry reaction.
[0669] Embodiment 24. The compound of Embodiment 23, wherein [0670] (a) the functional group is a side chain of an amino acid of at least one pHLIP peptide; [0671] (b) the functional group is a side chain of an amino acid of at least one pHLIP peptide, wherein the side chain is a side chain to which a cargo compound may be attached via a disulfide bond; [0672] (c) the functional group comprises a free sulfhydryl (SH) or selenohydryl (SeH) group; [0673] (d) the functional group comprises a cysteine, homocysteine, selenocysteine, or homoselenocysteine; [0674] (e) the functional group comprises a primary amine; [0675] (f) the functional group comprises an azido modified amino acid; or [0676] (g) the functional group comprises an alkynyl modified amino acid.
[0677] Embodiment 25. The compound of any one of Embodiments 1-24, wherein the linker is attached to a cargo compound via a covalent bond.
[0678] Embodiment 26. The compound of Embodiment 25, wherein [0679] (a) the covalent bond is an ester bond, a disulfide bond, a bond between two selenium atoms, a bond between a sulfur and a selenium atom, or an acid-liable bond; [0680] (b) the covalent bond is a bond that has been formed by a click chemistry reaction; [0681] (c) the covalent bond is a bond that has been formed by a reaction between an azide and an alkyne, an alkyne and a strained difluorooctyne, a diaryl-strained-cyclooctyne and a 1,3-nitrone, a cyclooctene, trans-cycloalkene, or oxanorbornadiene and an azide, tetrazine, or tetrazole, an activated alkene or oxanorbornadiene and an azide, a strained cyclooctene or other activated alkene and a tetrazine, or a tetrazole that has been activated by ultraviolet light and an alkene.
[0682] Embodiment 27. The compound of any one of Embodiments 1-26, further comprising a cargo compound.
[0683] Embodiment 28. The compound of Embodiment 27, wherein [0684] (a) the cargo compound is polar or nonpolar; [0685] (b) the cargo compound comprises a marker; [0686] (c) the cargo compound comprises a prophylactic, therapeutic, diagnostic, radiation-enhancing, radiation-sensitizing, imaging, gene regulation, immune activation, cytotoxic, apoptotic, or research agent; [0687] (d) the cargo compound comprises a dye, a fluorescent dye, a fluorescence quencher, or a fluorescent protein; [0688] (e) the cargo compound comprises a magnetic resonance, positron emission tomography, single photon emission computed tomography, fluorescent, optoacoustic, ultrasound, or X-ray contrast imaging agent; [0689] (f) the cargo compound comprises a peptide, a protein, an enzyme, or a polysaccharide; [0690] (g) the cargo compound comprises an aptamer, an antigen, a protease, an amylase, a lipase, a Fc receptor, a tissue factor, or a complement component 3 (C.sub.3) protein; [0691] (h) the cargo compound comprises a toxin, an inhibitor, a DNA intercalator, an alkylating agent, an antimetabolite, an anti-microtubule agents, a topoisomerase inhibitor, or an antibiotic compound; [0692] (i) the cargo compound comprises an amanita toxin, a vinca alkaloid, a taxane, an anthracycline, a bleomycin, a nitrogen mustard, a nitrosourea, a tetrazine, an aziridine, a platinum-containing chemotherapeutic agent, cisplatin or a cisplatin derivative, a procarbazine, or a hexamethylmelamine; [0693] (j) the cargo compound comprises a DNA, a DNA analog, a RNA, a RNA analog; [0694] (k) the cargo compound comprises a peptide nucleic acid (PNA), a bis PNA, a gamma PNA, a locked nucleic acid (LNA), or a morpholino; [0695] (l) the cargo compound comprises a chemotherapeutic compound; [0696] (m) the cargo compound comprises an antimicrobial compound; or [0697] (n) the cargo compound comprises a gene-regulation compound.
[0698] Embodiment 29. The compound of any one of Embodiments 1-28, wherein at least one of the pHLIP peptides comprises an amino acid side chain that is radioactive or detectable by probing radiation.
[0699] Embodiment 30. The compound of any one of Embodiments 1-29, wherein one or more atoms of the compound is a radioactive isotope or has been replaced with a stable isotope.
[0700] Embodiment 31. A formulation for a parenteral, a local, or a systemic administration comprising the compound of any one of Embodiments 1-30.
[0701] Embodiment 32. A compound for the treatment of a superficial or muscle invasive bladder tumor comprising (i) a pHLIP peptide that is attached to at least one other pHLIP peptide via a peptide linker, and (ii) an amanitin toxic cargo.
[0702] Embodiment 33. A formulation for the ex vivo treatment of a biopsy specimen, a liquid biopsy specimen, surgically removed tissue, a surgically removed liquid, or blood, comprising the compound of any one of Embodiments 1-30.
[0703] Embodiment 34. A pH-triggered peptide (pHLIP peptide) comprising the sequence of at least 8 to 25 consecutive amino acids that is present in any one of the following sequences:
TABLE-US-00025 (SEQIDNO:124) X.sub.2X.sub.2RX.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2, (SEQIDNO:125) X.sub.2X.sub.2RX.sub.2X.sub.3X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2GX.sub.2X.sub.2, (SEQIDNO:126) X.sub.2X.sub.2RX.sub.2X.sub.3X.sub.1X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2, (SEQIDNO:127) X.sub.2X.sub.2RX.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.3X.sub.2X.sub.2, (SEQIDNO:128) X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2RX.sub.2X.sub.2, (SEQIDNO:129) X.sub.2X.sub.2GX.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.1X.sub.3X.sub.2RX.sub.2X.sub.2, (SEQIDNO:130) X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.1X.sub.3X.sub.2RX.sub.2X.sub.2, (SEQIDNO:131) X.sub.2X.sub.2X.sub.3X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2RX.sub.2X.sub.2, (SEQIDNO:132) GX.sub.2X.sub.2GX.sub.2X.sub.2GX.sub.2X.sub.1GX.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.1GX.sub.2X.sub.2X.sub.2GX.sub.2, (SEQIDNO:133) X.sub.2GX.sub.2X.sub.2X.sub.2GX.sub.1X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2GX.sub.1X.sub.2GX.sub.2X.sub.2GX.sub.2X.sub.2G, (SEQIDNO:134) X.sub.2RX.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2, (SEQIDNO:135) X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2RX.sub.2, (SEQIDNO:136) X.sub.2X.sub.2RX.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2XX.sub.2, (SEQIDNO:137) X.sub.2X.sub.2QX.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2, (SEQIDNO:138) X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2RX.sub.2X.sub.2, (SEQIDNO:139) X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2QX.sub.2X.sub.2, (SEQIDNO:140) X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2NGX.sub.2X.sub.2X.sub.2X.sub.2X.sub.1, (SEQIDNO:141) X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2X.sub.2X.sub.1, (SEQIDNO:142) X.sub.2X.sub.2RX.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2, (SEQIDNO:143) X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2GNX.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2, (SEQIDNO:144) X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2, (SEQIDNO:145) X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2RX.sub.2X.sub.2, (SEQIDNO:146) GNX.sub.2X.sub.1GX.sub.2X.sub.2X.sub.2X.sub.3X.sub.2GGX.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1, (SEQIDNO:147) X.sub.1GX.sub.2X.sub.2X.sub.2X.sub.3X.sub.2GGX.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1, (SEQIDNO:147) X.sub.1GX.sub.2X.sub.2X.sub.2X.sub.3X.sub.2GGX.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1, (SEQIDNO:149) X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1GGX.sub.2X.sub.3X.sub.2X.sub.2X.sub.2GX.sub.1X.sub.2NG, (SEQIDNO:150) X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1GGX.sub.2X.sub.3X.sub.2X.sub.2X.sub.2GX.sub.1, (SEQIDNO:151) X.sub.1X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.1GGX.sub.2X.sub.3X.sub.2X.sub.2X.sub.2GX.sub.1, (SEQIDNO:152) X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2X.sub.2X.sub.2X.sub.3X.sub.3X.sub.2X.sub.1X.sub.2X.sub.2X.sub.2QX.sub.2, and (SEQIDNO:153) X.sub.2QX.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.3X.sub.3X.sub.2X.sub.2X.sub.2X.sub.2X.sub.2GX.sub.2X.sub.2X.sub.2X.sub.1X.sub.2X.sub.2, [0704] wherein [0705] each X.sub.1 is, individually, D, E, Gla, or Aad, [0706] each X.sub.2 is, individually, A, I, L, M, F, P, W, Y, V, or G and [0707] each X.sub.3 is, individually, S, T, or G.
[0708] Embodiment 35. A pHLIP peptide comprising at least 8 consecutive amino acids, wherein [0709] (i) at least 4 of the 8 consecutive amino acids are non-polar amino acids, [0710] (ii) at least 1 of the at least 8 consecutive amino acids is protonatable, [0711] (iii) the pHLIP peptide has a higher affinity for a membrane lipid bilayer at pH 5.0 compared to the affinity at pH 8.0, and [0712] (iv) the at least 8 consecutive amino acids comprise 8 consecutive amino acids in a sequence that is identical to a sequence of 8 consecutive amino acids that occurs in a naturally occurring human protein.
[0713] Embodiment 36. The pHLIP peptide of Embodiment 35, comprising the following sequence: LGGEIALW (SEQ ID NO: 322).
[0714] Embodiment 37. The pHLIP peptide of Embodiment 36, comprising the following sequence: NLEGFFATLGGEIALWSLVVLAIE (SEQ ID NO: 82).
[0715] Embodiment 38. A pHLIP peptide having the sequence: [0716] X.sub.nY.sub.m; Y.sub.mX.sub.n; X.sub.nY.sub.mX.sub.j; Y.sub.mX.sub.nY.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.j; X.sub.nY.sub.mX.sub.jY.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.jY.sub.i; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.i; Y.sub.mX.sub.nY.sub.iX.sub.jY.sub.lX.sub.h; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.hY.sub.g; Y.sub.mX.sub.nY.sub.iX.sub.jY.sub.lX.sub.hY.sub.g; X.sub.nY.sub.mX.sub.jY.sub.iX.sub.hY.sub.gX.sub.f; (XY).sub.n; (YX).sub.n; (XY).sub.nY.sub.m; (YX).sub.nY.sub.m; (XY).sub.nX.sub.m; (YX).sub.nX.sub.m; Y.sub.m(XY).sub.n; Y.sub.m(YX).sub.n; X.sub.n(XY).sub.m; X.sub.n(YX).sub.m; (XY).sub.nY.sub.m(XY).sub.i; (YX).sub.nY.sub.m(YX).sub.i; (XY).sub.nX.sub.m(XY).sub.i; (YX).sub.nX.sub.m(YX).sub.i; Y.sub.m(XY).sub.n; Y.sub.m(YX).sub.n; X.sub.n(XY).sub.m; or X.sub.n(YX).sub.m, wherein, [0717] (i) each Y is, individually, a non-polar amino acid with solvation energy, G.sub.X.sup.cor>+0.50, or Gly; [0718] (ii) each X is, individually, a protonatable amino acid, [0719] (iii) n, m, i, j, 1, h, g, f are each, individually, an integer from 1 to 8.
[0720] Embodiment 39. A non-ocular cell comprising an exogenous nucleic acid encoding a pHLIP peptide comprising at least 8 consecutive amino acids with a sequence that is at least 85% identical to (i) a sequence of at least 8 consecutive amino acids that occurs in a naturally occurring human protein; or (ii) the reverse of a sequence of at least 8 consecutive amino acids that occurs in a naturally occurring human protein.
[0721] Embodiment 40. A non-ocular cell comprising a pHLIP peptide comprising at least 8 consecutive amino acids with a sequence that is at least 85% identical to (i) a sequence of at least 8 consecutive amino acids that occurs in a naturally occurring human protein; or (ii) the reverse of a sequence of at least 8 consecutive amino acids that occurs in a naturally occurring human protein expressed on the surface of said cell.
[0722] Embodiment 41. The non-ocular cell of Embodiment 40, wherein the at least 8 consecutive amino acids are located outside of the lipid bilayer of the cell membrane of said cell.
[0723] Embodiment 42. The non-ocular cell of Embodiment 40 or 41, wherein at least 85% of the expressed pHLIP peptide is presented on the exterior of said cell.
[0724] Embodiment 43. The non-ocular cell of any one of Embodiments 40-42, which is a T-cell, a B-cell, a neutrophil, an eosinophil, a basophil, a lymphocyte, a monocyte, a dendritic cell, a natural killer cell, or a macrophage.
EXAMPLES
Example 1: pHLIP Compounds for Targeted Intracellular Delivery of Cargo Molecules to Tumors
[0725] pH (Low) Insertion Peptides (pHLIPs) target acidity at the surfaces of cancer cells and show utility in a wide range of applications, including optical and nuclear imaging, and the intracellular delivery of cell-impermeable and cell-permeable therapeutic agents. Here pHLIP constructs are introduced that improve the targeted delivery of agents into tumor cells. The constructs presented herein include pHLIP bundles, e.g., conjugates consisting of two or four pHLIP peptides linked together by polyethelyne glycol (PEG), and Var3 pHLIP variants containing either the non-standard amino acids -carboxyglutamic acid (Gla) or a GLL motif. The in vitro and in vivo performance of the constructs was compared with previous pHLIP variants. A wide range of experiments was performed on nine constructs including: i) biophysical measurements of steady-state and kinetic fluorescence, circular dichroism, and oriented circular dichroism, in order to study the pH-dependent insertion of pHLIP variants across the membrane lipid bilayer; ii) cell viability assays to gauge the pH-dependent potency of peptide-toxin constructs by assessing the intracellular delivery of the polar, cell-impermeable cargo molecule, amanitin, at physiological and low pH (pH 7.4 and 6.0, respectively); and iii) tumor targeting and biodistribution measurements using fluorophore-peptide conjugates in a breast cancer mouse model. The main principles of the design of pHLIP variants for various medical applications are discussed.
[0726] Targeting tumors based on the acidic environment at the surfaces of cancer cells presents several advantages to traditional biomarker targeting methods. Past studies have demonstrated the utility of the class of pH (Low) Insertion Peptides (pHLIPs) for targeting the acidity present in tumor tissue in applications such as fluorescence and nuclear imaging, and drug and gene therapy. Here, several pHLIPs are described, including pHLIP bundles, and these constructs are thoroughly evaluated alongside an improved generation of pHLIPs. Challenges relating to the design and accurate evaluation of pHLIPs are also discussed. The research elucidates the strengths and weaknesses of existing pHLIPs, proposes future peptide modifications that could further improve tumor targeting, and discusses the applicability of this improved generation of pHLIPs for drug delivery.
[0727] The targeted delivery of drugs to cancer cells maximizes their therapeutic effect while reducing side effects. Although many biomarkers exist that can be exploited to improve tumor targeting and treatment outcomes, such as various receptors overexpressed at the surfaces of cancer cells, the heterogeneity of the cancer cell population in an individual tumor and between tumors of various patients limits the effective use of biomarker targeting technologies. Additionally, rapid mutation increases the likelihood of the selection of cancer cell phenotypes that do not express high levels of the targeted biomarker. In both situations, biomarker targeting acts as a selection method that can lead to the development of drug resistance and poor patient outcomes (Marusyk A & Polyak K (2010) Biochim Biophys Acta 1805(1):105; Gillies et al. (2012) Nat Rev Cancer 12(7):487-493; Lloyd et al. (2016) Cancer Res 76(11):3136-3144). It is well known that acidosis is a characteristic ubiquitous to tumors, including both primary tumors and metastases (Estrella et al. (2013) Cancer Res 73(5):1524-1535). This acidic microenvironment is generated by the increased use of the glycolytic mechanism of energy production by cancer cells, and by the abundance of carbonic anhydrase proteins on the cancer cell surfaces. The extracellular pH is the lowest at the surface of cancer cells, and is significantly lower than normal physiological pH and the bulk extracellular pH in tumors (Zhang X, Lin Y, & Gillies R J (2010) J Nucl Med 51(8):1167-1170; Hashim et al. (2011) NMR in biomedicine 24(6):582-591; Anderson et al. (2016) Proc Natl Acad Sci USA 113(29):8177-8181). The low pH layer remains at the cancer cell surface even in well-perfused tumor areas. This layer of acidity on the surface of cancer cells is a targetable characteristic of tumor tissue, which is not subject of clonal selection, and the level of acidity is a predictor of tumor invasion and aggression. Rapidly growing tumor cells are more acidic.
[0728] The family of pH (low) insertion peptides (pHLIPs) comprises a variety of acidity-targeting peptides, each possessing different tumor-targeting characteristics. pHLIPs can be used in a wide variety of applications, so it is desirable to have a range of options for specific applications. The applications include i) fluorescence imaging (Reshetnyak et al. (2011) Mol Imaging Biol 13(6):1146-1156; Adochite et al. (2014) Mol Pharm 11(8):2896-2905; Tapmeier et al. (2015) Proc Natl Acad Sci USA 112(31):9710-9715) and fluorescence image-guided surgery (Golijanin et al. (2016) Proc Natl Acad Sci USA 113(42):11829-11834); ii) nuclear imaging including PET and SPECT (Macholl et al. (2012) Mol Imaging Biol 14(6):725-734; Demoin et al. (2016) Bioconjugate Chem 27(9):2014-2023); iii) therapeutic applications, such as the targeted delivery of polar toxins that cannot cross cell membranes (An et al. (2010) Proc Natl Acad Sci USA 107(47):20246-20250; Wijesinghe et al. (2011) Biochemistry-US 50(47):10215-10222), drug-like molecules that diffuse across cell membranes (Burns et al. (2015) Mol Pharm 12(4):1250-1258; Burns et al. (2017) Mol Pharm 14(2):415-422), and gene therapy (Cheng et al. (2015) Nature 518(7537):107-110); and iv) nanotechnology for enhancing the delivery of gold nanoparticles (Yao et al. (2013) Proc Natl Acad Sci USA 110(2):465-470; Daniels et al. (2017) Biochem Biophys Rep 10:62-69) or liposome-encapsulated payloads to cancer cells (Yao et al. (2013) J Control Release 167(3):228-237; Wijesinghe et al. (2013) Sci Rep 3:3560).
[0729] pHLIPs are triggered to insert across the membranes of cancer cells by the acidity at the cancer cell surface. The behavior of peptides in the pHLIP family is typically described in terms of three states: at physiological pH, peptides exist in equilibrium between a solvated state (State I) and a membrane-adsorbed state (State II); a decrease in pH shifts the equilibrium toward a membrane-inserted state (State III) (Reshetnyak et al. (2007) Biophys J 93(7):2363-2372). The mechanism of action of peptides in the pHLIP family is well understood: protonatable residues, which are interspersed throughout the hydrophobic middle region and the C-terminal, membrane-inserting region of the peptides, are negatively charged at physiological pH (e.g., pH 7.4) but become protonated and neutrally charged with a decrease in pH. The loss of charge and increase in overall hydrophobicity drives pHLIPs to partition into the hydrophobic core of the membrane bilayer, and triggers the formation of a transmembrane (TM) helix. This helix spans the lipid bilayer, leaving the N-terminus in the extracellular space and placing the C-terminus in the intracellular space, where, due to the more alkaline pH in the cytosol, the C-terminus can again become deprotonated and charged, stably anchoring the peptide in the cell membrane.
[0730] Following the extensive characterization of wild-type (WT) pHLIP, the first-generation of pHLIP variants was created to examine the effects on targeting due to fairly straightforward changes to the WT primary structure such as sequence truncation, the addition and replacement of some protonatable residues with others, and sequence reversal (Reshetnyak et al. (2008) Proc Natl Acad Sci USA 105(40):15340-15345; Karabadzhak et al. (2012) Biophys J 102(8):1846-1855; Weerakkody et al. (2013) Proc Natl Acad Sci USA 110(15):5834-5839). Of these first-generation variants, Variant 3 (Var3) appeared to have the most desirable insertion characteristics, and much research has been focused around the use of Var3 for various applications (Tapmeier et al. (2015) Proc Natl Acad Sci USA 112(31):9710-9715; Golijanin et al. (2016) Proc Natl Acad Sci USA 113(42):11829-11834; Cruz-Monserrate et al. (2014) Sci Rep 4:4410; Adochite et al. (2016) Mol Imaging Biol 113(42):11829-11834). Lately, additional variants have emerged that incorporate more exotic changes to the peptide primary structure; these changes include the use of the non-standard amino acids -carboxyglutamic acid (Gla), a residue with two protonatable carboxyl groups, and -aminoadipic acid (Aad), a more hydrophobic version of the glutamic acid residue (Onyango et al. (2015) Angew Chem Int Edit 54(12):3658-3663), as well as the creation of a pHLIP peptide de novo, ATRAM (Nguyen et al. (2015) Biochemistry-US 54(43):6567-6575). Here, several additional members of the pHLIP family of peptides and pHLIP bundles are introduced, their biophysical properties are compared to some previously introduced variants, and the utility of nine pHLIPs in drug-delivery and tumor imaging is evaluated. Variants disclosed herein significantly expand the useful range of use in targeted cancer therapy.
[0731] pHLIP Constructs
[0732] Several pHLIP variants were investigated; data described herein shows results from nine variants, among them are Var3/Gla (with nonstandard amino acid Gla), Var3/GLL (with glycine-leucine-leucine motif), and pHLIP bundles. The pHLIP bundles include two- or four-armed polyethylene glycol (PEG) 2 kDa spacers conjugated with the Cys residue at the N-terminus of WT: PEG-2WT (
List of Main Groups of pHLIP Variants
List of Main Groups of pHLIP Variants Described in
TABLE-US-00026 WT: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT(SEQIDNO:2) PEG-2WT: Two-armPEGconjugatedto2WT PEG-4WT: Four-armPEGconjugatedto4WT WT/Gla: AEQNPIYWARYAGlaWLFTTPLLLLDLALLVDADEGT(SEQIDNO:44) WT/Gla/Aad: AEQNPIYWARYAGlaWLFTTPLLLLAadLALLVDADEGT(SEQIDNO:45) Var3: ADDQNPWRAYLDLLFPTDTLLLDLLW(SEQIDNO:46) Var3/Gla: ADDQNPWRAYLGlaLLFPTDTLLLDLLW(SEQIDNO:47) Var3/GLL: GEEQNPWLGAYLDLLFPLELLGLLELGLWG(SEQIDNO:48) ATRAM: GLAGLAGLLGLEGLLGLPLGLLEGLWLGLELEGN(SEQIDNO:3)
[0733] Enhancement of affinity improves targeting, and higher cooperativity narrows the window of pH that produces TM drug delivery. The information about all pHLIP variants used in the study with additional variations from the addition of single N- or C-terminal cysteine or lysine residues for conjugation purposes is provided in Tables 9 and 10. Nine pHLIP variants are grouped together in various ways by shared characteristics. A WT-like group contains peptides with two protonatable residues (shown in bold in the list above) in the putative TM region, multiple protonatable residues in the membrane-inserting C-terminal region, and two tryptophan residues (residue W) both located at the beginning of the helix-forming TM region; this group includes WT, PEG-2WT and PEG-4WT, WT/Gla, and WT/Gla/Aad. A Var3-like group is based on Var3 from the first pHLIP series (Weerakkody et al. (2013) Proc Natl Acad Sci USA 110(15):5834-5839). This group includes Var3, Var3/Gla, and Var3/GLL, each of which have three protonatable residues in the TM region and tryptophan residues located at the beginning and end of the TM region. Considering this scheme, ATRAM, with its multiple glycine and leucine residues and single tryptophan located about two-thirds to the end of its TM part, is in a group of its own. Other subgroups could be considered as well: a subgroup of peptides that incorporate the non-standard Gla residue, shown in italics in the list above (i.e., WT/Gla, WT/Gla/Aad, and Var3/Gla), and another subgroup that includes peptides containing the GLL motif (Var3/GLL and ATRAM). When performing analysis of biophysical measurements, analyzing variants with respect to their group-mates becomes important: the very different characteristics of peptides from various groups make it difficult to accurately compare the behavior of all peptides at the same time.
[0734] Biophysical Steady-State and Kinetics Studies
[0735] A variety of spectroscopic techniques to probe pHLIP variants interactions with phospholipid bilayer of POPC liposomes including steady-state fluorescence spectroscopy, circular dichroism (CD), oriented circular dichroism (OCD), and stopped-flow fluorescence measurements were employed. Steady-state fluorescence and CD experiments were conducted in phosphate buffer titrated with hydrochloric acid to drop the pH from pH 8 to pH 4 to ensure consistency with previously published data (Weerakkody et al. (2013) Proc Natl Acad Sci USA 110(15):5834-5839; Nguyen et al. (2015) Biochemistry-US 54(43):6567-6575; Hunt et al. (1997) Biochemistry 36(49):15177-15192). At the same time, steady-state and kinetics fluorescence experiments measuring the pH-dependent transition from State II to State III were performed in phosphate buffer containing physiological concentrations of free calcium (1.25 mM) and magnesium (0.65 mM) ions found in blood.
[0736] It was established that in solution, PEG-2WT and PEG-4WT exists in compact coil conformations, where tryptophan and other aromatic residues can form stacking structures. As a result, exciton was reflected by the appearance of a minimum around 230 nm on CD spectra (
[0737] Next, the study was extended and the groups consisting of WT, Var3, and ATRAM pHLIP variants were compared to the newly synthesized Var3/Gla and Var3/GLL pHLIP variants. The HPLC retention times of the peptides indicate increasing hydrophobicity within the groups in the following order, from less to more hydrophobic: WT, WT/Gla, WT/Gla/Aad and Var3, Var/Gla, Var3/GLL, and ATRAM, with ATRAM being the most hydrophobic (Table 10). Both Var3/Gla and Var3/GLL demonstrated a pH-dependent interaction with membrane (
[0738] As seen for previous pHLIP designs, the blue shift (or decrease in Stokes shift) in transition from State I to State II and State III was observed for all peptides (Table 11), indicating partitioning of the peptides into the lipid bilayer. However, the positions of fluorescence spectra maxima for peptides belonging to different groups cannot be compared directly, since the locations of the tryptophan residues within the peptides vary greatly. With this fact in mind, and without being bound by any theory, it can be concluded that peptides had very different conformations in State II at pH 8, and that the highest membrane affinity was exhibited by the PEG-pHLIPs, WT/Gla/Aad, Var3/GLL, and ATRAM peptides. PEG-pHLIPs have multiple binding sites due to the linking of multiple WT peptides within a single construct, which is expected to enhance binding affinity. At the same time, WT/Gla/Aad, Var3/GLL, and ATRAM were the most hydrophobic sequences, and thus exhibited stronger binding/insertion. It was also found that some peptides were especially sensitive to the presence of calcium and magnesium ions, namely WT, variants containing the Gla residue (WT/Gla, WT/Gla/Aad, and Var3/Gla) and ATRAM. This sensitivity was most obviously indicated by a decreased Stokes shift (usually 2-3 nm) in State I and/or State II (data not shown), and might reflect slight increases in the hydrophobicity of the peptides caused by the coordination of divalent cations resulting from the presence of closely spaced protonatable residues, such as those found in the C-terminal region of WT and, to some degree, in ATRAM, and to the presence of the Gla residue, with its two protonatable carboxyl groups, in the WT/Gla, WT/Gla/Aad, and Var3/Gla peptides. It was previously shown that the Gla residue possesses the ability to complex calcium ions (Cabaniss et al. (1991) Int J Pept Prot Res 37(1):33-38; Shikamoto et al. (2003) J Biol Chem 278(26):24090-24094; Huang et al. (2004) J Biol Chem 279(14):14338-14346). The decrease in Stokes shift in State II was likely due to the location of membrane-adsorbed peptides (especially more hydrophobic pHLIPs: WT/Gla/Aad, Var3/GLL, and ATRAM) deeper in the lipid membrane and/or a shift in peptide population from the solvated to the membrane-adsorbed state.
[0739] In contrast to tryptophan fluorescence, which is dependent on the location of tryptophan residues within the peptide sequence, the appearance of helicity is a more general parameter which can be compared between all peptides.
[0740] The transitions from State II to State III investigated in steady-state and kinetics modes in the presence of physiological concentrations of calcium and magnesium ions demonstrated pK values in the range of pH 5.7 to 6.6, with highest cooperativity observed for PEG-4WT, and transition times varying from 0.1 to 37.5 s (Table 8). There are subtleties that affect the comparison and interpretation of the data such as: i) the peptides were in different starting conditions in State II at pH 8 due to greatly differing overall peptide hydrophobicity; ii) difference in peptides pK values, which reflect equilibrium between peptides' membrane-adsorbed and membrane-inserted populations; (iii) characteristic times, which report the movement of tryptophan residues into environments inside the membrane; however, sincethe tryptophan residues are located in different regions of each pHLIP, their movement into the membrane, as measured via changes in fluorescence parameters, should be expected to bedifferent; and (iv) the cooperativity of the transition is a somewhat unstable parameter in the fitting of experimental pHdependence data using the Henderson-Hasselbalch equation, especially if slopes are introduced at the initiation and completion of the transition (Barrera et al. (2011) J Mol Biol 413(2):359-371). Lower values of cooperativity (n<1) were observed for the peptides with tryptophan residues located at (Var3 group) or close (ATRAM) to the C-terminal end, which must be translocated across the cell membrane. ATRAM and Var3/GLL, which were the most hydrophobic pHLIPs and were therefore already located deeper in the membrane at pH 8, demonstrated the fastest times of insertion. As was shown previously, the removal of protonatable residues from the inserting C-terminus increases the rate of the transition from State II to State III (Karabadzhak et al. (2012) Biophys J 102(8):1846-1855; Weerakkody et al. (2013) Proc Natl Acad Sci USA 110(15):5834-5839). Thus, the group of Var3-like peptides exhibited fast insertion time (t<1 s). In the group of WT peptides, the time of insertion decreased as the hydrophobicity of the peptide increased, with insertion times listed in the following order (from longest to shortest time of insertion): WT, WT/Gla, WT/Gla/Aad, PEG-2WT, and PEG-4WT.
[0741] Intracellular Delivery of Polar Cargo
[0742] First, whether the pHLIP bundles could cause any cytotoxicity by themselves was evaluated. HeLa cells were treated with either PEG-2WT or PEG-4WT at physiological pH (pH 7.4) and low pH (pH 6.0) for two hours. No cytotoxic effect was observed at either pH, even when treating with concentrations up to 10 M (construct concentration is presented as concentration of WT pHLIP).
[0743] Next, a proliferation assay was employed to evaluate the ability of pHLIPs to intracellularly delivery the toxin amanitin, a cell-impermeable polar cargo molecule (Moshnikova et al. (2013) Biochemistry-US 52(7):1171-1178; Weerakkody et al. (2016) Sci Rep 6:31322). For amanitin to induce cytotoxicity, it must be translocated across the cell membrane, be released from peptide carrier, and reach its target (RNA polymerase II) in nucleus. Amanitin was conjugated via a cleavable disulfide link to the inserting, C termi of the peptides. The translocation capabilities of the pHLIP-amanitin conjugates were probed by investigating the inhibition of proliferation of HeLa cells treated with increasing concentrations (up to 2 M) of pHLIP-amanitin at either physiological pH (pH 7.4) or low pH (pH 6.0) for two hours, followed by removal of the constructs, transferring cells to normal cell culture media, and assessing cell death at 48 hours.
[0744] Each of the conjugates demonstrated pH-dependent cytotoxicity (
[0745] Tumor Targeting
[0746] To investigate the tumor targeting and biodistribution characteristics of the pHLIP variants, the fluorescent dye Alexa Fluor 546 (AF546) was conjugated to the non-inserting, N-terminal ends of seven of the peptides. Previous data indicate excellent tumor targeting by AF546-pHLIPs (Adochite et al. (2014) Mol Pharm 11(8):2896-2905; Adochite et al. (2016) Mol Imaging Biol 18:686-696). In the case of pHLIP bundles, AF546 was conjugated to the inserting, C termini of the PEG-2WT and PEG-4WT pHLIPs, as the N termini were occupied by PEG polymers. A well-established model of acidic 4T1 murine breast tumors was used in the study; this model is targeted well by pHLIPs (Adochite et al. (2014) Mol Pharm 11(8):2896-2905; Adochite et al. (2016) Mol Imaging Biol 113(42):11829-11834). Following the development of breast tumors in the mouse flank, the fluorescent constructs were introduced by a single tail vein injection. Animals were euthanized four hours after the injection of the fluorescent conjugates, and the tumor and major organs (kidney, liver, lungs, spleen, and muscle) were collected and imaged. The four-hour post-injection time point was selected based on previous pharmacokinetics data which show that the highest tumor targeting with pHLIPs is observed four hours after the injection of construct (Adochite et al. (2014) Mol Pharm 11(8):2896-2905; Adochite et al. (2016) Mol Imaging Biol 113(42):11829-11834). The mean values of the surface fluorescence intensity of tumors, muscle, and organs are given in Table 12. The normalized tumor fluorescence intensity (normalized by tumor uptake of AF546-WT) for all constructs is shown in
pHLIP Compounds for Targeted Intracellular Delivery of Cargo Molecules to Tumors
[0747] The study of pHLIPs was been extended by introducing additional variants and pHLIP bundles, and comparing their performance to the performance of recently introduced variants with non-standard amino acids (Gla and Aad) and the hydrophobic GLL motif A goal was to correlate the biophysical properties of the membrane interactions of different pHLIPs at physiological concentrations of free calcium and magnesium ions to the ability of these pHLIPs to move polar cargo across the cell membrane and to target acidic tumors.
[0748] The thermodynamic parameters of pK and cooperativity of pH-dependent transition from State II at pH 8 to State III at pH<5 can be taken as predictors of the performance of a pHLIP for drug delivery and tumor targeting (Burns et al. (2017) Mol Pharm 14(2):415-422; Onyango et al. (2015) Angew Chem Int Edit 54(12):3658-3663; Nguyen et al. (2015) Biochemistry-US 54(43):6567-6575). First, while pK is a rather stable fitting parameter, the cooperativity parameter (Hill coefficient) might vary over a wide range resulting from different fittings which are within the level of accuracy of the experimental measurements. Moreover, if different binding affinities are assumed, the Hill formulation loses validity. In general, highly cooperative transitions are hard to measure in biological systems with noise, especially when examining relatively short peptides like the class of pHLIP peptides (Onyango et al. (2015) Angew Chem Int Edit 54(12):3658-3663). Only if the biological system is approximated to be infinite can a phase transition occur (Sharma et al. (2015) Journal of Statistical Mechanics: Theory and Experiment P01034). Moreover, transition parameters for different peptides can only truly be compared when both peptides have precisely the same starting and ending states; although this condition is met for the membrane-inserted state (State III) of the peptides, which is very similar for all pHLIP variants, the condition that the initial state (State II) of the peptides be identical is not met. As hydrophobicity varies among peptides of the pHLIP family due to the difference in numbers of protonatable, polar, and hydrophobic residues and their location within the peptide sequences, the characteristics of the peptide population in the initial state of the transition also varies as these peptides position themselves at different interaction levels with the hydrophobic/hydrophilic boundary region of a bilayer.
[0749] The population percentages of inserted peptide presented in Table 14 were calculated from the pH-dependence transitions of pHLIP variants. The numbers represent the percentage of membrane-inserted peptides at varying pH assuming that at the beginning of the transition (State II) (i.e., at physiological pH and higher) the population of inserted peptides is about zero. In reality, close consideration of the interaction between a pHLIP variant and the membrane at pH 8, in conditions more alkaline than physiological conditions where the inserted peptide population should be even less than at physiological conditions, indicates that the most hydrophobic sequences, such as ATRAM and Var3/GLL, and bundled pHLIPs with multiple binding sites within a single construct, demonstrate a significant inserted peptide population. This is reflected by the loss of pH-dependent differences in translocation of the polar, cell-impermeable cargo amanitin with an increase in construct concentration (i.e., a decrease in potency at higher concentrations). Additionally, as previously shown using the pore-forming peptide melittin, helix formation, membrane binding, and insertion properties are very sensitive to primary structure changes involving glycine and leucine residues (Krauson et al. (2015) J Am Chem Soc 137:16144-16152). Ultimately, due to patient variability, it is crucial that potential therapeutic pHLIP constructs are able to discriminate between healthy and tumor tissue over a wide concentration range, meaning that a constant potency is necessary to avoid targeting normal tissue and the resulting significant side effects, suggesting that the properties of these variants may not be well suited for clinical development using agents that require tight targeting.
[0750] In addition to the steady-state experiments, it is important to probe tumor targeting and to examine the biodistribution of the constructs when injected into the high-flowrate blood stream, since targeted delivery is may be opposed by clearance from the blood. The best tumor targeting was shown by faster-inserting pHLIP constructs. Thus, in the design of new pHLIP variants, the biophysical kinetics parameters are considered in addition to the steady-state properties. These kinetics parameters are critical for the delivery and translocation of a cargo across membrane, since charges and the presence of cargo at the inserting end of a pHLIP slows down the process of insertion (Karabadzhak et al. (2012) Biophys J 102(8):1846-1855). Different cargoes linked to a pHLIP alter biodistribution and tumor targeting (Adochite et al. (2016) Mol Imaging Biol 113(42):11829-11834). Less polar pHLIP variants conjugated with hydrophobic cargoes might have a higher tendency toward targeting normal tissue and hepatic clearance. On other hand, the size of links in pHLIP bundles are used to tune biodistribution and re-direct clearance from renal to hepatic.
[0751] Among the pHLIP variants, Var3 demonstrated excellent performance in vitro, the most stable potency over a wide range of concentrations, and high tumor targeting. Variants containing the Gla residue, especially WT/Gla construct indeed showed an increase in the cooperativity of the membrane insertion transition as previously reported (Onyango et al. (2015) Angew Chem Int Edit 54(12):3658-3663), and improved therapeutic index. However the tumor targeting of WT/Gla was lower compared to the tumor targeting of WT. The -carboxyglutamic acid is not naturally encoded in the human genome, but is introduced into proteins through the post-translational carboxylation modification of glutamic acid and has two carboxyl groups. Several proteins are known to have Gla-rich domains, including many coagulation factors, which coordinate calcium ions, inducing conformational changes in the protein which enhance the hydrophobicity and affinity of the protein to the cell membrane bilayer (Kalafatis et al. (1996) Crit Rev Eukar Gene 6(1):87-101). Calcium complex formation by a pHLIP increases the hydrophobicity of the peptide and alters the interaction between peptide and membrane; however, despite the cost of synthesizing a peptide with Gla, such constructs are associated with significant advantages such as increased potency.
[0752] pHLIP peptides can be tailored to the specific medical application. For example, kidney clearance might be preferred to liver clearance for PET-pHLIP imaging constructs (Demoin et al. (2016) Bioconjugate Chem 27(9):2014-2023). High tumor-to-normal tissue fluorescence intensity ratios will be the key in fluorescence-guided surgical applications (Golijanin et al. (2016) Proc Natl Acad Sci USA 113(42):11829-11834). Delivery of highly toxic molecules, such as amanitin, are tailored for minimal off-targeting, thus achieving high potency and therapeutic index. However, for the delivery of polar peptide nucleic acids (PNAs) or other highly specific inhibitors of particular pathways in cancer cells, neither of which are associated with toxicity in normal cells, the requirement to reduce off-targeting is much lower, and the emphasis is shifted toward the efficiency of delivery, the goal being is to translocate as much cargo as possible (Cheng et al. (2015) Nature 518(7537):107-110; Reshetnyak et al. (2006) Proc Natl Acad Sci USA 103(17):6460-6465). The pHLIP bundles yield excellent results in these types of applications, supported by the observation that PEG-4WT is the most efficient at delivering the polar molecule amanitin to the intracellular space. Bundling multiple Var3 pHLIPs, in the same fashion in which two or four WT pHLIPs were linked, might be more advantageous. Var3 demonstrates membrane insertion rates orders of magnitude faster than the insertion rates of WT; with the knowledge that faster insertion rates observed in biophysical experiments correlate to better tumor targeting in vivo, it stands to reason that potential PEG-Var3 constructs might demonstrate better tumor targeting still.
[0753] In drug delivery applications, pHLIP peptides are best designed for the delivery of polar, cell-impermeable molecules (An et al. (2010) Proc Natl Acad Sci USA 107(47):20246-20250; Moshnikova et al. (2013) Biochemistry-US 52(7):1171-1178; Burns K E & Thevenin D (2015) Biochem J 472(3):287-295; Burns et al. (2016) Sci Rep 6:28465). The intracellular delivery of polar cargo could be further tuned by altering the link connecting the cargo to pHLIP, and/or by attaching modulator molecules to the inserting end of the peptide (An et al. (2010) Proc Natl Acad Sci USA 107(47):20246-20250; Wijesinghe et al. (2011) Biochemistry-US 50(47):10215-10222; Cheng et al. (2015) Nature 518(7537):107-110; Moshnikova et al. (2013) Biochemistry-US 52(7):1171-1178). Additionally, pHLIP are used for the tumor-targeted delivery of cell-permeable, drug-like molecules since it can significantly increase the time of retention in blood, positively alter the biodistribution of drugs that typically rely on passive diffusion, and enhance tumor targeting, leading to an increase in therapeutic index (Burns (2015) Mol Pharm 12(4):1250-1258). More polar pHLIP variants are expected to be better suited applications involving the intracellular delivery of cell-permeable cargoes.
[0754] The present disclosure establishes a set of properties for a number of pHLIPs, which can be selected for clinical development in different circumstances. This body of work, with the prior studies, opens pathways for targeted delivery using a range of imaging and therapeutic agents in the fight against cancer.
[0755] Materials and Methods
[0756] pHLIPs characterization and pHLIP bundle synthesis: All peptides were purchased from CS Bio Co. Peptides were characterized by reversed phase high-performance liquid chromatography (RP-HPLC) using Zorbax SB-C18 and Zorbax SB-C8, 4.6250 mm 5 m columns (Agilent Technology). For biophysical measurements, PEG-2WT and PEG-4WT were made by conjugating either 2 kDa bifunctional maleimide-PEG-maleimide or 2 kDa 4-arm PEG-maleimide (Creative PEGWorks) to Cys-WT via an N-terminal cysteine residue. Purification of the PEG-pHLIP constructs was conducted using RP-HPLC. Peptide concentration was calculated by absorbance at 280 nm, where, for WT, WT/Gla, and WT/Gla/Aad, F280=13,940 M.sup.1 cm.sup.1; for Var3, Var3/Gla, and Var3/GLL, F280=12,660 M.sup.1 cm.sup.1; and for ATRAM, .sub.280=5,690 M.sup.1 cm.sup.1. PEG construct concentration was presented in terms of peptide concentration, not molecular concentration.
[0757] Liposome preparation: Small unilamellar vesicles were used as model membranes and were prepared by extrusion. 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC; Avanti Polar Lipids) was dissolved in chloroform at a concentration of 12.5 mg/mL, then desolvated by rotary evaporation for two hours under high vacuum. The resulting POPC film was rehydrated in 10 mM phosphate buffer at pH 8, either with ions (1.25 mM calcium and 0.65 mM magnesium), or without ions, vortexed, and extruded fifteen times through a membrane with a pore size of 50 nm.
[0758] Steady-state fluorescence measurements: Steady-state fluorescence spectra were measured using a PC1 spectrofluorometer (ISS) with temperature control set to 25.0 C. The tryptophan fluorescence was excited using an excitation wavelength of 295 nm. Excitation and emission slits were set to 8 nm, and excitation and emission polarizers were set to 54.7 and 0.0, respectively. Sample preparation was conducted 24 hours prior to experiments to allow for State II equilibration. A buffer-only sample was used as a baseline for State I, and a buffer-with-POPC-only sample was used as a baseline for States II and III.
[0759] pH dependence measurements: pH dependence measurements were taken with the PC1 spectrofluorometer by using the shift in the position of maximum of peptide fluorescence as an indication of changes of the peptide environment at varying pH. All pH dependence measurements were conducted at physiological concentrations of free calcium and magnesium ions (1.25 and 0.65 mM, respectively). After the addition of hydrochloric acid, the pH of solutions containing 5 M peptide and 1 mM POPC were measured using an Orion PerHecT ROSS Combination pH Micro Electrode and an Orio Dual Star pH and ISE Benchtop Meter (Thermo Fisher Scientific) before and after spectrum measurement to ensure equilibration. The tryptophan fluorescence spectrum at each pH was recorded, and the spectra were analyzed using the Protein Fluorescence and Structural Toolkit (PFAST) (Shen et al. (2008) Proteins 71(4):1744-1754)(43) to determine the positions of spectral maxima (.sub.max). The position of .sub.max was plotted as a function of pH, and normalized, such as, .sub.max.sup.initialthe position of spectral maxima in the State II, was set to 1 and .sub.max.sup.finalthe position of spectral maxima in the State III, was set to 0. The normalized pH-dependence was fit (using OriginLab software) with the Henderson-Hasselbach equation to determine the cooperativity (n) and transition mid-point (pK) of transition of the peptide population from State II to State III:
[0760] Steady-state circular dichroism and oriented CD measurements: Steady-state CD was measured using an MOS-450 spectrometer (Bio-Logic Science Instruments) in the range of 190 to 260 nm with a step size of 1 nm, and with temperature control set to 25.0 C. Samples were prepared 24 hours prior to experiments to allow for State II equilibration. A buffer-only sample was used as baseline for State I, and a buffer-with-POPC-only sample was used as baseline for States II and III.
[0761] OCD was measured using supported planar POPC bilayers prepared using a Langmuir-Blodgett system (KSV Nima). Fourteen quartz slides with 0.2 mm spacers were used; after sonicating the slides in 5% cuvette cleaner (Contrad 70; Decon Labs) in deionized water (18.2 M cm at 25 C.; Milli-Q Type 1 Ultrapure Water System, EMD Millipore) for fifteen minutes and rinsing with deionized water, the slides were immersed and sonicated for ten minutes in 2-propanol, sonicated again for ten minutes in acetone, sonicated a final time in 2-propanol for ten minutes, and rinsed thoroughly with deionized water. Lastly, the slides were immersed in a 3:1 solution of sulfuric acid to hydrogen peroxide for five minutes and rinsed three times in deionized water. The slides were stored in deionized water until they were used. POPC bilayers were deposited on the fourteen slides using the Langmuir-Blodgett minitrough: a 2.5 mg/mL solution of POPC in chloroform was spread on the subphase (deionized water) and the chloroform was allowed to evaporate for fifteen minutes, after which the POPC monolayer was compressed to 32 mN/m. A lipid monolayer was deposited on the slides by retrieving them from the subphase, after which a solution of 10 M peptide and 500 M of 50 nm POPC liposomes at pH 4 was added to the slides, resulting in the creation of the supported bilayer by fusion between the monolayer on the slides and the peptide-laden lipid vesicles. After incubation for six hours at 100% humidity, the slides were rinsed with buffer solution to remove excess liposomes, and the spaces between the cuvettes were filled with buffer at pH 4. Measurements were taken at three points during the experiment: immediately after the addition of the peptide/lipid solution (0 h), after the slides were rinsed to remove excess liposomes following the six-hour incubation time (6 h), and after an additional twelve-hour incubation time and rinse with buffer (18 h); these measurements were recorded on the MOS-450 spectrometer with sampling times of two seconds at each wavelength. Control measurements were conducted using a peptide solution between slides without supported bilayers and in the presence of POPC liposomes.
[0762] Kinetics measurements: Stopped-flow fluorescence measurements were made using an SFM-300 mixing system (Bio-Logic Science Instruments) in conjunction with the MOS-450 spectrometer. All solutions were degassed for fifteen minutes prior to loading into the stopped-flow system. pHLIP variants were incubated with POPC for 24 hours prior to the experiment to reach State II equilibrium, and insertion was induced by mixing equal volumes of pHLIP/POPC solutions with hydrochloric acid diluted to ensure a pH drop from pH 8 to pH 4. Kinetics data were fit by one-, two-, three-, or four-states exponential models in OriginLab.
[0763] Amanitin pHLIP conjugates: Alpha-amanitin (Sigma-Aldrich) was conjugated to succinimidyl 3-(2-piridyldithio)propionate) (SPDP; Thermo Fisher Scientific), followed by purification and conjugation of the SPDP-amanitin to the C-terminal cysteine residues of pHLIP peptides. For synthesis of PEG-2WT-amanitin and PEG-4WT-amanitin, Lys-WT-Cys with N-terminal lysine and C-terminal cysteine residues was used, and the Lys-WT-SPDP-amanitin was conjugated to dibenzocyclooctyne-sulfo-N-hydroxysuccinimidyl ester (DBCO-NHS ester; Sigma-Aldrich), resulting in DBCO-WT-SPDP-amanitin. Finally, 2-arm or 4-arm PEG-azide (Creative PEGWorks) was conjugated to DBCO-WT-SPDP-amanitin, resulting in PEG-DBCO-WT-SPDP-amanitin, with a cleavable disulfide bond present in SPDP, between the peptide and amanitin cargo. Construct concentration was calculated by absorbance at 310 nm, where, for -amanitin, .sub.310=13,000 M.sup.1 cm.sup.1. Construct concentration was presented in terms of peptide/amanitin concentration. Purification was conducted using reverse phase HPLC. Zorbax SB-C18 columns (9.4250 mm, 5 m; Agilent Technologies) were used for all peptide-amanitin conjugates other than ATRAM-amanitin, PEG-2WT-amanitin, and PEG-4WT-amanitin, for which Zorbax SB-C8 columns (9.4250 mm, 5 m; Agilent Technologies) were used.
[0764] Cell proliferation assay: Human cervix adenocarcinoma cells (HeLa; American Type Culture Collection) were authenticated, stored according to the supplier's instructions, and used within three months of frozen aliquot resuscitation. Cells were cultured in Dulbecco's modified Eagle's medium (DMEM; Sigma-Aldrich) at pH 7.4 with 4.5 g/L D-glucose, supplemented with 10% heat-inactivated fetal bovine serum (FBS; Sigma-Aldrich) and 10 g/mL ciprofloxacin (Sigma-Aldrich), in a humidified atmosphere of 5% CO2 and 95% air at 37 C. The pH 6.0 medium was prepared by mixing 13.3 g of dry DMEM in 1 L of deionized water. HeLa cells were loaded in the wells of 96-well plates (5,000 cells/well) and incubated overnight. The standard growth medium was replaced with medium without FBS, at pH 6.0 or 7.4, containing increasing amounts of pHLIP-amanitin conjugates (from 0 up to 2.0 M). Treatment with amanitin alone for two hours and at concentrations up to 2 M does not induce cell death (Moshnikova et al. (2013) Biochemistry-US 52(7):1171-1178). After two-hour incubation with the pHLIP-amanitin conjugates, the constructs were removed and replaced with standard growth medium. Cell viability was assessed after 48 hours using the CellTiter 96 AQ.sub.ueous One Solution Cell Proliferation Assay (Promega); the colorimetric reagent was added to cells for one hour, followed by absorption measurement at 490 nm. All samples were prepared in triplicate, and each experiment was repeated from 3 to 6 times for different constructs. All obtained cell proliferation data were normalized by corresponding controls (non-treated cells). There was no difference in viability of cells incubated with media (no constructs) at pH7.4 and pH6.0, therefore role of pH was excluded from the consideration. Normalized cell viability data obtained in different experiments were averaged, and presented as the logarithm of dose of pHLIP-amanitin constructs. The dose response function was used for fitting (using OriginLab software) of the obtained data (
where A.sub.b and A.sub.t are the bottom and the top asymptotes, respectively. The top asymptote was set as constant, 100%, while for bottom asymptote we allowed small variations in the range of 0 to 10%. p is the slope (cooperativity parameter) and LOG x0 is the center of the transition, the concentration for half response, which is used to calculate the EC.sub.20, EC.sub.50, EC.sub.50 values:
EC.sub.20=10.sup.(LOG x0+Log(0.25)/p)(3)
EC.sub.50=10.sup.LOG x0(4)
EC.sub.80=10.sup.(LOG x0+Log(4)/p)(5)
Therapeutic index (TI) was calculated according to the equation:
[0765] Additionally, the cytotoxicity of the PEG-2WT and PEG-4WT constructs without amanitin was tested: these experiments demonstrated no cytotoxicity at physiological or low pH at treatment concentrations up to 10 M.
[0766] Fluorescent pHLIP conjugates: Alexa Fluor 546 (AF546) C.sub.5 maleimide (Thermo Fisher Scientific) was conjugated to N-terminal cysteine residues of WT, Var3, Var3/Gla, and ATRAM. Alexa Fluor 546 NHS Ester (Thermo Fisher Scientific) was conjugated to the N-terminal lysine residues of WT/Gla, WT/Gla/Aad, and Var3/GLL. For PEG-2WT and PEG-4WT, Cys-WT-Lys, with N-terminal cysteine and C-terminal lysine residues, was used, and was first conjugated to 2-arm maleimide-PEG-maleimide or 4-arm PEG-maleimide resulting in PEG-WT-Lys. Then, Alexa Fluor 546 NHS Ester was conjugated to the C-terminal lysine residue, resulting in 2-arm and 4-arm PEG-pHLIP constructs with C-terminal AF546 fluorophores. Construct concentration was calculated by absorbance at 554 nm, where, for AF546, .sub.554=93,000 M.sup.1 cm.sup.1. Construct concentration was presented in terms of AF546/peptide concentration, not molecular concentration. Purification was conducted using RP-HPLC for all peptides other than PEG-4WT-AF546, which was purified via Amicon Ultra MWCO 10 kDa centrifugal filter (Sigma-Aldrich). Zorbax SB-C18 columns (9.4250 mm, 5 m; Agilent Technologies) were used for all AF546-peptide conjugates except AF546-ATRAM and PEG-2WT-AF546, for which Zorbax SB-C8 columns (9.4250 mm, 5 m; Agilent Technologies) were used.
[0767] Ex vivo imaging: All animal studies were conducted according to the animal protocol AN04-12-011 approved by the Institutional Animal Care and Use Committee at the University of Rhode Island, in compliance with the principles and procedures outlined by the National Institutes of Health for the care and use of animals. Mouse mammary cells (4T1; American Type Culture Collection) were subcutaneously implanted in the right flank (810.sup.5 cells/0.1 mL/flank) of adult female BALB/cAnNHsd mice (Envigo). When tumors reached approximately 5-6 mm in diameter, single tail vein injections of 100 L, 40 M fluorophore-pHLIP solutions in PBS were performed. Mice were euthanized 4 hours (or 24 hours) after injection, and necropsy was immediately performed. Tumors and major organs were cut in half and imaged using FX Kodak in-vivo image station connected to the Andor CCD. Mean surface fluorescence intensity of tumor, tissue and organs was obtained via analysis of fluorescent images in ImageJ (NIH) (Schneider et al. (2012) Nat Methods 9(7):671-675). The corresponding autofluorescence signal was subtracted to obtained net fluorescence intensities used in the study. Autofluorescence was calculated after imaging of tumor, tissue and organs collected from mice with no injection of fluorescent pHLIP constructs.
[0768] Tables
TABLE-US-00027 TABLE 8 The parameters, midpoint (pK), cooperativity (n) and time (t), characterizing the pH-dependent transition of pHLIP variants in the presence of POPC liposomes, are presented. EC.sub.20, EC.sub.50, EC.sub.80 values were calculated for each pHLIP-amanitin construct at different pHs by analyzing pH- and concentration-dependent cell viability data (FIG. 6). EC.sub.20, M EC.sub.50, M EC.sub.80, M Peptide pK n t (s) pH 7.4 pH 6.0 pH 7.4 pH 6.0 pH 7.4 pH 6.0 WT 6.5 1.8 0.1 36.8 1.95 1.22 1.37 0.56 0.96 0.26 WT/Gla 6.2 1.5 0.0 37.5 6.20 0.93 2.73 0.30 1.20 0.10 WT/Gla/Aad 6.6 1.4 0.1 34.8 3.01 0.66 1.39 0.37 0.64 0.21 PEG-2WT 6.6 1.8 0.2 18.8 1.98 0.54 1.03 0.19 0.53 0.07 PEG-4WT 6.6 2.2 0.4 13.1 0.473 0.19 0.33 0.11 0.23 0.06 Var3 5.7 0.9 0.0 0.9 10.63 1.30 3.95 0.43 1.47 0.14 Var3/Gla 6.3 0.7 0.0 0.7 5.12 1.34 2.76 0.50 1.48 0.19 Var3/GLL 6.6 0.4 0.0 0.1 1.75 0.47 0.91 0.23 0.47 0.11 ATRAM 6.4 0.9 0.1 0.1 2.06 0.40 1.23 0.22 0.74 0.12
TABLE-US-00028 TABLE9 ListofpHLIPsequencesusedinthestudy. Peptide Sequence Cys-WT ACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT(SEQIDNO:313) WT-Cys AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGCT(SEQIDNO:314) Lys-WT-Cys Ac-AKEQNPIYWARYADWLFTTPLLLLDLALLVDADECT(SEQIDNO:315) Lys-WT/Gla-Cys Ac-AKEQNPIYWARYAGlaWLFTTPLLLLDLALLVDADECT(SEQIDNO:316) Lys-WT/Gla/Aad-Cys Ac-AKEQNPIYWARYAGlaWLFTTPLLLLAadLALLVDADECT(SEQIDNO:317) Cys-Var3 ACDDQNPWRAYLDLLFPTDTLLLDLLWA(SEQIDNO:15) Var3-Cys ADDQNPWRAYLDLLFPTDTLLLDLLWCA(SEQIDNO:17) Cys-Var3/Gla ACDDQNPWRAYLGlaLLFPTDTLLLDLLWG(SEQIDNO:318) Var3/Gla-Cys ADDQNPWRAYLGlaLLFPTDTLLLDLLWCG(SEQIDNO:327) Lys-Var3/GLL-Cys Ac-GKEEQNPWLGAYLDLLFPLELLGLLELGLWCG(SEQIDNO:319) Cys-ATRAM ACGLAGLAGLLGLEGLLGLPLGLLEGLWLGLELEGN(SEQIDNO:320) ATRAM-Cys GLAGLAGLLGLEGLLGLPLGLLEGLWLGLELEGNCA(SEQIDNO:324)
TABLE-US-00029 TABLE 10 Molecular weights (MW), retention time and percentage of acetonitrile presented for 30 min method of 25% to 80% gradient of acetonitrile/0.05% TFA in water/0.05% TFA used in C18 and C8 columns for the elution of peptides. Zorbax SB-C18 Zorbax SB-C8 (4.6 250 mm, 5 m) (4.6 250 mm, 5 m) Reten- Reten- tion tion Time % Aceto- Time % Aceto- Peptide MW (Da) (min) nitrile (min) nitrile Cys-WT 4111.7 21.6 64.6% 20.6 62.8% Lys-WT- 4224.9 21.6 64.6% 20.4 62.4% Cys Lys-WT/ 4283.1 22.3 65.9% 21.2 63.9% Gla-Cys Lys-WT/ 4310.9 22.8 66.8% 21.7 64.8% Gla/Aad- Cys Cys-Var3 3292.8 19.7 61.1% 19.6 60.9% Cys-Var3/ 3333.8 19.9 61.5% 19.7 61.1% Gla Lys-Var3/ 3643.2 28.0 76.2% 26.0 72.7% GLL-Cys Cys- 3516.2 30.6* 93.0% 27.2 74.9% ATRAM *Peptide eluted during washing with acetonitrile, after the completion of the gradient.
TABLE-US-00030 TABLE 11 Positions of maxima of tryptophan fluorescence spectra (.sub.max) and ratios of ellipticity at 205 nm to 222 nm of pHLIP constructs in States I, II, and III. .sub.max (nm) Ellipticity at 205/222 nm Construct State I State II State III State I State II State III WT 351.6 347.4 340.0 1.61 2.16 0.68 WT/Gla 348.2 347.1 338.2 2.02 1.60 0.70 WT/Gla/Aad 347.5 346.7 338.3 1.60 1.31 0.68 PEG-2WT 341.8 341.2 336.6 1.12 1.48 0.71 PEG-4WT 344.0 343.4 338.9 1.18 1.07 0.71 Var3 350.2 346.8 339.9 2.35 1.55 0.71 Var3/Gla 351.4 345.7 339.2 2.72 1.76 0.85 Var3/GLL 349.3 343.3 341.2 2.21 1.32 0.84 ATRAM 345.5 341.4 333.0 2.45 1.44 0.85
TABLE-US-00031 TABLE 12 Fluorescence intensity obtained by ex vivo imaging of tumor, tissue, and organs 4 hours after a single IV administration of the Alexa Fluor 546-pHLIP constructs (also data obtained at 24 hours post-injection are shown for PEG-2WT and PEG-4WT). Values of tissue autofluorescence are provided in the last row. Sample size (n) is given in the last column for each construct. Total Fluorescence Intensity in tumor, muscle and organs (a.u.) Construct Tumor Muscle Kidney Liver Lungs Spleen n WT 2335.7 447.1 726.8 58.5 988.5 91.0 998.7 142.0 545.8 32.6 447.0 31.7 5 WT/Gla 1372.1 331.7 591.2 73.2 880.2 126.5 1102.1 239.6 456.2 68.6 387.9 63.3 13 WT/Gla/Aad 1336.6 304.5 559.6 53.5 726.6 149.9 1156.4 120.8 448.5 79.9 374.1 45.0 13 PEG-2WT 1443.4 178.5 545.3 42.2 602.7 79.2 1267.1 146.2 462.0 28.5 450.7 17.3 5 PEG-4WT 912.8 159.5 495.5 23.0 523.4 52.5 1209.7 100.7 431.0 54.9 403.7 30.0 7 Var3 3474.3 924.2 760.7 68.3 1263.9 136.5 904.8 93.4 564.3 130.1 335.6 45.0 7 Var3/Gla 2948.9 540.6 889.3 144.7 1390.0 247.5 702.9 140.9 784.5 248.7 379.2 47.8 5 Var3/GLL 1577.9 364.2 694.2 27.5 1690.8 431.8 1194.3 147.1 520.2 18.6 442.8 37.4 5 ATRAM 3039.5 620.9 813.3 105.4 1009.8 183.9 1073.2 146.3 716.6 109.0 421.3 35.3 9 PEG-2WT (24 h) 894.9 151.8 486.3 19.8 525.1 37.6 753.6 54.0 547.2 64.8 346.3 11.0 5 PEG-4WT (24 h) 663.5 121.1 440.1 7.7 464.2 35.1 726.7 69.6 482.8 48.5 331.8 4.4 5 Autofluorescence 426.9 15.7 402.7 11.5 325.6 30.8 354.7 28.3 392.7 32.7 296.1 23.2 12
TABLE-US-00032 TABLE 13 Tumor-to-muscle (T/M), tumor-to-kidney (T/K) and tumor-to liver (T/L) ratios presented on FIGS. 4B, 4C, and 4D, respectively. Constructs T/M T/K T/L WT 5.87 0.64 2.95 0.95 3.03 0.76 WT/Gla 5.39 1.65 1.77 0.68 1.40 0.76 WT/Gla/Aad 6.54 3.15 2.59 1.33 1.14 0.37 PEG-2WT 7.48 1.86 3.80 0.77 1.13 0.19 PEG-4WT 5.34 1.53 2.55 0.78 0.57 0.17 Var3 8.86 3.61 3.38 1.34 5.62 1.90 Var3/Gla 5.30 0.89 2.46 0.64 8.29 4.19 Var3/GLL 4.03 1.54 0.87 0.23 1.42 0.55 ATRAM 6.56 1.55 3.96 1.05 3.72 1.01
TABLE-US-00033 TABLE 14 The membrane-inserted populations of different pHLIP variants were calculated using the pH dependence parameters pK and n (Table 8). pH WT WT/Gla WT/Gla/Aad PEG-2WT PEG-4WT Var3 Var3/Gla Var3/GLL ATRAM 7.4 2% 2% 7% 4% 2% 3% 15% 32% 11% 7.2 5% 3% 13% 8% 5% 4% 19% 37% 16% 7.0 11% 6% 22% 16% 12% 6% 24% 41% 22% 6.8 22% 11% 34% 30% 27% 9% 31% 45% 30% 6.5 50% 26% 58% 60% 62% 16% 42% 52% 45% 6.2 78% 50% 78% 84% 88% 26% 54% 59% 60% 6.0 89% 67% 87% 92% 95% 35% 62% 63% 70%
Example 2: Hemolysis Assay Performed with WT, Var3 and Var7 pHLIP Peptide
[0769] Hemolysis assays show ability of a construct to lyse red blood cells (RBCs). Peptide or compounds with multiple positive charges are typically very lytic. This study shows that pHLIPs (which have negative charges) are not lytic for RBC.
[0770] Single donor human whole blood was purchased from Innovative Research. RBCs were collected by centrifugation of whole blood at 2000 rpm for 10 minutes followed by washing three times with Dulbecco's PBS (DPBS) and re-suspended in DPBS at a concentration of 7.5% (v:v). Varying concentrations of WT, Var3 and Var7 peptides (2.5 M, 5 M and 10 M) in 10 mM HEPES buffer, pH 7.4 containing 137 mM NaCl, 2.7 mM KCl, 1 mM CaCl.sub.2) were added to RBCs to form 5% RBC suspension. The resultant mixtures were incubated at 37 C. for 2 hours and then centrifuged at 2000 rpm for 10 min. The hemolysis was assessed by the release of hemoglobin, which was monitored by measuring of absorbance at 450 nm. 10 mM HEPES buffer, pH 7.4 containing 137 mM NaCl, 2.7 mM KCl, 1 mM CaCl.sub.2) and DPBS were used as negative controls. As positive controls, which result in 100% lysis of RBCs, we used i) water and ii) 10% of Triton X-100. The percentage of hemolysis was calculated as follows:
where, OD.sub.Test, OD.sub.NC, and OD.sub.PC are the optical density reading (absorbance) values of the test sample, negative control and positive control, respectively. The assay was performed in triplicate. The lysis of RBCs was less than 1% in the case of WT, Var3 and Var7 pHLIP peptides.
Example 3: Use of pHLIP Compound Comprising of pHLIP Peptide (Var3 Group), Linker (SPDP Crosslinker), and Cargo (Amanitin)
[0771] Methods
[0772] pHLIP peptide (Var3: ADDQNPWRAYLDLLFPTDTLLLDLLWCA (SEQ ID NO: 17)) was purchased from CS Bio Co. Peptide concentration was calculated by absorbance at 280 nm, .sub.280=12,660 M.sup.1 cm.sup.1. Alpha-amanitin (Sigma-Aldrich) was conjugated to succinimidyl 3-(2-pyridyldithio)propionate) (SPDP; Thermo Fisher Scientific), followed by purification and conjugation of the SPDP-amanitin to the C-terminal cysteine residues of Var3 pHLIP peptides. Purification was conducted using reverse phase HPLC (Zorbax SB-C18 columns 9.4250 mm, 5 m; Agilent Technologies). Construct concentration was calculated by absorbance at 310 nm, where, for -amanitin, .sub.310=13,000 M.sup.1 cm.sup.1.
[0773] Ten different bladder cancer cell lines from ATCC (American Type Culture Collection) were authenticated, stored according to the supplier's instructions, and used within three months of frozen aliquot resuscitation. Cells were loaded in the wells of 96-well plates (5,000 cells/well) and incubated overnight. The standard growth medium was replaced with medium without FBS, at pH 6.0 or 7.4, containing increasing amounts of pHLIP-SPDP-amanitin composition. Treatment with amanitin alone for two hours and at concentrations up to 2 M does not induce cell death as it was shown previously. After two-hour incubation with the pHLIP-SPDP-amanitin composition, the construct was removed and replaced with standard growth medium. Cell viability was assessed after 72 hours using the CellTiter 96 AQ.sub.ueous One Solution Cell Proliferation Assay (Promega); the colorimetric reagent was added to cells for one hour, followed by absorption measurement at 490 nm. All samples were prepared in triplicate, and each experiment was repeated from 3-4 times for different cell lines. All obtained cell proliferation data were normalized by corresponding controls (non-treated cells at pH7.4). Normalized cell viability data obtained in different experiments were averaged, and presented as the logarithm of dose of pHLIP-SPDP-amanitin composition. The dose response function was used for global fitting (using OriginLab software) of the obtained data at both pH7.4 and pH6.0:
where A.sub.b and A.sub.t are the bottom and the top asymptotes, respectively. The top asymptote was set as constant, 100%, while for bottom asymptote we allowed small variations in the range of 0 to 10%. p is the slope (cooperativity parameter) and LOG x0 is the center of the transition, the concentration for half response, which is used to calculate the EC.sub.20, EC.sub.50, EC.sub.50 values:
EC.sub.20=10.sup.(LOG x0+Log(0.25)/p)
EC.sub.50=10.sup.LOG x0
EC.sub.80=10.sup.(LOG x0+Log(4)/p)
Therapeutic index (TI) was calculated according to the equation:
[0774] Use of pHLIP Compound Comprising of pHLIP Peptide (Var3 Group), Linker (SPDP Crosslinker), and Cargo (Amanitin)
[0775] Bladder cancer is the fifth most common cancer, comprising 5% of all new cancer cases in the United States, with 79,030 new cases of bladder cancer (about 60,490 in men and 18,540 in women) and about 16,870 deaths from bladder cancer (about 12,240 in men and 4,630 in women) estimated for 2017 in the US and over 450,000 cases worldwide. Almost all of these patients require continuous surveillance and treatments. The first treatment option of bladder cancer is a surgery, transurethral resection of bladder tumors (TURBT)for the removal of cancerous lesions. TURBT is accompanied with perioperative or postoperative intravesical therapy. Immunotherapy includes the use of Bacillus Calmette-Gurin (BCG), a vaccine for prevention of tuberculosis, and interferons. Typically, immunotherapy might provide a good first outcome, but does not lead to cure and became ineffective at next steps, when chemotherapy is employed. Chemotherapy includes use of mitomycin, thiotepa, gemcitabine, doxorubicin and its derivatives. However, these drugs do not possess ability of targeting of cancer cells. Thus, high concentration of the drug is used for bladder instillation, which leads to the toxicity, since small drug molecules (<500 Da) are readily adsorbed by the bladder and reach the blood stream to induce systemic toxicity. At the same time the efficacy of the treatment is very moderate and the recurrence rate is very significant due to the lack of the ability to target and kill all cancer cells in the bladder.
[0776] A tumor targeting pHLIP compound comprising a pHLIP peptide, SPDP linker and amanitin cargo is proposed. Amanitin is a polar, cell-impermeable molecule, which cannot cross the plasma membrane of cells. A toxic effect after IV administration of amanitin or consumption of amanitin with food is associated with liver poisoning, since the liver has a special transporting system to take up cyclic compounds, like amanitin. Significant liver toxicity is not expected in the result of intravesical instillation. The tested pHLIP compound has been tested on the following 10 human bladder cancer cell lines: [0777] 5637, grade II carcinoma [0778] J82, transitional cell carcinoma [0779] UMUC3, transitional cell carcinoma [0780] SCaBER, squamous cell carcinoma [0781] T24, transitional cell carcinoma [0782] TCCSUR, IV transitional cell carcinoma [0783] RT4, transitional cell papilloma [0784] HT-1197, urinary bladder carcinoma [0785] HT-1376, grade III carcinoma [0786] SW780, transitional cell carcinoma
[0787]
TABLE-US-00034 TABLE 15 The EC.sub.20, EC.sub.50, EC.sub.80 values were calculated for each pHLIP-SPDP-amanitin composition at different pHs by analyzing pH- and concentration-dependent cell viability data shown in FIG. 7. EC.sub.20, M EC.sub.50, M EC.sub.80, M Bladder cancer cell line pH 7.4 pH 6.0 pH 7.4 pH 6.0 pH 7.4 pH 6.0 TI HT-1197, urinary bladder carcinoma 240.4 78.5 25.7 876.6 284.7 92.5 3.6 5637, grade II carcinoma 148.7 45.1 13.7 858.3 408.6 194.5 9.1 HT-1376, grade III carcinoma 3625.7 429.8 51.0 7067.1 2128.8 641.2 5.0 SCaBER, squamous cell carcinoma 157.9 67.7 29.0 1753.8 768.2 336.5 11.3 J82, transitional cell carcinoma 249.3 79.3 25.2 877.7 339.5 131.3 4.3 UM-UC-3, transitional cell carcinoma 631.7 79.5 10.0 2078.8 390.0 73.2 4.9 SW780, transitional cell carcinoma 693.1 84.0 10.2 2191.7 405.5 75.0 4.8 T-24, transitional cell carcinoma 255.7 77.1 23.2 1204.0 527.4 231.0 6.8 TCCSUR, IV transitional cell carcinoma 1060.3 293.9 81.4 5058.3 2027.3 812.5 6.9 RT4, transitional cell papilloma 1119.3 92.2 7.6 2643.4 900.2 306.6 9.8
Example 4: Tumors Targeting, Biodistribution and Kinetics Studies with an Exemplary ICG-pHLIP
[0788] An ICG-Var3 pHLIP imaging agent that has been chosen for further study and evaluation (ICG-pHLIP) is shown in
Conjugation of ICG with pHLIP Var3
[0789] pHLIP Var3 (synthesized and purified by CS Bio) and ICG-maleimide (Intrace Medical) was dissolved in DMSO. Peptide and ICG-maleimide concentrations were calculated by measuring absorbance in methanol at 280 nm and 800 nm, respectively, and using extinction coefficients .sub.280=12,660 M.sup.1cm.sup.1 for peptide and .sub.800=137,000 M.sup.1cm.sup.1 for ICG. ICG-maleimide was conjugated with the peptide at a 1:1 molar ratio. Reaction went in DMSO in presence of 100 mM sodium phosphate, 150 mM NaCl buffer, pH 7.4 (saturated with argon) at 9:1 v/v ratio. The reaction mixture was incubated at room temperature for 2-3 hours and the progress of the reaction was monitored by analytical reverse phase HPLC using a Zorbax SB-C18 column (4.6250 mm, 5 m; Agilent Technologies) and a 20-80% binary solvent gradient system of water and acetonitrile with 0.05% TFA over 30 min. If needed, additional amounts of ICG-maleimide were added to the reaction mix to react with the peptide. ICG pHLIP was purified by reverse phase HPLC using 9.4250 Zorbax SB-C18 columns. Purity of the product was accessed by SELDI-TOF mass spectrometry and analytical HPLC using a Zorbax SB-C18 column (4.6250 mm, 5 m) with a binary solvent system using a 15-85% water and acetonitrile gradient with 0.05% TFA over 25 min (
[0790] A cGMP manufacturing protocol of ICG-pHLIP is developed by. The GLP material is produced for toxicity study (see Certificate of Analysis in
Stability Study
[0791] Stability studies were performed with i) ICG-pHLIP formulation in PBS containing 5% DMSO used in some of the proof of concept (PoC) animal studies and ii) ICG-pHLIP in PBS containing 5% Ethanol formulation used in some PoC animal studies, toxicity studies on mice, rats and dogs and formulation developed for human dosing (in PBS containing 5% Ethanol).
[0792] For the PBS/5% DMSO formulation, 1 mg of the lyophilized powder of ICG-pHLIP (96.8% purity), synthesized according to the protocol described above, was dissolved in 75 LEI of DMSO (to make 3.2 mM solution), next 10 l of 3.2 mM stock was mixed with 190 l PBS to make 0.16 mM solution of ICG pHLIP (5% DMSO).
[0793] For the PBS/5% Ethanol formulation, 16 mg of the lyophilized powder of ICG-pHLIP (98.7% purity, GLP material manufactured by Iris Biotech) was dissolved by 30 sec vortexing in PBS containing 5% Ethanol (formulation proposed for human dosing).
[0794] Both formulations were kept at room temperature protected from light. The aliquots were taken at 0.5 or 1 b, 3 h, 6 h, 24 h, 48 h and 72 hours for analytical HPLC analysis using a Zorbax SB-C18 column (4.6250 mm, 5 m) with a binary solvent system using a 15-85% water and acetonitrile gradient with 0.05% TFA over 25 min. Results of HPLC analysis are provided in Appendix N2 and N3). The stability was constant up to 72 hours (we did not looked longer time points) at room temperature and both constructs preserved their original purity (
Absorption and Fluorescence of ICG-pHLIP
[0795] The concentration of the ICG-pHLIP was determined by ICG absorption at 800 nm, .sub.800=137,000 M.sup.1 cm.sup.1 in DMSO or Methanol. The absorption and fluorescence spectra of ICG-pHLIP in DMSO and emission of ICG-pHLIP in PBS in presence of POPC liposomes, which mimic cellular membrane, are shown in
Cytotoxicity
[0796] Human mammary epithelial cells (HMEpC) were acquired from Cell Applications Inc, and authenticated, and stored according to supplier's instructions. Cells were cultured in mammary epithelial cell growth medium provided by Cell Applications Inc. HMEpC cells were loaded in the wells of 96-well plates (6,000 cells per well) and incubated overnight. The increasing amounts of ICG-pHLIP dissolved in cell growth medium were added to cells to have the following final concentration of ICG-pHLIP with cells: 0.125, 0.25, 0.5, 1, 2, 4, 8 and 16 M. After 48 and 72 hours of incubation, a colorimetric reagent (CellTiter 96 AQ.sub.ueous One Solution Assay, Promega) was added for 1 hour followed by measuring absorbance at 490 nm to assess cell viability. All samples were prepared in triplicate and each experiment was repeated several times. ICG-pHLIP did not show any cytotoxic effect at any tested concentration.
Hemolysis Assay
[0797] Single donor human whole blood was purchased from Innovative Research. Red blood cells (RBCs) were collected by centrifugation of whole blood at 2000 rpm for 10 minutes followed by washing three times with Dulbecco's PBS (DPBS) and re-suspended in DPBS at a concentration of 7.5% (v:v). Varying concentrations of ICG-pHLIP (0.075, 0.15, 0.3, 0.6, 1.2 nmol) in DPBS were added to RBCs to give a 5% RBC suspension (total volume of solution with RBC was 150 L). The resultant mixtures were incubated at 37 C. for 2 hours and then centrifuged at 2000 rpm for 10 min. Hemolysis was assessed by the release of hemoglobin, which was monitored by measuring the absorbance at 450 nm of the supernatant hemoglobin. DPBS was used as negative controls. As positive controls, which result in 100% lysis of RBCs, we used i) water and ii) 10% of Triton X-100. The percentage of hemolysis was calculated as follows:
where, OD.sub.Test, OD.sub.NC, and OD.sub.PC are the optical density reading (absorbance) values of the test sample, negative control and positive control, respectively. The assay was performed in triplicate. The amount of RBC lysis was less than 2% in all samples. For the reference, in mice study 2.5 nmol of ICG pHLIP is injected per mouse (a 20 g mouse has about 1.2 mL of blood), or 2.08 nmol/ml (the dose will be much lower in humans), while in hemolysis assay the maximum tested concentration was 8 nmol/ml.
Animal Experiments
[0798] All animal studies were conducted according to the animal protocol AN04-12-011 approved by the Institutional Animal Care and Use Committee at the University of Rhode Island, in compliance with the principles and procedures outlined by the National Institutes of Health for the care and use of animals.
Biodistribution and Kinetics
[0799] BALB/cAcNHsd mice ranging in age from 5 to 6 weeks obtained from Envigo RMS Inc were used in the study. Mouse mammary 4T1 cancer cells were subcutaneously implanted in the right flank (810.sup.5 cells/0.1 mL/flank) of adult female mice. Triple negative 4T1 tumor model closely mimics stage IV of human breast cancer. When tumors reached 5-6 mm in diameter, single tail vein injections of 2.5 nmol (or 0.5 mg/kg) of ICG-pHLIP in sterile PBS with 5% DMSO or 5% Ethanol (volume of the injection was 100 l) were performed. The whole body and ex vivo imaging was performed using a Stryker 1588 AIM clinical imaging system with L10 AIM Light Source, 1588 AIM Camera using a 10 mm or 5 mm scope. Whole-body mouse images, magnified images of shaved mouse flank with 4T1 tumor and excised 4T1 tumors demonstrating ICG pHLIP NIRF imaging are shown in
[0800] Animals were euthanized at time points: 5 min, 1 hr, 2 hrs, 4 hrs, 6 hrs, 16 hrs, 26 hrs and 48 hrs. Five animals were used for each time point plus seven control animals (mice, who did not receive ICG-pHLIP imaging construct). 100 l of blood was collected immediately after euthanasia and mixed with 12.5 l of citrate-dextrose anticoagulant solution (kept at 4 C.), and necropsy was performed. Tumor, muscles, skin, heart, lungs, liver, spleen, kidneys, brain, pancreas, bone, stomach, small and large intestines were collected, imaged immediately after collection, weighed, and fast frozen in liquid nitrogen.
[0801] Blood samples mixed with of anti-coagulant solution were placed in 384 well plates (MatTek, glass bottom) (15 L per well) and imaged on an Odyssey IR scanner (Li-Cor Biosciences). To establish a calibration curve, known amounts of ICG-pHLIP (different concentrations) were added to the blood of control mice (mice, who did not receive ICG-pHLIP imaging construct), mixed with anticoagulant solution. The same amounts (15 L) of blood samples were placed in 384 well plate and imaged together with all other blood samples. The digital images were processed using the Image J program to calculate mean fluorescence intensity. The calibration curve (known concentration of ICG-pHLIP in blood samples vs intensity) was constructed to calculate the amount of ICG-pHLIP in blood samples collected from the mice at different times after construct administration.
TABLE-US-00035 TABLE 16 Concentration of ICG-Var3 (nmol) in blood collected from animals at different time points after single tail vein injection of 2.5 nmol of ICG-Var3. 5 animals were used for each time point. Time p.i. 5 min 1 hour 2 hours 4 hours 6 hours 16 hours 26 hours Concentration 2.09 1.31 0.40 0.49 0.38 0.13 0.03 in blood, nmol 2.47 1.73 0.67 0.57 0.32 0.10 0.02 2.02 0.93 0.47 0.48 0.35 0.16 0.02 2.24 0.88 0.76 0.57 0.46 0.08 0.03 2.56 1.40 0.64 0.41 0.41 0.11 0.02 Mean St. D. 2.28 0.23 1.25 0.35 0.59 0.15 0.51 0.07 0.38 0.06 0.12 0.03 0.02 0.01
[0802] The ex vivo imaging of organs was performed using a Stryker 1588 AIM clinical imaging system with L10 AIM Light Source, 1588 AIM Camera using a 10 mm scope. The lens was spaced 4.3 cm away from the surface of the organs within an enclosed (light protected) area. The NIRF imaging of each organ was performed at three different laser intensities set on a hexadecimal scale as OB-22 (low), 12-5C (medium), and 20-3A (high). Representative images of organs are shown in
TABLE-US-00036 TABLE 17a Fluorescence intensity (a.u.) obtained by ex vivo imaging of organs collected at different time points after IV administration of ICG pHLIP, 5 animals were used for each time point. Time p.i. 5 1 2 4 6 16 26 min hour hours hours hours hours hours Tumor 46.3 92.0 119.7 205.3 193.8 208.2 173.3 37.2 117.6 145.3 219.5 169.3 226.8 208.2 32.4 73.8 151.9 191.8 250.5 233.9 182.1 33.4 61.1 121.8 206.4 172.1 214.5 174.8 31.7 157.9 131.1 233.0 207.3 230.6 174.4 Liver 380.8 541.2 560.0 532.7 517.1 382.1 213.8 393.6 558.6 568.2 569.4 560.7 386.3 196.9 469.0 519.7 555.7 541.0 489.1 455.1 217.1 450.4 520.5 523.6 539.5 483.9 368.5 214.9 405.4 525.1 505.3 517.6 584.9 410.3 223.0 Kidneys 145.9 202.1 175.6 191.7 169.6 154.1 121.4 180.2 202.8 161.0 188.5 169.3 175.2 100.2 165.6 179.8 152.4 175.7 173.3 183.1 108.4 195.7 199.0 154.4 183.6 180.9 160.3 115.2 171.2 184.9 136.8 188.0 176.9 180.4 113.8 Heart 174.5 188.4 164.5 191.7 153.6 128.2 67.8 213.0 194.5 154.9 191.6 166.7 115.2 50.1 211.8 170.2 183.9 174.5 155.5 146.4 63.4 191.5 155.5 176.2 182.8 166.5 112.3 61.5 199.6 189.6 158.3 187.5 173.0 143.6 63.6 Lungs 214.0 194.4 176.4 187.1 150.6 132.0 54.4 218.3 202.2 163.5 209.3 165.3 115.2 54.5 220.4 192.7 172.4 163.7 141.9 169.5 81.1 215.4 185.8 180.7 196.1 180.4 133.2 53.2 214.8 198.5 191.7 179.0 145.7 156.4 77.6 Brain 137.0 126.7 95.4 73.2 50.6 36.1 0 153.9 151.5 79.9 78.5 48.7 37.9 0 196.2 138.1 96.9 60.0 47.9 35.6 0 172.2 136.8 53.8 76.5 55.2 33.7 0 175.6 135.4 84.8 81.0 74.3 33.3 0 Spleen 146.1 158.7 134.3 158.3 133.6 102.2 39.9 154.8 162.3 144.2 167.2 160.9 101.4 40.6 168.9 161.1 135.4 143.8 152.7 150.1 50.7 147.9 151.4 144.6 140.0 134.0 92.5 50.8 155.5 155.5 126.2 145.2 159.3 135.3 58.1 Pancreas 169.1 163.4 121.6 101.6 70.7 72.6 46.5 176.4 96.2 80.2 62.0 49.6 38.4 186.6 140.5 41.3 96.3 87.1 121.2 34.2 129.0 119.1 111.3 77.4 96.3 49.5 35.4 104.9 107.9 74.8 104.7 95.1 58.6 0 Bone 73.8 67.3 40.3 90.1 58.7 76.7 43.1 73.1 92.8 62.5 35.6 73.6 73.4 45.4 88.8 77.0 48.3 55.3 61.2 58.3 42.3 73.4 75.5 96.1 57.5 49.2 64.5 50.2 87.8 57.5 40.4 76.9 90.8 58.2 32.8 Stomach 72.8 125.1 49.9 98.5 126.8 103.5 42.2 82.5 81.7 91.1 107.6 129.7 86.3 48.3 104.2 71.8 79.9 109.5 141.6 161.0 71.0 99.6 98.0 98.4 116.4 119.8 92.1 62.2 99.3 118.8 84.3 110.3 116.1 143.6 72.0 Small 62.2 78.3 64.3 83.5 40.4 77.6 34.3 intestine 45.5 97.2 57.8 54.9 58.8 107.8 43.8 38.4 68.8 31.5 42.1 44.2 78.6 35.8 33.0 62.1 45.4 73.1 68.2 80.9 41.6 33.0 53.0 36.3 70.8 59.5 74.2 33.2 Large 42.4 49.1 0 0 32.3 37.1 0 intestine 35.4 32.5 32.2 39.4 33.4 42.6 0 30.0 33.3 0 0 30.0 37.8 0 47.8 27.0 0 0 39.8 36.6 0 29.8 0 0 0 0 45.2 0 Skin 40.6 32.0 40.9 66.9 34.5 91.1 0 1.0 39.4 43.4 51.0 66.1 60.5 31.9 38.0 54.1 0 38.5 56.3 82.5 0 33.4 38.2 36.8 39.6 37.3 50.7 57.0 27.6 32.1 39.0 45.1 41.2 98.9 36.4 Muscle 36.5 0 0 36.2 0 0 0 1.0 40.8 0 0 0 0 0 1.0 0 0 41.7 0 0 42.9 38.6 0 0 0 0 0 0 35.9 0 0 53.0 0 0 0
TABLE-US-00037 TABLE 17b Mean (and St. D.) of fluorescence intensity values presented in Table 17a. Time p.i. 5 min 1 hour 2 hours 4 hours 6 hours 16 hours 26 hours Tumor 36.2 6.0 100.5 38.5 133.9 14.2 211.2 15.7 198.6 33.0 222.8 11.0 182.6 14.7 Liver 419.8 37.9 533.0 16.7 542.6 26.8 540.1 18.8 527.1 44.4 400.5 34.1 213.1 9.7 Kidneys 171.7 18.4 193.7 10.6 156.0 14.1 185.5 6.2 174.0 5.0 170.6 12.8 111.8 7.9 Heart 198.1 15.9 179.6 16.4 167.6 12.2 185.6 7.2 163.0 8.2 129.2 15.7 61.3 6.6 Lungs 216.6 2.7 194.7 6.2 177.0 10.4 187.0 17.2 156.8 15.9 141.3 21.5 64.2 13.9 Brain 167.0 22.5 137.7 8.9 82.2 17.4 73.8 8.3 55.3 11.0 35.3 1.8 0.0 0.0 Spleen 154.6 9.0 157.8 4.4 136.9 7.7 150.9 11.4 148.1 13.4 116.3 25.0 48.0 7.7 Pancreas 153.2 34.7 132.7 24.5 89.0 32.0 92.0 2.5 82.2 15.3 70.3 30.0 30.9 17.9 Bone 79.4 8.1 74.0 13.1 57.5 23.4 63.1 21.0 66.7 16.0 66.2 8.5 42.8 6.4 Stomach 91.7 13.4 99.1 23.0 80.7 18.6 108.4 6.5 126.8 9.9 117.3 33.1 59.1 13.4 S. Intest. 42.4 12.2 71.9 16.9 47.1 13.9 64.9 16.3 54.2 11.6 83.8 13.6 37.8 4.7 L. Intest. 37.1 7.9 28.4 17.9 6.4 14.4 7.9 17.6 27.1 15.6 40.5 4.0 0.0 0.0 Skin 27.9 16.4 39.1 9.0 32.0 18.1 48.2 11.6 47.1 13.6 76.7 20.4 25.1 24.8 Muscle 22.2 20.3 8.2 18.2 0.0 0.0 26.2 24.6 0.0 0.0 0.0 0.0 8.6 19.2
[0803] The blood clearance, biodistribution and kinetics of signal changes in tissue and organs at different time points after single tail vein administration of ICG-pHLIP are shown in
[0804] The fluorescence signals in organs and tissue were also measured in the tissue/organ homogenates and compared with the signals from the control tissue/organ homogenates (collected from control mice) mixed with known amounts of ICG-pHLIP. About 100 mg of tissue (tumor, liver or kidney) were homogenized with 2.5 (about 250 L) volumes of DMSO using BioMasher II disposable homogenizers (DiagnoCine LLC). 30 l of homogenate was placed into 384 well plate and imaged using an Odyssey IR scanner. Tumor, liver or kidney homogenates of control mice, mixed with known concentrations of ICG-pHLIP were used to establish the calibration curve. First, note that the fluorescence signals obtained on the control tumor, liver and kidney mixed with the known amounts of ICG-pHLIP were the same. Second, the course of signal changes in tumor, liver and kidney (data not shown) was in excellent correlation with the course of the kinetics presented on
Targeting Tumors in Different Mouse Tumor Models
[0805] Targeting of murine and human tumors was shown in six different tumor models in athymic female nude mice (strain Hsd Athymic Nude-Foxn1nu) ranging in age from 5 to 6 weeks (obtained from Envigo RMS Inc). The following tumors were established by subcutaneous injection of 110.sup.6 cells/0.1 ml/flank in both flanks of athymic nude mice: HeLa (cervical adenocarcinoma), M4A4 (breast ductal carcinoma), A549 (lung carcinoma), UM-UC3 (urinary bladder cancer), 4T1 (murine breast tumor). Human MDA-MB-231 (breast adenocarcinoma) tumors were established by injections of 110.sup.6 cells/0.05 ml in the mammary fat pad. Tumors reached different sizes (from very small to large) and 100 l of tail vein injections of 2.5 nmol (0.5 mg/kg) of ICG-pHLIP in sterile PBS containing either 5% of DMSO or 5% of Ethanol were performed. Imaging was carried out at 24 hours after construct administration using the Stryker 1588 AIM imaging system. White light and NIRF whole-body imaging was performed while the animal was under gas (isoflurane) anesthesia (
[0806] A resected tumor and tumor bed are shown in
[0807] Animals were euthanized immediately after whole-body imaging, and the tumor with surrounding muscle was collected and imaged (
[0808] Excised tumors with surrounding muscle are shown in
[0809] An excellent correlation between ICG-pHLIP NIRF imaging and H&E histopathology indicating tumor location are shown in
Other Embodiments
[0810] While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
[0811] The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. Genbank and NCBI submissions indicated by accession number cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.
[0812] While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.