Alpha-Hemolysin Variants and Uses Thereof
20190367975 ยท 2019-12-05
Assignee
Inventors
- Timothy K. CRAIG (CAMPBELL, CA, US)
- Mark R. AMBROSO (SAN JOSE, CA, US)
- Corissa J. HARRIS (SANTA CLARA, CA, US)
- Matthew M. DIPIETRO (GILROY, CA, US)
- Yaozhong Zou (Sunnyvale, CA)
- Marshall W. PORTER (Santa Clara, CA, US)
Cpc classification
G01N33/48721
PHYSICS
International classification
Abstract
Described herein are variants of alpha-hemolysin having at least one mutation, such as a mutation to a positive charge. In certain examples, the mutation is selected from V149K, E287R, H35G, T109K, P151K, K147N, E111N, M113A, or combinations thereof in the mature, wild-type alpha-hemolysin amino acid sequence. The -hemolysin variants may also include a substitution at H144A and/or a series of glycine residues spanning residues 127 to 131 of the mature, wild-type alpha hemolysin. Also provided are nanopore assemblies including the alpha-hemolysin variants, the assembly having a decreased time-to-thread. The decreased time-to-thread, for example, increases DNA sequencing efficiency and accuracy.
Claims
1. An isolated polypeptide comprising an amino acid sequence having at least 90% sequence identity to one or more SEQ ID NO: 5-14, wherein said amino acid sequence has a set of substitutions relative to SEQ ID NO: 14 comprising a combination selected from the group consisting of: (a) H35G+V149K; (b) V149K+E287R+H35G; (c) V149K+E287R; (d) T109K+H35G; (e) P151K+H35G; (f) V149K+P151K+H35G; (g) T109K+V149K+H35G; (h) V149K+K147N+E111N+D127G+D128G+T129G+K131G+M113A+H35G; (i) V149K+K147N+E111N+D127G+D128G+T129G+K131G+M113A; and (j) T109K+V149K+P151K+H35G.
2. The isolated polypeptide of claim 1, wherein said set of substitutions consists of substitutions corresponding to positions of SEQ ID NO: 14 selected from the group consisting of 1-6, 8-11, 13-22, 24-33, 35-37, 40, 44-51, 56, 62, 64-75, 79, 82, 83, 85, 87, 89-95, 97, 102-118, 120-132, 134-156, 158-164, 168, 170-191, 193, 194, 197-205, 207, 208, 210-216, 218, 221, 222, 224-229, 235-241, 244, 246, 250, 252, 253, 255, 257, 259-264, 266, 268-278, 280-283, 285-289, and 291-293.
3. The isolated polypeptide of claim 1, wherein said set of substitutions further comprises an H144A substitution.
4. The isolated polypeptide of claim 1, wherein said set of substitutions further comprises an alanine, asparagine, or lysine substitution at one or more of residues 1-17 of SEQ ID NO: 14.
5. The isolated polypeptide of claim 1, wherein said amino acid sequence comprises a series of glycine residues at positions corresponding to each of residues 127-131 of SEQ ID NO: 14.
6. The isolated polypeptide of claim 1, wherein the amino acid sequence comprises SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, or SEQ ID NO: 13.
7. The isolated polypeptide of claim 1, wherein the amino acid sequence consists of SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, or SEQ ID NO: 13.
8. The isolated polypeptide of claim 1, wherein the at least 90% sequence identity to SEQ ID NO: 4 is a sequence identity according to CLUSTAL-W program in MacVector version 13.0.7, operated with an open gap penalty of 10.0, an extended gap penalty of 0.1, and a BLOSUM 30 similarity matrix.
9. The isolated polypeptide of claim 1, further comprising a purification tag.
10. The isolated polypeptide of claim 1, further comprising a polymerase attached thereto.
11. The isolated polypeptide of claim 10, wherein the polymerase is a DNA polymerase.
12. The isolated polypeptide of claim 10, wherein the DNA polymerase is covalently attached to the isolated polypeptide.
13. A heptameric nanopore assembly comprising 7 alpha-hemolysin subunits arranged in a nanopore, wherein at least one of the seven alpha-hemolysin subunits comprises the isolated polypeptide of claim 1 and a DNA polymerase covalently attached to one of the seven alpha-hemolysin subunits.
14. The heptameric nanopore assembly of claim 13, wherein the nanopore is a heteromeric pore.
15. The heptameric nanopore assembly of claim 13, wherein the nanopore is a homomeric pore.
16. The heptameric nanopore assembly of claim 13, wherein the nanopore has a decreased time to thread (TTT) relative to a heptameric nanopore assembly consisting of native alpha-hemolysins.
17. The heptameric nanopore assembly of claim 13, wherein the nanopore has at least a 10% decreased TTT relative to the heptameric nanopore assembly including native alpha-hemolysins.
18. The heptameric nanopore assembly of claim 13, wherein the nanopore has at least a 50% decreased TTT relative to the heptameric nanopore assembly including native alpha-hemolysins.
19. The heptameric nanopore assembly of claim 13, wherein the nanopore has at least a 80% decreased TTT relative to the heptameric nanopore assembly including native alpha-hemolysins.
20. A system for sequencing a nucleic acid comprising: a heptameric nanopore assembly according to claim 13; a chip comprising a plurality of sensing electrodes and a membrane that is disposed adjacent or in proximity to one or more of the sensing electrodes; and a set of negatively charged tagged nucleotides.
21. A method for sequencing a target nucleic acid sequence, comprising: providing a chip, the chip comprising a plurality of sensing electrodes and a membrane that is disposed adjacent or in proximity to the sensing electrodes; disposing, within the membrane, a heptameric nanopore assembly of claim 13; contacting the chip with a target nucleic acid sequence and a plurality of negatively charged tagged nucleotides; applying a voltage across the membrane; determining, by one or more of the sensing electrodes, one or more current changes associated with the heptameric nanopore assembly; and determining, with the aid of a computer processor and based on the one or more of the determined current changes associated with the heptameric nanopore assembly, a sequence for the target nucleic acid sequence.
22. The method of claim 21, wherein the chip comprises a well and wherein the nanopore assembly is disposed within the membrane over the well.
23. The method of claim 21, wherein the nucleic acid comprises a tag.
24. The method of claim 23, wherein the tag is a negatively charged tag.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0021]
[0022]
DETAILED DESCRIPTION
[0023] The invention will now be described in detail by way of reference only using the following definitions and examples. All patents and publications, including all sequences disclosed within such patents and publications, referred to herein are expressly incorporated by reference.
[0024] Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Singleton, et al., D
[0025] Numeric ranges are inclusive of the numbers defining the range. The term about is used herein to mean plus or minus ten percent (10%) of a value. For example, about 100 refers to any number between 90 and 110.
[0026] Unless otherwise indicated, nucleic acids are written left to right in 5 to 3 orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
[0027] The headings provided herein are not limitations of the various aspects or embodiments of the invention, which can be had by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification as a whole.
Definitions
[0028] Alpha-hemolysin: As used herein, alpha-hemolysin, -hemolysin, a-HL and -HL are used interchangeably and refer to the monomeric protein that self-assembles into a heptameric water-filled transmembrane channel (i.e., nanopore). Depending on context, the term may also refer to the transmembrane channel formed by seven monomeric proteins.
[0029] Amino acid: As used herein, the term amino acid, in its broadest sense, refers to any compound and/or substance that can be incorporated into a polypeptide chain. In some embodiments, an amino acid has the general structure H.sub.2NC(H)(R)COOH. In some embodiments, an amino acid is a naturally-occurring amino acid. In some embodiments, an amino acid is a synthetic amino acid; in some embodiments, an amino acid is a D-amino acid; in some embodiments, an amino acid is an L-amino acid. Standard amino acid refers to any of the twenty standard L-amino acids commonly found in naturally occurring peptides. Nonstandard amino acid refers to any amino acid, other than the standard amino acids, regardless of whether it is prepared synthetically or obtained from a natural source. As used herein, synthetic amino acid or non-natural amino acid encompasses chemically modified amino acids, including but not limited to salts, amino acid derivatives (such as amides), and/or substitutions. Amino acids, including carboxy- and/or amino-terminal amino acids in peptides, can be modified by methylation, amidation, acetylation, and/or substitution with other chemical without adversely affecting their activity. Amino acids may participate in a disulfide bond. The term amino acid is used interchangeably with amino acid residue, and may refer to a free amino acid and/or to an amino acid residue of a peptide. It will be apparent from the context in which the term is used whether it refers to a free amino acid or a residue of a peptide. It should be noted that all amino acid residue sequences are represented herein by formulae whose left and right orientation is in the conventional direction of amino-terminus to carboxy-terminus.
[0030] Base Pair (bp): As used herein, base pair refers to a partnership of adenine (A) with thymine (T), adenine (A) with uracil (U) or of cytosine (C) with guanine (G) in a double stranded nucleic acid.
[0031] Complementary: As used herein, the term complementary refers to the broad concept of sequence complementarity between regions of two polynucleotide strands or between two nucleotides through base-pairing. It is known that an adenine nucleotide is capable of forming specific hydrogen bonds (base pairing) with a nucleotide which is thymine or uracil. Similarly, it is known that a cytosine nucleotide is capable of base pairing with a guanine nucleotide.
[0032] Expression cassette: An expression cassette or expression vector is a nucleic acid construct generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell. The recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment. Typically, the recombinant expression cassette portion of an expression vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter.
[0033] Heterologous: A heterologous nucleic acid construct or sequence has a portion of the sequence which is not native to the cell in which it is expressed. Heterologous, with respect to a control sequence refers to a control sequence (i.e. promoter or enhancer) that does not function in nature to regulate the same gene the expression of which it is currently regulating. Generally, heterologous nucleic acid sequences are not endogenous to the cell or part of the genome in which they are present, and have been added to the cell, by infection, transfection, transformation, microinjection, electroporation, or the like. A heterologous nucleic acid construct may contain a control sequence/DNA coding sequence combination that is the same as, or different from a control sequence/DNA coding sequence combination found in the native cell.
[0034] Host cell: By the term host cell is meant a cell that contains a vector and supports the replication, and/or transcription or transcription and translation (expression) of the expression construct. Host cells for use in the present invention can be prokaryotic cells, such as E. coli or Bacillus subtilus, or eukaryotic cells such as yeast, plant, insect, amphibian, or mammalian cells. In general, host cells are prokaryotic, e.g., E. coli.
[0035] Isolated: An isolated molecule is a nucleic acid molecule that is separated from at least one other molecule with which it is ordinarily associated, for example, in its natural environment. An isolated nucleic acid molecule includes a nucleic acid molecule contained in cells that ordinarily express the nucleic acid molecule, but the nucleic acid molecule is present extrachromasomally or at a chromosomal location that is different from its natural chromosomal location.
[0036] Modified alpha-hemolysin: As used herein, the term modified alpha-hemolysin refers to an alpha-hemolysin originated from another (i.e., parental) alpha-hemolysin and contains one or more amino acid alterations (e.g., amino acid substitution, deletion, or insertion) compared to the parental alpha-hemolysin. In some embodiments, a modified alpha-hemolysin of the invention is originated or modified from a naturally-occurring or wild-type alpha-hemolysin. In some embodiments, a modified alpha-hemolysin of the invention is originated or modified from a recombinant or engineered alpha-hemolysin including, but not limited to, chimeric alpha-hemolysin, fusion alpha-hemolysin or another modified alpha-hemolysin. Typically, a modified alpha-hemolysin has at least one changed phenotype compared to the parental alpha-hemolysin.
[0037] Mutation: As used herein, the term mutation refers to a change introduced into a parental sequence, including, but not limited to, substitutions, insertions, deletions (including truncations). The consequences of a mutation include, but are not limited to, the creation of a new character, property, function, phenotype or trait not found in the protein encoded by the parental sequence.
[0038] Nanopore: The term nanopore, as used herein, generally refers to a pore, channel or passage formed or otherwise provided in a membrane. A membrane may be an organic membrane, such as a lipid bilayer, or a synthetic membrane, such as a membrane formed of a polymeric material. The membrane may be a polymeric material. The nanopore may be disposed adjacent or in proximity to a sensing circuit or an electrode coupled to a sensing circuit, such as, for example, a complementary metal-oxide semiconductor (CMOS) or field effect transistor (FET) circuit. In some examples, a nanopore has a characteristic width or diameter on the order of 0.1 nanometers (nm) to about 1000 nm. Some nanopores are proteins. Alpha-hemolysin is an example of a protein nanopore.
[0039] Nucleic Acid Molecule: The term nucleic acid molecule includes RNA, DNA and cDNA molecules. It will be understood that, as a result of the degeneracy of the genetic code, a multitude of nucleotide sequences encoding a given protein such as alpha-hemolysin and/or variants thereof may be produced. The present invention contemplates every possible variant nucleotide sequence, encoding variant alpha-hemolysin, all of which are possible given the degeneracy of the genetic code.
[0040] Promoter: As used herein, the term promoter refers to a nucleic acid sequence that functions to direct transcription of a downstream gene. The promoter will generally be appropriate to the host cell in which the target gene is being expressed. The promoter together with other transcriptional and translational regulatory nucleic acid sequences (also termed control sequences) are necessary to express a given gene. In general, the transcriptional and translational regulatory sequences include, but are not limited to, promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences.
[0041] Purified: As used herein, purified means that a molecule is present in a sample at a concentration of at least 95% by weight, or at least 98% by weight of the sample in which it is contained.
[0042] Purifying: As used herein, the term purifying generally refers to subjecting transgenic nucleic acid or protein containing cells to biochemical purification and/or column chromatography.
[0043] Tag: As used herein, the term tag refers to a detectable moiety that may be atoms or molecules, or a collection of atoms or molecules. A tag may provide an optical, electrochemical, magnetic, or electrostatic (e.g., inductive, capacitive) signature, which signature may be detected with the aid of a nanopore. Typically, when a nucleotide is attached to the tag it is called a Tagged Nucleotide. The tag may be attached to the nucleotide via the phosphate moiety.
[0044] Time-To-Thread: The term time to thread or TTT means the time it takes the polymerase-tag complex or a nucleic acid strand to thread the tag into the barrel of the nanopore.
[0045] Variant: As used herein, the term variant refers to a modified protein which displays altered characteristics when compared to the parental protein, e.g., altered ionic conductance.
[0046] Variant hemolysin: The term variant hemolysin gene or variant hemolysin means, respectively, that the nucleic acid sequence of the alpha-hemolysin gene from Staphylococcus aureus has been altered by removing, adding, and/or manipulating the coding sequence or the amino acid sequence of the expressed protein has been modified consistent with the invention described herein.
[0047] Vector: As used herein, the term vector refers to a nucleic acid construct designed for transfer between different host cells. An expression vector refers to a vector that has the ability to incorporate and express heterologous DNA fragments in a foreign cell. Many prokaryotic and eukaryotic expression vectors are commercially available. Selection of appropriate expression vectors is within the knowledge of those having skill in the art.
[0048] Wild-type: As used herein, the term wild-type refers to a gene or gene product which has the characteristics of that gene or gene product when isolated from a naturally-occurring source.
[0049] Percent homology: The term % homology is used interchangeably herein with the term % identity herein and refers to the level of nucleic acid or amino acid sequence identity between the nucleic acid sequence that encodes any one of the inventive polypeptides or the inventive polypeptide's amino acid sequence, when aligned using a sequence alignment program. For example, as used herein, 80% homology means the same thing as 80% sequence identity determined by a defined algorithm, and accordingly a homologue of a given sequence has greater than 80% sequence identity over a length of the given sequence. Exemplary levels of sequence identity include, but are not limited to, 80, 85, 90, 95, 98% or more sequence identity to a given sequence, e.g., the coding sequence for any one of the inventive polypeptides, as described herein.
[0050] Exemplary computer programs which can be used to determine identity between two sequences include, but are not limited to, the suite of BLAST programs, e.g., BLASTN, BLASTX, and TBLASTX, BLASTP and TBLASTN, publicly available on the Internet. See also, Altschul, et al., 1990 and Altschul, et al., 1997.
[0051] Sequence searches are typically carried out using the BLASTN program when evaluating a given nucleic acid sequence relative to nucleic acid sequences in the GenBank DNA Sequences and other public databases. The BLASTX program is preferred for searching nucleic acid sequences that have been translated in all reading frames against amino acid sequences in the GenBank Protein Sequences and other public databases. Both BLASTN and BLASTX are run using default parameters of an open gap penalty of 11.0, and an extended gap penalty of 1.0, and utilize the BLOSUM-62 matrix. (See, e.g., Altschul, S. F., et al., Nucleic Acids Res. 25:3389-3402, 1997.)
[0052] A preferred alignment of selected sequences in order to determine % identity between two or more sequences, is performed using for example, the CLUSTAL-W program in MacVector version 13.0.7, operated with default parameters, including an open gap penalty of 10.0, an extended gap penalty of 0.1, and a BLOSUM 30 similarity matrix.
Nomenclature
[0053] In the present description and claims, the conventional one-letter and three-letter codes for amino acid residues are used.
[0054] For ease of reference, variants of the application are described by use of the following nomenclature: Original amino acid(s); position(s); substituted amino acid(s). According to this nomenclature, for instance, the substitution of a valine by a lysine in position 149 is shown as: [0055] Val149Lys or V149K
[0056] Multiple mutations are separated by plus signs, such as: [0057] His35Gly+Val149Lys or H35G+V149K
representing mutations in positions 35 and 149 substituting glycine for histidine and lysine for valine, respectively. Spans of amino acid substitutions are represented by a dash, such as a span of glycine residues from residue 127 to 131 being: 127-131Gly or 127-133G.
Site-Directed Mutagenesis of Alpha-Hemolysin
[0058] Staphylococcus aureus alpha hemolysin wild type sequences are provided herein (SEQ ID NO:1, nucleic acid coding region; SEQ ID NO:14, protein coding region) and available elsewhere (National Center for Bioinformatics or GenBank Accession Numbers M90536 and AAA26598).
[0059] Point mutations may be introduced by any method known in the art. For example, a point mutation may be made using QuikChange Lightning 2 kit (Stategene/Agilent) following manufacturer's instructions.
[0060] Primers can be ordered from commercial companies, e.g., IDT DNA.
Alpha-Hemolysin Variants
[0061] The alpha-hemolysin variants provided herein include specific substitutions, or one or more combination of substitutions, that improve the time-to-thread in a nanopore-based, sequencing reaction. By improving the time-to-thread, high accuracy DNA sequencing can be achieved with fewer deletions in the determined sequence.
[0062] In certain example embodiments, the alpha-hemolysin variant provided herein includes one or more mutations at one or more of the locations of the amino acid sequence set forth as SEQ ID NO: 14. For example, any one of the residues identified in Table 1, or combinations thereof, may be mutated to form an alpha-hemolysin variant. In certain example embodiments, the alpha-hemolysin variant formed from muting one or more of the amino acids of SEQ ID NO:14 identified in Table 1 has 80%, 85%, 90%, 95%, 98% or more sequence identity to the sequence set forth as SEQ ID NO: 14. In certain example embodiments, the mutation results in the addition of a positive charge. For example, the mutation may result in a substitution of an amino acid residue identified in Table 1 to an arginine, lysine, histidine, asparagine, or other amino acid that can carry a positive charge.
[0063] In certain example embodiments, the mutation includes a particular substitution. For example, the variant may include an amino acid substitution of any one of V149K, E287R, H35G, T109K, P151K, K147N, E111N, M113A, or combinations thereof of SEQ ID NO: 14. In other example embodiments, the variant may include one or more these same substitutions, while the overall sequence can have up to 80%, 85%, 90%, 95%, 98% or more sequence identity to the amino acid sequence set forth as SEQ ID NO: 14. In certain example embodiments, one or more of the first 17 amino acids of SEQ ID NO: 14 mutated to either an A, N, K, or combinations thereof.
[0064] To improve nanopore stability, for example, any of the alpha-hemolysin variants described herein may also include an amino acid substitution at H144A of SEQ ID NO: 14. Additionally or alternatively, any of the variants may include a series of glycine residue substitutions spanning from residue 127 to residue 131 of the sequence set forth as SEQ ID NO: 14.
TABLE-US-00001 TABLE 1 Residues of mature alpha-hemolysin that can be mutated to form alpha-hemolysin variant. Position* Residue 1 ALA 2 ASP 3 SER 4 ASP 5 ILE 6 ASN 8 LYS 9 THR 10 GLY 11 THR 13 ASP 14 ILE 15 GLY 16 SER 17 ASN 18 THR 19 THR 20 VAL 21 LYS 22 THR 24 ASP 25 LEU 26 VAL 27 THR 28 TYR 29 ASP 30 LYS 31 GLU 32 ASN 33 GLY 35 HIS 36 LYS 37 LYS 40 TYR 44 ASP 45 ASP 46 LYS 47 ASN 48 HIS 49 ASN 50 LYS 51 LYS 56 ARG 62 ALA 64 GLN 65 TYR 66 ARG 67 VAL 68 TYR 69 SER 70 GLU 71 GLU 72 GLY 73 ALA 74 ASN 75 LYS 79 ALA 82 SER 83 ALA 85 LYS 87 GLN 89 GLN 90 LEU 91 PRO 92 ASP 93 ASN 94 GLU 95 VAL 97 GLN 102 TYR 103 PRO 104 ARG 105 ASN 106 SER 107 ILE 108 ASP 109 THR 110 LYS 111 GLU 112 TYR 113 MET 114 SER 115 THR 116 LEU 117 THR 118 TYR 120 PHE 121 ASN 122 GLY 123 ASN 124 VAL 125 THR 126 GLY 127 ASP 128 ASP 129 THR 130 GLY 131 LYS 132 ILE 134 GLY 135 LEU 136 ILE 137 GLY 138 ALA 139 ASN 140 VAL 141 SER 142 ILE 143 GLY 144 HIS 145 THR 146 LEU 147 LYS 148 TYR 149 VAL 150 GLN 151 PRO 152 ASP 153 PHE 154 LYS 155 THR 156 ILE 158 GLU 159 SER 160 PRO 161 THR 162 ASP 163 LYS 164 LYS 168 LYS 170 ILE 171 PHE 172 ASN 173 ASN 174 MET 175 VAL 176 ASN 177 GLN 178 ASN 179 TRP 180 GLY 181 PRO 182 TYR 183 ASP 184 ARG 185 ASP 186 SER 187 TRP 188 ASN 189 PRO 190 VAL 191 TYR 193 ASN 194 GLN 197 MET 198 LYS 199 THR 200 ARG 201 ASN 202 GLY 203 SER 204 MET 205 LYS 207 ALA 208 ASP 210 PHE 211 LEU 212 ASP 213 PRO 214 ASN 215 LYS 216 ALA 218 SER 221 SER 222 SER 224 PHE 225 SER 226 PRO 227 ASP 228 PHE 229 ALA 235 ASP 236 ARG 237 LYS 238 ALA 239 SER 240 LYS 241 GLN 244 ASN 246 ASP 250 GLU 252 VAL 253 ARG 255 ASP 257 GLN 259 HIS 260 TRP 261 THR 262 SER 263 THR 264 ASN 266 LYS 268 THR 269 ASN 270 THR 271 LYS 272 ASP 273 LYS 274 TRP 275 THR 276 ASP 277 ARG 278 SER 280 GLU 281 ARG 282 TYR 283 LYS 285 ASP 286 TRP 287 GLU 288 LYS 289 GLU 291 MET 292 THR 293 ASN *Position corresponds to the specific amino acid position in SEQ ID NO: 14.
[0065] While the -hemolysin variant can include various combinations of substitutions as described herein, in certain example embodiments the -hemolysin variant includes particular combinations of substitutions. For example, an -hemolysin variant may include the following combinations of amino acid substitutions of the sequence set forth as SEQ ID NO: 14: [0066] H35G+V149K; [0067] V149K+E287R+H35G; [0068] V149K+E287R; [0069] T109K+H35G; [0070] P151K+H35G; [0071] V149K+P151K+H35G; [0072] T109K+V149K+H35G; [0073] V149K+K147N+E111N+127-131G+M113A+H35G; [0074] V149K+K147N+E111N+127-131G+M113A; or, [0075] T109K+V149K+P151K+H35G.
Such combinations may also include, for example, a substitution at H144A of SEQ ID NO: 14 and/or a series of glycine residues at amino acids 127-131 of SEQ ID NO: 14. In certain example embodiments, the -hemolysin variant includes an amino acid sequence having at least 80%, 90%, 95%, 98%, or more sequence identity to the amino acid sequence set forth as SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, or SEQ ID NO: 13, with the substitution(s) identified in each sequence, for example, being preserved in the variant.
[0076] So that the variants and WT alpha-hemolysin can be manipulated, in certain example embodiments any of the amino acid sequences described herein, such as those set forth as SEQ ID NO: 4-14, may also include a linker/TEV/HisTAG sequence at the C-terminal end having the sequence GLSAENLYFQGHHHHHH (SEQ ID NO: 16, where the TEV sequence is underlined). As those skilled in the art will appreciate, such a sequence allows for the purification of the variant.
Nanopore Assembly and Insertion
[0077] The methods described herein can use a nanopore having a polymerase attached to the nanopore. In certain example embodiments, it is desirable to have one and only one polymerase per nanopore (e.g., so that only one nucleic acid molecule is sequenced at each nanopore). However, many nanopores, including alpha-hemolysin (aHL), can be multimeric proteins having a plurality of subunits (e.g., 7 subunits for aHL). The subunits can be identical copies of the same polypeptide. Provided herein are multimeric proteins (e.g., nanopores) having a defined ratio of modified subunits (e.g., a-HL variants) to un-modified subunits (e.g., a-HL).
[0078] Also provided herein are methods for producing multimeric proteins (e.g., nanopores or nanopore assemblies) having a defined ratio of modified subunits to un-modified subunits. For example, the nanopore assembly may include any of the alpha-hemolysin variants described herein. A heptameric nanopore assembly, for example, may include one or more alpha-hemolysin subunits having an amino acidic sequence corresponding to a substitution of any one of V149K, E287R, H35G, T109K, P151K, K147N, E111N, M113A, or combinations thereof of SEQ ID NO: 14. In certain example embodiments, one or more of the subunits may include a specific combination of substitutions as described herein. Any of the variants used in the nanopore assembly, such as in a heptameric assembly, may also include an H144A substitution of SEQ ID NO: 14.
[0079] With reference to FIG. 27 of WO2014/074727, a method for assembling a protein having a plurality of subunits includes providing a plurality of first subunits 2705 and providing a plurality of second subunits 2710, where the second subunits are modified when compared with the first subunits. In some cases, the first subunits are wild-type (e.g., purified from native sources or produced recombinantly). The second subunits can be modified in any suitable way. In some cases, the second subunits have a protein (e.g., a polymerase) attached (e.g., as a fusion protein).
[0080] In certain example embodiments, the modified subunits can comprise a chemically reactive moiety (e.g., an azide or an alkyne group suitable for forming a linkage). In some cases, the method further comprises performing a reaction (e.g., a Click chemistry cycloaddition) to attach an entity (e.g., a polymerase) to the chemically reactive moiety.
[0081] In certain example embodiments, the method can further include contacting the first subunits with the second subunits 2715 in a first ratio to form a plurality of proteins 2720 having the first subunits and the second subunits. For example, one part modified aHL subunits having a reactive group suitable for attaching a polymerase can be mixed with six parts wild-type aHL subunits (i.e., with the first ratio being 1:6). The plurality of proteins can have a plurality of ratios of the first subunits to the second subunits. For example, the mixed subunits can form several nanopores having a distribution of stoichiometries of modified to un-modified subunits (e.g., 1:6, 2:5, 3:4).
[0082] In certain example embodiments, the proteins are formed by simply mixing the subunits. In the case of aHL nanopores for example, a detergent (e.g., deoxycholic acid) can trigger the aHL monomer to adopt the pore conformation. The nanopores can also be formed, for example, using a lipid (e.g., 1,2-diphytanoyl-sn-glycero-3-phosphocholine (DPh PC) or 1,2-di-0-phytanyl-sn-glycero-3-phosphocholine (DoPhPC)) and moderate temperature (e.g., less than about 100 C.). In some cases, mixing DPhPC with a buffer solution creates large multi-lamellar vesicles (LMV), and adding aHL subunits to this solution and incubating the mixture at 40 C. for 30 minutes results in pore formation.
[0083] If two different types of subunits are used (e.g., the natural wild type protein and a second aHL monomer which can contain a single point mutation), the resulting proteins can have a mixed stoichiometry (e.g., of the wild type and mutant proteins). The stoichiometry of these proteins can, in certain example embodiments, follow a formula which is dependent upon the ratio of the concentrations of the two proteins used in the pore forming reaction. This formula is as follows:
100 P.sub.m=100[n!/m!(nm)!].Math.f.sub.mut.sup.m.Math.f.sub.wt.sup.nm, where
[0084] P.sub.m=probability of a pore having m number of mutant subunits
[0085] n=total number of subunits (e.g., 7 for aHL)
[0086] m=number of mutant subunits
[0087] f.sub.mut=fraction or ratio of mutant subunits mixed together
[0088] f.sub.wt=fraction or ratio of wild-type subunits mixed together
[0089] The method can further comprise fractionating the plurality of proteins to enrich proteins that have a second ratio of the first subunits to the second subunits 2725. For example, nanopore proteins can be isolated that have one and only one modified subunit (e.g., a second ratio of 1:6). However, any second ratio is suitable. A distribution of second ratios can also be fractionated such as enriching proteins that have either one or two modified subunits. The total number of subunits forming the protein is not always 7 (e.g., a different nanopore can be used or an alpha-hemolysin nanopore can form having six subunits) as depicted in FIG. 27 of WO2014/074727. In some cases, proteins having only one modified subunit are enriched. In such cases, the second ratio is 1 second subunit per (n1) first subunits where n is the number of subunits comprising the protein.
[0090] The first ratio can be the same as the second ratio, however this is not required. In some cases, proteins having mutated monomers can form less efficiently than those not having mutated subunits. If this is the case, the first ratio can be greater than the second ratio (e.g., if a second ratio of 1 mutated to 6 non-mutated subunits are desired in a nanopore, forming a suitable number of 1:6 proteins may require mixing the subunits at a ratio greater than 1:6).
[0091] Proteins having different second ratios of subunits can behave differently (e.g., have different retention times) in a separation. In certain example embodiments, the proteins are fractionated using chromatography, such as ion exchange chromatography or affinity chromatography. Since the first and second subunits can be identical apart from the modification, the number of modifications on the protein can serve as a basis for separation. In some cases, either the first or second subunits have a purification tag (e.g., in addition to the modification) to allow or improve the efficiency of the fractionation. In some cases, a poly-histidine tag (His-tag), a streptavidin tag (Strep-tag), or other peptide tag is used. In some instances, the first and second subunits each comprise different tags and the fractionation step fractionates on the basis of each tag. In the case of a His-tag, a charge is created on the tag at low pH (Histidine residues become positively charged below the pKa of the side chain). With a significant difference in charge on one of the aHL molecules compared to the others, ion exchange chromatography can be used to separate the oligomers which have 0, 1, 2, 3, 4, 5, 6, or 7 of the charge-tagged aHL subunits. In principle, this charge tag can be a string of any amino acids which carry a uniform charge. FIG. 28 and FIG. 29 show examples of fractionation of nanopores based on a His-tag. FIG. 28 shows a plot of ultraviolet absorbance at 280 nanometers, ultraviolet absorbance at 260 nanometers, and conductivity. The peaks correspond to nanopores with various ratios of modified and unmodified subunits. FIG. 29 of WO2014/074727 shows fractionation of aHL nanopores and mutants thereof using both His-tag and Strep-tags.
[0092] In certain example embodiments, an entity (e.g., a polymerase) is attached to the protein following fractionation. The protein can be a nanopore and the entity can be a polymerase. In some instances, the method further comprises inserting the proteins having the second ratio subunits into a bilayer.
[0093] In certain example embodiments, a nanopore can comprise a plurality of subunits. As described herein, a polymerase can be attached to one of the subunits and at least one and less than all of the subunits comprise a first purification tag. In some example embodiments, the nanopore is alpha-hemolysin or a variant thereof. In some instances, all of the subunits comprise a first purification tag or a second purification tag. The first purification tag can, for example, be a poly-histidine tag (e.g., on the subunit having the polymerase attached).
Polymerase Attached to Nanopore
[0094] In certain example embodiments, a polymerase (e.g., DNA polymerase) is attached to and/or is located in proximity to the nanopore. Any DNA polymerase capable of synthesizing DNA during a DNA synthesis reaction may be used in accordance with the methods and compositions described herein. Example DNA polymerases include, but are not limited to, phi29 (Bacillus bacteriophage 29), pol6 (Clostridium phage phiCPV4; GenBank: AFH27113.1) or pol7 (Actinomyces phage Av-1; GenBank: ABR67671.1). In certain example embodiments, attached to the nanopore assembly is a DNA-manipulating or modifying enzyme, such as a ligase, nuclease, phosphatase, kinase, transferase, or topoisomerase.
[0095] In certain example embodiments, the polymerase is a polymerase variant. For example, the polymerase variant may include any of the polymerase variants identified in U.S. patent application Ser. No. 15/012,317 (the 317 Application). Such variants include, for example, one or more amino acid substitutions at H223A, N224Y/L, Y225L/T/I/F/A, H227P, I295 W/F/M/E, Y342L/F, T343N/F, 1357G/L/Q/H/W/M/A/E/Y/P, S360G, L361M/W/V, I363V, S365Q/W/M/A/G, S366A/L, Y367L/E/M/P/N, P368G, D417P, E475D, Y476V, F478L, K518Q, H527 W/R/L, T529M/F, M531H/Y/A/K/R/W/T/L/V, N535L/Y/M/K/I, G539Y/F, P542E/S, N545K/D/S/L/R, Q546 W/F, A547M/Y/W/F/V/S, L549Q/Y/H/G/R, 1550A/W/T/G/F/S, N552L/M/S, G553S/T, F558P/T, A596S, G603T, A610T/E, V615A/T, Y622A/M, C623G/S/Y, D624F, I628Y/V/F, Y629 W/H/M, R632L/C, N635D, M641 L/Y, A643L, I644H/M/Y, T647G/A/E/K/S, I648K/R/V/N/T, T651Y/F/M, 1652Q/G/S/N/F/T, K655G/F/E/N, W656E, D657R/P/A, V658L, H660A/Y, F662I/L, L690M, or combinations thereof of SEQ ID NO: 15 (which corresponds to SEQ ID NO: 2 of the '317 Application). In certain example embodiments, the polymerase includes one or more such substitutions and has 80%, 90%, 95%, 98% or more sequence identity to the amino acid sequence set forth as SEQ ID NO: 15. As described in the '317 Application, the polymerase variant has altered enzyme activity, fidelity, processivity, elongation rate, sequencing accuracy, long continuous read capability, stability, or solubility relative to the parental polymerase.
[0096] The polymerase can be attached to the nanopore in any suitable way. A polymerase, for example, can be attached to the nanopore assembly in any suitable way known in the art. See, for example, PCT/US2013/068967 (published as WO2014/074727; Genia Technologies), PCT/US2005/009702 (published as WO2006/028508), and PCT/US2011/065640 (published as WO2012/083249; Columbia Univ). In certain example embodiments, the polymerase is attached to the nanopore (e.g., hemolysin) protein monomer and then the full nanopore heptamer is assembled (e.g., in a ratio of one monomer with an attached polymerase to 6 nanopore (e.g., hemolysin) monomers without an attached polymerase). The nanopore heptamer can then be inserted into the membrane.
[0097] Another method for attaching a polymerase to a nanopore involves attaching a linker molecule to a hemolysin monomer or mutating a hemolysin monomer to have an attachment site and then assembling the full nanopore heptamer (e.g., at a ratio of one monomer with linker and/or attachment site to 6 hemolysin monomers with no linker and/or attachment site). A polymerase can then be attached to the attachment site or attachment linker (e.g., in bulk, before inserting into the membrane). The polymerase can also be attached to the attachment site or attachment linker after the (e.g., heptamer) nanopore is formed in the membrane. In some cases, a plurality of nanopore-polymerase pairs are inserted into a plurality of membranes (e.g., disposed over the wells and/or electrodes) of the biochip. In some instances, the attachment of the polymerase to the nanopore complex occurs on the biochip above each electrode.
[0098] The polymerase can be attached to the nanopore with any suitable chemistry (e.g., covalent bond and/or linker). In some cases, the polymerase is attached to the nanopore with molecular staples. In some instances, molecular staples comprise three amino acid sequences (denoted linkers A, B and C). Linker A can extend from a hemolysin monomer, Linker B can extend from the polymerase, and Linker C then can bind Linkers A and B (e.g., by wrapping around both Linkers A and B) and thus the polymerase to the nanopore. Linker C can also be constructed to be part of Linker A or Linker B, thus reducing the number of linker molecules.
[0099] In certain example embodiments, the polymerase is linked to the nanopore using Solulink chemistry. Solulink can be a reaction between HyNic (6-hydrazino-nicotinic acid, an aromatic hydrazine) and 4FB (4-formylbenzoate, an aromatic aldehyde). In some instances, the polymerase is linked to the nanopore using Click chemistry (available from LifeTechnologies for example). In some cases, zinc finger mutations are introduced into the hemolysin molecule and then a molecule is used (e.g., a DNA intermediate molecule) to link the polymerase to the zinc finger sites on the hemolysin.
[0100] Additionally or alternatively, the SpyTag/SpyCatcher system, which spontaneously forms covalent isopeptide linkages under physiological conditions, may be used to join an alpha-hemolysin monomer to the polymerase. See, for example, Li et al, J Mol Biol. 2014 Jan. 23; 426(2):309-17. For example, an alpha-hemolysin protein can be expressed having a SpyTag domain. Further, the DNA polymerase to be joined to the alpha-hemolysin may be separately expressed as fusion protein having a SpyCatcher domain. By mixing the alpha-hemolysin/SpyTag fusion protein with the DNA Polymerase/SpyCatcher protein, the SpyTag and SpyCatcher proteins interact to form the alpha-hemolysin monomer that is linked to a DNA polymerase via a covalent isopeptide linkage.
[0101] In certain example embodiments, the polymerase may be attached to a nanopore monomer before the nanopore monomer is incorporated into a nanopore assembly. For example, following expression and purification of the alpha-hemolysin/SpyTag fusion protein, the purified alpha-hemolysin/SpyTag fusion protein is mixed with purified polymerase/SpyCatcher fusion protein, thus allowing the SpyTag and SpyCatcher proteins bind each other to form an alpha-hemolysin/polymerase monomer. The monomer can then be incorporated into the nanopore assembly as described herein to form a heptameric assembly.
[0102] In certain example embodiments, the polymerase is attached to the nanopore assembly after formation of the nanopore assembly. For example, following expression and purification of the alpha-hemolysin/SpyTag fusion protein, the fusion protein is incorporated into the nanopore assembly to form the heptameric nanopore assembly. The polymerase/SpyCatcher fusion protein is then mixed with the heptameric assembly, thus allowing the SpyTag and SpyCatcher proteins bind each other, which in turn results in binding of the polymerase to the nanopore assembly.
[0103] Because of the nature of nanopore-based sequencing reaction, those skilled in the art will appreciate that it is beneficial to have only a single polymerase associated with each nanopore assembly (rather than multiple polymerases). To achieve such assemblies, the nanopore assembly may be configured, for example, to have only a single SpyTag, which therefore allows the attachment of a single polymerase/SpyCatcher.
[0104] In the case of alpha-hemolysin, for example, mixing the alpha-hemolysin/SpyTag proteins with additional alpha-hemolysin proteins results in heptamers having 0, 1, 2, 3, 4, 5, 6, or 7 alpha-hemolysin/SpyTag subunits. Yet because of the different number of SpyTag sequences (0, 1, 2, 3, 4, 5, 6, or 7) associated with each heptamer, the heptamers have different charges. Hence, in certain example embodiments, the heptamers can be separated by methods known in the art, such as via elution with cation exchange chromatography. The eluted fractions can then be examined to determine which fraction includes an assembly with a single SpyTag. The fraction with a single SpyTag can then be used to attach a single polymerase to each assembly, thereby creating a nanopore assemblies with a single polymerase attached thereto.
[0105] While a variety of methods may be suitable for determining which heptamer fraction contains a single SpyTag (and that is hence capable of binding a only single polymerase/SpyCatcher fusion protein per heptamer), in certain example embodiments the different heptamer fraction can be separated based on molecular weight, such as via SDS-PAGE. A reagent can then be used to confirm the presence of SpyTag associated with each fraction. For example, a SpyCatcher-GFP (green fluorescent protein) can be added to the fractions before separation via SDS-PAGE.
[0106] Because heptamers with fewer number of SpyTags are smaller than the heptamers with greater number of SpyTags, the fraction with a single SpyTag can be identified, as evidenced by the furthest band migration and the presence of GFP fluorescence in the SDS-PAGE gel corresponding to the band. For example, a fraction containing seven alpha-hemolysin monomers and zero SpyTag fusion proteins will migrate the furthest, but will not fluoresce when mixed with SpyCatcher-GFP because of the absence of the SpyTag bound to the heptamers. The fraction containing a single SpyTag, however, will both migrate the next furthest (compared to other fluorescent bands) and will fluoresce, thereby allowing identification of the fraction with a single SpyTag bound to the heptamer. Following identification of the fraction with a single SpyTag bound to the heptamer, the polymerase/SpyCatcher fusion protein can then be added to this fraction, thereby linking the polymerase to the nanopore assembly.
[0107] By using the methods and compositions described herein, a nanopore assembly tethered to a single DNA polymeraseand including one or more of the alpha hemolysin variants as described hereincan be achieved. For example, the heptameric nanopore may include one alpha-hemolysin variant having a substitution corresponding to any one of V149K, E287R, H35G, T109K, P151K, K147N, E111N, M113A, or combinations thereof of SEQ ID NO: 14, five mature wild type alpha hemolysin monomers, and a seventh alpha-hemolysin monomer that is fused to a polymerase (for a total of seven subunits of the heptamer). In certain example embodiments, the nanopore heptamer assembly may include 1, 2, 3, 4, 5, 6, or 7 of the variants described herein, with one of the subunits being attached to a polymerase as described herein.
Apparatus Set-Up
[0108] The nanopore may be formed or otherwise embedded in a membrane disposed adjacent to a sensing electrode of a sensing circuit, such as an integrated circuit. The integrated circuit may be an application specific integrated circuit (ASIC). In some examples, the integrated circuit is a field effect transistor or a complementary metal-oxide semiconductor (CMOS). The sensing circuit may be situated in a chip or other device having the nanopore, or off of the chip or device, such as in an off-chip configuration. The semiconductor can be any semiconductor, including, without limitation, Group IV (e.g., silicon) and Group III-V semiconductors (e.g., gallium arsenide). See, for example, WO 2013/123450, for the apparatus and device set-up for sensing a nucleotide or tag.
[0109] Pore based sensors (e.g., biochips) can be used for electro-interrogation of single molecules. A pore based sensor can include a nanopore of the present disclosure formed in a membrane that is disposed adjacent or in proximity to a sensing electrode. The sensor can include a counter electrode. The membrane includes a trans side (i.e., side facing the sensing electrode) and a cis side (i.e., side facing the counter electrode).
[0110] In certain example embodiments, a nanopore including one or more of the alpha-hemolysin variants described herein, will have an altered time to thread relative to a nanopore including wild-type alpha-hemolysin (i.e., a nanopore without any of the substitutions described herein). For example, the time for a tag to thread through the pore (the time-to-thread or TTT) may be decreased. In certain example embodiments, the TTT for a nanopore comprising one or more of the variants described herein may be decreased by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% or more as compared to a heptameric nanopore assembly consisting of native alpha-hemolysin.
[0111] In the experimental disclosure that follows, the following abbreviations apply: eq (equivalents); M (Molar); M (micromolar); N (Normal); mol (moles); mmol (millimoles); mol (micromoles); nmol (nanomoles); g (grams); mg (milligrams); kg (kilograms); g (micrograms); L (liters); ml (milliliters); l (microliters); cm (centimeters); mm (millimeters); m (micrometers); nm (nanometers); C. (degrees Centigrade); h (hours); min (minutes); sec (seconds); msec (milliseconds).
EXAMPLES
[0112] The present invention is described in further detain in the following examples which are not in any way intended to limit the scope of the invention as claimed. The attached Figures are meant to be considered as integral parts of the specification and description of the invention. All references cited are herein specifically incorporated by reference for all that is described therein. The following examples are offered to illustrate, but not to limit the claimed invention.
Example 1
Expression and Recovery
[0113] This example illustrates the expression and recovery of protein from bacterial host cells, e.g., E. coli.
[0114] DNA encoding the wild-type a-HL was purchased from a commercial source. The sequence was verified by sequencing.
[0115] Plasmid Construction.
[0116] The gene encoding either a wild-type or variant -hemolysin was inserted into a pPR-IBA2 plasmid (IBA Life Sciences, Germany) under the control of T7 promoter.
[0117] Transformation.
[0118] E. coli BL21 DE3 (from Life Technologies) cells were transformed with the expression vector comprising the DNA encoding the wild-type or variant -hemolysin using techniques well-known in the art. Briefly, the cells were thawed on ice (if frozen). Next, the desired DNA (in a suitable vector/plasmid) was added directly into the competent cells (should not exceed 5% of that of the competent cells) and mixed by flicking the tube. The tubes were placed on ice for 20 minutes. Next, the cells were placed in a 42 C. water bath for 45 seconds without mixing, followed by placing the tubes on ice for 2 min. The cells were then transferred to a 15 ml sterilized culture tube containing 0.9 ml of SOC medium (pre-warmed at room temperature) and cultured at 37 C. for 1 hr in a shaker. Finally, an aliquot of the cells were spread onto a LB agar plate containing the appropriate antibiotic and the plates incubated at 37 C. overnight.
[0119] Protein Expression.
[0120] Following transformation, colonies were picked and inoculated into a small volume (e.g., 3 ml) of growth medium (e.g., LB broth) containing the appropriate antibiotic with shaking at 37 C., overnight.
[0121] The next morning, transfer 1 ml of the overnight culture to a new 100 ml of autoinduction medium, e.g., Magic Media (Life Technologies) containing an appropriate antibiotic to select the expression plasmid. Grow the culture with shaking at 25 C. approximately 16 hrs but this depended on the expression plasmids. Cells were harvested by centrifugation at 3,000 g for 20 min at 4 C. and stored at 80 C. until used.
[0122] Purification.
[0123] Cells were lysed via sonication. The alpha-hemolysin was purified to homogeneity by affinity column chromatography.
Example 2
Alpha-Hemolysin Variants
[0124] The following example details the introduction of a mutation at a desired residue.
[0125] Mutations.
[0126] Site-directed mutagenesis is carried out using a QuikChange Multi Site-Directed Mutagenesis kit (Stratagene, La Jolla, Calif.) to prepare the example H35G+V149K+H144A, as set forth in SEQ ID NO: 4, but also including a C-terminal linker/TEV/HisTag for purification.
[0127] The variant was expressed and purified as in Example 1.
Example 3
Assembly of Nanopore Including Variant
[0128] This example describes the assembly of a nanopore comprising six a-HL variant subunits and one wild-type subunit.
[0129] The wild-type a-HL was expressed as described in Example 1 with SpyTag and a HisTag and purified on a cobalt affinity column using a cobalt elution buffer (200 mM NaCl, 300 mM imidazole, 50 mM tris, pH 8). The H35G+V149K+H144A a-HL variant was expressed as described in Example 1 with a HisTag and purified on a cobalt affinity column using a cobalt elution buffer (200 mM NaCl, 150 mM imidazole, 50 mM tris, pH 8). The protein was then incubated with 1 mg of TEV protease for every 5 mg of protein at 4 C. for 4 hours. After incubation with TEV protease the mixture is purified on a cobalt affinity column to remove TEV protease and undigested protein. The proteins were stored at 4 C. if used within 5 days, otherwise 8% trehalose was added and stored at 80 C.
[0130] Using approximately 10 mg of total protein, the -HL/SpyTag to desired -HL-variant protein solutions were mixed together at a 1:9 ratio to form a mixture of heptamers. It is expected that such a mixture will result in various fractions that include varying ratios of -HL/SpyTag and -HL-variant protein (0:7; 1:6, 2:5, 3:4, etc.), where the SpyTag component is present as 0, 1, 2, 3, 4, 5, 6, or seven monomeric subunits of the heptamer.
[0131] Diphytanoylphosphatidylcholine (DPhPC) lipid was solubilized in either 50 mM Tris, 200 mM NaCl, pH 8 or 150 mM KCl, 30 mM HEPES, pH 7.5 to a final concentration of 50 mg/ml and added to the mixture of a-HL monomers to a final concentration of 5 mg/ml. The mixture of the -HL monomers was incubated at 37 C. for at least 60 min. Thereafter, n-Octyl--D-Glucopyranoside (OG) was added to a final concentration of 5% (weight/volume) to solubilize the resulting lipid-protein mixture. The sample was centrifuged to clear protein aggregates and left over lipid complexes and the supernatant was collected for further purification.
[0132] The mixture of heptamers was then subjected to cation exchange purification and the elution fractions collected. For each fraction, two samples were prepared for SDS-PAGE. The first sample included 15 uL of -HL eluate alone and the second sample was combined with 3 ug of SpyCatcher-GFP. The samples were then incubated and sheltered from light and at room temperature for 1-16 hours. Following incubation, 5 uL of 4 Laemmli SDS-PAGE buffer (Bio-Rad) was added to each sample. The samples and a PrecisionPlus Stain-Free protein ladder were then loaded onto a 4-20% Mini-PROTEAN Stain-Free protein precast gel (Bio-Rad). The gels were ran at 200 mV for 30 minutes. The gels were then imaged using a Stain-Free filter.
[0133] The conjugation of SpyCatcher-GFP to heptameric -HL/SpyTag can be observed through molecular weight band shifts during SDS-PAGE. Heptamers containing a single SpyTag will bind a single SpyCatcher-GFP molecular and will thus have a shift that corresponds to the molecular weight of the heptameric pore plus the molecular weight of a single SpyCatcher-GFP, while heptamers with two or more SpyTags should have correspondingly larger molecular weight shifts. Therefore, the peaks eluted off of the cation exchange column during heptameric -HL purification above can be analyzed for the ratio of -HL/SpyTag to -HL-variant. In addition, the presence of SpyCatcher-GFP attachment can be observed using a GFP-fluorescence filter when imaging the SDS-PAGE gels.
[0134] Based on this rationale, the fraction whose molecular weight shift corresponded to a single addition of SpyCatcher-GFP was determined using a molecular weight standard protein ladder. Bio-Rad's stain-free imaging system was used to determine the molecular weight shift. The presence of GFP fluorescence was determined using a blue filter. The presence of fluorescence was used to confirm the presence of the SpyTag protein. The elution fraction corresponding to the 1:6 ratio, i.e., one -HL/SpyTag to six -HL-variants, was then used for further experiments.
Example 4
Attachment of a Polymerase
[0135] This example provides for the attachment of a polymerase to a nanopore.
[0136] The polymerase may be coupled to the nanopore by any suitable means. See, for example, PCT/US2013/068967 (published as WO2014/074727; Genia Technologies), PCT/US2005/009702 (published as WO2006/028508), and PCT/US2011/065640 (published as WO2012/083249; Columbia Univ).
[0137] The polymerase, e.g., phi29 DNA Polymerase, was coupled to a protein nanopore (e.g. alpha-hemolysin), through a linker molecule. Specifically, the SpyTag and SpyCatcher system, which spontaneously forms covalent isopeptide linkages under physiological conditions, was used. See, for example, Li et al, J Mol Biol. 2014 Jan. 23; 426(2):309-17.
[0138] Briefly, the Sticky phi29 SpyCatcher HisTag was expressed according to Example 1 and purified using a cobalt affinity column. The SpyCatcher polymerase and the SpyTag oligomerized protein were incubated at a 1:1 molar ratio overnight at 4 C. in 3 mM SrCl.sub.2. The 1:6-polymerase-template complex is then purified using size-exclusion chromatography.
Example 5
Activity of the Variant
[0139] This example shows the activity of the nanopores as provided by Example 4 (nanopores with an attached polymerase).
[0140] The wild-type and H35G+V149K+H144A variant nanopores were assayed to determine the effect of the substitutions. More particularly, the assay was designed to measure the time it takes to capture a tagged molecule by a DNA polymerase attached to the nanopore using alternating voltages, i.e., squarewaves.
[0141] The bilayers were formed and pores were inserted as described in PCT/US14/61853 filed 23 Oct. 2014. The nanopore device (or sensor) used to detect a molecule (and/or sequence a nucleic acid) was set-up as described in WO2013123450.
[0142] To measure the time it takes to capture a tagged nucleotide by a DNA polymerase in our sequencing complex we have devised an assay that uses alternating positive and negative voltages (squarewaves) to determine the amount of time this takes. Our sequencing complex is comprised of a protein nanopore (HL) which is attached to a single DNA polymerase (see Example 4). The tagged nucleotides are negatively charged, and are therefore attracted to the nanopore when the voltage applied is positive in nature, and repelled when the voltage applied to the nanopore sequencing complex is negative. So we can measure the time it takes for a tag to thread into the pore by cycling the voltage between positive and negative potentials and determine how much time the nanopore's current is unobstructed (open channel) verses when the tag is threaded (reduced current flux).
[0143] To carry out the time-to-thread assay, the Genia Sequencing device is used with a Genia Sequencing Chip. The electrodes are conditioned and phospholipid bilayers are established on the chip as explained in PCT/US2013/026514. Genia's sequencing complex is inserted to the bilayers following the protocol described in PCT/US2013/026514 (published as WO2013/123450). The time-to-thread data was collected using a buffer system comprised of 20 mM HEPES pH 8, 300 mM KGlu, 3 uM tagged nucleotide, 3 mM Mg.sup.2+, with a voltage applied of 235 mV peak to peak with a duty cycle of 80 Hz.
[0144] After the data was collected, it was analyzed for squarewaves that showed the capture of a tagged nucleotide (threaded level) which lasted to the end of the positive portion of the squarewave, and was followed by another tag capture on the subsequent squarewave. The time-to-thread was measured by determining how long the second squarewave reported unobstructed open channel current. As an example, if 10 consecutive squarewaves showed tagged nucleotide captures that lasted to the end of the positive portion of the squarewave then the time-to-thread parameter would be calculated from squarewaves 2-10 (the first squarewave does not factor into the calculation because the polymerase did not have a tag bound to it in the previous squarewave). These time-to-thread numbers were then collected for all of the pores in the experiment and statistical parameters extracted from them (such as a mean, median, standard deviation etc.).
[0145] Results for the H35G+V149K+H144A variant, as compared to controls, are shown in
[0146] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.
TABLE-US-00002 SEQUENCELISTINGFREETEXT SEQIDNO:1(WTaHLDNA) ATGGCAGATCTCGATCCCGCGAAATTAATACGACTCACTATAGGGAGGCC 50 ACAACGGTTTCCCTCTAGAAATAATTTTGTTTAACTTTAAGAAGGAGATA 100 TACAAATGGATTCAGATATTAATATTAAAACAGGTACAACAGATATTGGT 150 TCAAATACAACAGTAAAAACTGGTGATTTAGTAACTTATGATAAAGAAAA 200 TGGTATGCATAAAAAAGTATTTTATTCTTTTATTGATGATAAAAATCATA 250 ATAAAAAATTGTTAGTTATTCGTACAAAAGGTACTATTGCAGGTCAATAT 300 AGAGTATATAGTGAAGAAGGTGCTAATAAAAGTGGTTTAGCATGGCCATC 350 TGCTTTTAAAGTTCAATTACAATTACCTGATAATGAAGTAGCACAAATTT 400 CAGATTATTATCCACGTAATAGTATTGATACAAAAGAATATATGTCAACA 450 TTAACTTATGGTTTTAATGGTAATGTAACAGGTGATGATACTGGTAAAAT 500 TGGTGGTTTAATTGGTGCTAATGTTTCAATTGGTCATACATTAAAATATG 550 TACAACCAGATTTTAAAACAATTTTAGAAAGTCCTACTGATAAAAAAGTT 600 GGTTGGAAAGTAATTTTTAATAATATGGTTAATCAAAATTGGGGTCCTTA 650 TGATCGTGATAGTTGGAATCCTGTATATGGTAATCAATTATTTATGAAAA 700 CAAGAAATGGTTCTATGAAAGCAGCTGATAATTTCTTAGATCCAAATAAA 750 GCATCAAGTTTATTATCTTCAGGTTTTTCTCCTGATTTTGCAACAGTTAT 800 TACTATGGATAGAAAAGCATCAAAACAACAAACAAATATTGATGTTATTT 850 ATGAACGTGTAAGAGATGATTATCAATTACATTGGACATCAACTAATTGG 900 AAAGGTACAAATACTAAAGATAAATGGACAGATAGAAGTTCAGAAAGATA 950 TAAAATTGATTGGGAAAAAGAAGAAATGACAAATGGTCTCAGCGCTTGGA 1000 GCCACCCGCAGTTCGAAAAATAA 1023 SEQIDNO:2(WTaHLaminoacids)[asexpressedinE.coli] MADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHN 50 KKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQIS 100 DYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYV 150 QPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKT 200 RNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIY 250 ERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTNGLSAWS 300 HPQFEK 306 SEQIDNO:3(MatureWTaHL,withpurificationtaq) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQ 150 PDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTNGLSAWSH 300 PQFEK 305 SEQIDNO:4(H35G+ V149K+ H144A) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMGKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGATLKYKQ 150 PDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN 293 SEQIDNO:5(H35G+ H144A+ V149K+ E287R) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMGKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGATLKYKQ 150 PDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWRKEEMTN 293 SEQIDNO:6(V149K+ E287R) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMGKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYKQ 150 PDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWRKEEMTN 293 SEQIDNO:7(T109K+ H35G) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMGKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDKKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGATLKYVQ 150 PDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN 293 SEQIDNO:8(P151K+ H35G) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMGKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGATLKYVQ 150 KDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN 293 SEQIDNO:9(V149K+ P151K+ H35G) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMGKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGATLKYKQ 150 KDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN 293 SEQIDNO:10(T109K+ V149K+ H35G) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMGKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDKKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGATLKYKQ 150 PDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN 293 SEQIDNO:11(V149K+ K147N+ E111N+ 127-131G+ M113A+ H35G) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMGKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDTKNYASTLTYGFNGNVTGGGGGGIGGLIGANVSIGATLNYKQ 150 PDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN 293 SEQIDNO:12(V149K+ K147N+ E111N+ 127-131G+ M113A) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDTKNYASTLTYGFNGNVTGGGGGGIGGLIGANVSIGHTLNYKQ 150 PDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN 293 SEQIDNO:13(T109K+ V149K+ P151K+ H35G) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMGKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDKKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGATLKYKQ 150 KDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMIN 293 SEQIDNO:14(MatureWTaHL;AAA26598) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNK 50 KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD 100 YYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQ 150 PDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR 200 NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE 250 RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN 293 SEQIDNO:15(13016withHisTaq) MHHHHHHHHSGGSDKHTQYVKEHSFNYDEYKKANFDKIECLIFDTESCTN 50 YENDNTGARVYGWGLGVTRNHNMIYGQNLNQFWEVCQNIFNDWYHDNKHT 100 IKITKTKKGFPKRKYIKFPIAVHNLGWDVEFLKYSLVENGFNYDKGLLKT 150 VFSKGAPYQTVTDVEEPKTFHIVQNNNIVYGCNVYMDKFFEVENKDGSTT 200 EIGLCLDFFDSYKIITCAESQFHNYVHDVDPMFYKMGEEYDYDTWRSPTH 250 KQTTLELRYQYNDIYMLREVIEQFYIDGLCGGELPLTGMRTASSIAFNVL 300 KKMTFGEEKTEEGYINYFELDKKTKFEFLRKRIEMESYTGGYTHANHKAV 350 GKTINKIGCSLDINSSYPSQMAYKVFPYGKPVRKTWGRKPKTEKNEVYLI 400 EVGFDFVEPKHEEYALDIFKIGAVNSKALSPITGAVSGQEYFCTNIKDGK 450 AIPVYKELKDTKLTTNYNVVLTSVEYEFWIKHFNFGVFKKDEYDCFEVDN 500 LEFTGLKIGSILYYKAEKGKFKPYVDHFTKMKVENKKLGNKPLTNQAKLI 550 LNGAYGKFGTKQNKEEKDLIMDKNGLLTFTGSVTEYEGKEFYRPYASFVT 600 AYGRLQLWNAIIYAVGVENFLYCDTDSIYCNREVNSLIEDMNAIGETIDK 650 TILGKWDVEHVFDKFKVLGQKKYMYHDCKEDKTDLKCCGLPSDARKIIIG 700 QGFDEFYLGKNVEGKKQRKKVIGGCLLLDTLFTIKKIMF* 739 SEQIDNO:16(Linker/TEV/HisTaq(TEVportionunderlined) GLSAENLYFQGHHHHHH
CITATION LIST
Patent Literature
[0147] [1] PCT/US2013/026514 (published as WO2013/123450) entitled Methods for Creating Bilayers for Use with Nanopore Sensors [0148] [2] PCT/US2013/068967 (published as WO 2014/074727) entitled Nucleic Acid Sequencing Using Tags [0149] [3] PCT/US14/61853 filed 23 Oct. 2014 entitled Methods for Forming Lipid Bilayers on Biochips
Non-Patent Literature
[0150] [4] Aksimentiev and Schulten, Imaging a-Hemolysin with Molecular Dynamics: Ionic Conductance, Osmotic Permeability, and the Electrostatic Potential Map, Biophysical Journal (2005) 88: 3745-3761. [0151] [5] Butler et al., Single-molecule DNA detection with an engineered MspA protein nanopore, PNAS (2008) 105(52): 20647-20652. [0152] [6] Korchev et al., Low Conductance States of a Single Ion Channel are not Closed, J. Membrane Biol. (1995) 147:233-239. [0153] [7] Krasilnikov and Sabirov, Ion Transport Through Channels Formed in Lipid Bilayers by Staphylococcus aureus Alpha-Toxin, Gen. Physiol. Biophys. (1989) 8:213-222. [0154] [8] Nakane et al., A Nanosensor for Transmembrane Capture and Identification of Single Nucleic Acid Molecules, Biophys. J. (2004) 87:615-621. [0155] [9] Rhee and Burns, Nanopore sequencing technology: nanopore preparations, TRENDS in Biotech. (2007) 25(4):174-181. [0156] [10] Song et al., Structure of Staphylococcal -Hemolysin, a Heptameric Transmembrane Pore, Science (1996) 274:1859-1866. [0157] [11] Kasianowicz et al., Nanometer-scale pores: potential applications for analyte detection and DNA characterization, Proc. Natl. Acad. Sci. USA (1996) 93:13770-13773. [0158] [12] Akeson et al., Microsecond timescale discrimination among polycytidylic acid, polyadenylic acid, and polyuridylic acid as homopolymers or as segments within single RNA molecules, Biophys. J. (1999) 77:3227-3233. [0159] [13] Meller et al., Voltage-driven DNA translocations through a nanopore, Phys. Rev. Lett., 86 (2001), pp. 3435-3438. [0160] [14] Howorka et al., Sequence-specific detection of individual DNA strands using engineered nanopores, Nat. Biotechnol., 19 (2001a), pp. 636-639. [0161] [15] Howorka et al., Kinetics of duplex formation for individual DNA strands within a single protein nanopore, Proc. Natl. Acad. Sci. USA, 98 (2001b), pp. 12996-13001. [0162] [16] Movileanu et al., Detecting protein analytes that modulate transmembrane movement of a polymer chain within a single protein pore, Nat. Biotechnol., 18 (2000), pp. 1091-1095.
[0163] The entirety of each patent, patent application, publication, document, GENBANK sequence, website and other published material referenced herein hereby is incorporated by reference, including all tables, drawings, and figures. All patents and publications are herein incorporated by reference to the same extent as if each was specifically and individually indicated to be incorporated by reference. Citation of the above patents, patent applications, publications and documents is not an admission that any of the foregoing is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents. All patents and publications mentioned herein are indicative of the skill levels of those of ordinary skill in the art to which the invention pertains.