MICROORGANISM FOR DELIVERING DRUG FOR TREATMENT OF GASTROINTESTINAL DISEASE, WHICH EXPRESSES AND SECRETES CYSTATIN, AND PHARMACEUTICAL COMPOSITION FOR PREVENTING OR TREATING GASTROINTESTINAL DISEASE, WHICH INCLUDES THE SAME
20190330312 ยท 2019-10-31
Inventors
Cpc classification
A61P1/04
HUMAN NECESSITIES
C12N15/74
CHEMISTRY; METALLURGY
A61K48/0025
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61P43/00
HUMAN NECESSITIES
C07K14/8139
CHEMISTRY; METALLURGY
A61P1/00
HUMAN NECESSITIES
A61K48/0008
HUMAN NECESSITIES
A61K35/744
HUMAN NECESSITIES
C12N15/746
CHEMISTRY; METALLURGY
C12P21/02
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C12P21/02
CHEMISTRY; METALLURGY
Abstract
The present invention relates to a microorganism for drug delivery, which has been transformed with a gene construct including a therapeutically active peptide, is delivered safely into the intestines through oral administration, and expresses and secretes a cystatin in the gastrointestinal tract, and also relates to a pharmaceutical composition for prevention or treatment of gastrointestinal disease, which includes the same. The present invention demonstrates the safety and superiority of lactic acid bacteria as a system for delivering a protein-based drug, and thus it is expected the lactic acid bacteria will be widely used as an agent for treatment of gastrointestinal disease in the medical field.
Claims
1. A microorganism for delivering a drug for treatment of gastrointestinal disease, wherein the microorganism has been transformed with a gene construct, comprising a polynucleotide encoding a cystatin or active fragment of the cystatin operably linked to an exogenous promoter and a gene encoding a secretion signal peptide, and expresses and secretes the cystatin in a gastrointestinal tract.
2. The microorganism of claim 1, wherein the exogenous promoter is at least one promoter selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 5.
3. The microorganism of claim 1, wherein the strain is a strain belonging to the genus Lactobacillus, Latococcus, Leuconostoc, Pediococcus, or Bifidobacterium.
4. The microorganism of claim 3, wherein the microorganism is a Lactobacillus rhamnosus, Lactobacillus acidophilus, Lactobacillus paracasei, Lactobacillus plantarum, Pediococcus pentosaceus, or Lactobacillus brevis strain.
5. The microorganism of claim 1, wherein the secretion signal peptide is a USP45 secretion signal peptide, Usp45 N4 or a Lactobacillus brevis S-layer protein signal peptide.
6. The microorganism of claim 1, wherein the cystatin is selected from the group consisting of cystatin A, cystatin B, cystatin C, cystatin D, cystatin S, egg white cystatin, milk cystatin, and kininogen.
7. The microorganism of claim 6, wherein the microorganism is a Pediococcus pentosaceus strain, and the cystatin is cystatin A.
8. The microorganism of claim 1, wherein the gene construct further comprises, downstream of the promoter, a second promoter, a second secretion signal peptide and a second heterologous nucleic acid sequence, and the second promoter is identical to or different from the exogenous promoter.
9. The microorganism of claim 1, wherein the gastrointestinal disease is colorectal cancer, colon polyp, colitis, ischemic gastrointestinal disease, dysentery, intestinal vascular dysplasia, diverticulosis, irritable bowel syndrome, or Crohn's disease.
10. A pharmaceutical composition for prevention or treatment of gastrointestinal disease, comprising the microorganism of claim 1, which produces and secretes a cystatin or an active fragment of the cystatin.
11. A pharmaceutical composition for prevention or treatment of gastrointestinal disease, comprising a Pediococcus pentosaceus strain, wherein the Pediococcus pentosaceus strain comprises a heterologous nucleic acid encoding a therapeutic peptide having a therapeutic effect against at least one gastrointestinal disease, and the heterogeneous nucleic acid comprises: at least one promoter operably linked to the heterogeneous nucleic acid and selected from SEQ ID NOs: 1 to 5 and combinations thereof; and a gene encoding a secretion signal peptide.
12. The pharmaceutical composition of claim 10 or 11, further comprising a pharmaceutically acceptable carrier or pharmaceutically acceptable salt.
13. The pharmaceutical composition of claim 11, further comprising a chemotherapeutic compound.
14. The pharmaceutical composition of claim 11, wherein the therapeutic peptide is selected from the group consisting of cystatin A, cystatin B, cystatin C, cystatin D, cystatin S, egg white cystatin, milk cystatin, and kininogen.
Description
DESCRIPTION OF DRAWINGS
[0024]
[0025]
[0026]
[0027]
[0028]
MODE FOR INVENTION
[0029] The present invention will be described in more detail below with reference to the accompanying drawings.
[0030] Unless otherwise defined, all the scientific and technical terms used in the specification have the same meanings as commonly understood by those skilled in the technical field to which the present invention.
[0031] The term nucleic acid refers to a deoxyribonucleotide or ribonucleotide polymer in either single- or double-stranded form, and, unless otherwise limited, encompasses known analogs of natural nucleotides that that hybridize to nucleic acids in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence includes its complementary sequence.
[0032] As used herein, the term promoter refers to a DNA sequence capable of controlling the expression of a coding sequence or functional RNA. Any person skilled in the art will easily recognize a promoter region. The promoter consists of proximal and more distal upstream elements. Proximal elements include a TATA box capable of directing RNA polymerase II to initiate RNA synthesis at an appropriate transcription initiation site.
[0033] The term biologically active molecule (BAM) refers to substances which are involved in gene therapy or capable of regulating immune responses, and include substances capable of regulating intracellular signal transduction mechanisms or the expression of other particular genes. These substances may include growth factors, substances for cancer treatment, tumor suppressors, cytokines, interferons, and the like.
[0034] As used herein, a heterologous sequence or a heterologous nucleic acid means one that originates from a foreign source (or species) or, if originates from the same source, is modified from its original form. Thus, a heterologous nucleic acid operably linked to a promoter is derived from a source different from that from which the promoter was derived, or, if derived from the same source, is modified from its original form.
[0035] The term operably linked refers to functional linkage between a nucleic acid expression control sequence (such as a promoter, signal sequence, or array of transcription factor binding sites) and a heterologous nucleic acid sequence, wherein the expression control sequence affects transcription and/or translation of the nucleic acid corresponding to the heterologous nucleic acid sequence.
[0036] As used herein, the terms protein and polypeptide are used interchangeably. A polypeptide refers to a polymer of amino acids, and does not refer to a specific length of the molecule. This term also includes post-translational modifications of the polypeptide, such as glycosylation, phosphorylation and acetylation.
[0037] As used herein, the term prevention means a medical or public health procedure whose purpose is to prevent disease rather than to treat or cure disease.
[0038] As used herein, the term treatment means a medical or public health procedure whose purpose is to treat or cure disease.
[0039] As used herein, the term therapeutically effective amount refers to the amount of therapeutic substance or composition effective to treat a disease or disorder in a subject, e.g., human or animal, i.e., to obtain a desired local or systemic effect and performance.
[0040] As used herein, the term pharmaceutically acceptable means compatible with the other ingredients of a pharmaceutical composition and not deleterious to the recipient thereof.
[0041] One aspect of the present invention to achieve the above-described objects is directed to a microorganism for delivering a drug for treatment of gastrointestinal disease, wherein the microorganism has been transformed with a gene construct, including a polynucleotide encoding a cystatin or active fragment of the cystatin operably linked to an exogenous promoter and a gene encoding a secretion signal peptide, and expresses and secretes the cystatin in the gastrointestinal tract.
[0042] The microorganism of the present invention may be used as a medicament. Although this medicament may be administered alone as a therapeutic agent, it is preferably provided as a pharmaceutical formulation prepared by mixing with one or more pharmacologically acceptable carriers by any method known in the technical field of pharmaceutics.
[0043] Cystatins are substances that inhibit the activity of intracellular proteases, and belong to a large superfamily of proteins, many of which inhibit cysteine proteases of the Cl class (cathepsins). Virtually all organisms produce one or more members of the cystatin superfamily. Basically, there are three major cystatin families, the types I, II, and III cystatins and a number of cystatin-related protein families. The cystatins may be classified into family I (cystatin A, and cystatin B), secretory family II (cystatin C, cystatin D, cystatin S, egg white cystatin, and milk cystatin), and family III (kininogens). The cystatins function as strong inhibitors of various cancers, and also the cystatins inhibit the activity of protein kinase C (PKC), a critical enzyme which helps drive the metastatic propensity of many cancer types.
[0044] In one example, the cystatin A protein preferably has the amino acid sequence as set forth in Table 1 below, but is not necessarily limited thereto.
TABLE-US-00001 TABLE1 Definition Sequence Nucleotidesequence MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYI ofcystatinA KVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF protein Nucleotidesequence ATGATTCCAGGTGGTCTTTCAGAAGCTAAACCAGCTACACCAGAAATTCAAGAAA ofthegeneencoding TTGTTGATAAAGTTAAACCACAACTTGAAGAAAAAACAAACGAAACATACGGTAA cystatinAprotein ACTTGAAGCTGTTCAATACAAAACACAAGTTGTTGCTGGTACAAACTACTACATT AAAGTTCGTGCTGGTGATAACAAATACATGCATCTTAAAGTTTTTAAATCACTTC CAGGTCAAAACGAAGATCTTGTTCTTACAGGTTACCAAGTTGATAAAAACAAAGA TGATGAACTTACAGGTTTTTAGC
[0045] In the present invention, five strong promoters for expression of a target protein in lactic acid bacteria were selected. The exogenous promoter may be selected from SEQ ID NO: 1 (Chos promoter, L-carnitine, choline ABC transporter), SEQ ID NO: 2 (PK promoter, pyruvate kinase), SEQ ID NO: 3 (GK promoter, glucokinase), SEQ ID NO: 4 (G6Pi promoter, glucose 6-phosphate isomerase), SEQ ID NO: 5 (L-LDH promoter, L-lactate dehydrogenase), and combinations thereof, derived from Pediococcus pentosaceus.
TABLE-US-00002 TABLE2 Abbreviationof primername Sequence(5 .fwdarw. 3) ChoS GGATCCGTGATGTACGTAAGAAAGATTTACGTCAAATCACAACGGCCGTAGGTGACGGTG GCGTCGCTGGACAACAAGCGTATGAATATATTCAAGCTTTAAATGATTAAAGTCAAAATA AGCCACGGTGAAAACCGGGGCTTTTCTTTTTGCCAAAATTCAAAAAGTGATTGGTCTATA CCTAAAATTAAAAAAACGCTTTCTGGTATTCCATGGGTATTGTATAATGAAAGTAACTAT AAGTTACATCATAGGAGGACTTTTGAATGAAAAAAAAGATTATCTCAGCTATTTTAATGT CTACAGTGATACTTTCTGCTGCAG PK GGATCCCTAAAGATCGCGTTTTAGCAAGTAAGATGGGTGCTTACGCTGTTGAGCTACTCC TTGAAGGTAAGGGTGGTTTAGCAGTTGGAATCTTAGAAAATAAGGTTCAAGCTCATAACA TGCTTGACTTGTTTGATGCAAAACATCAAGCAGATGATTCACTTTACCAATTAAGTGAAG ATTTATCATTCTAGAGTTCTATTAATATTTGGATAAAATGACTTAAGAAGTCTTTTATAA TTTAAAATCAAGGGAGAGATTCTGTAATGAAAAAAAAGATTATCTCAGCTATTTTAATGT CTACAGTGATACTTTCTGCTGCAG GK GGATCCATAATCTGGTAAATTAGTTGAGATGGTATTATGAAAACACTTTATGATGTGCAA CAACTTTTAAAGCAATTCGGAATATTTGTTTACGTTGGAAAACGTAAATGGGATATTGAA TTGATGAGTATTGAATTGAAAAATTTGTACAAAGCAGGAGTCGTCGATAAACCGACTTAT GTTAAAGCTCAGTTGGTTTTACGACATGAGCATCATATTGAAGAGGTTAGAGATAACCAA CAAAAATAATGGAGGGTTTCGAAGTAATGAAAAAAAAGATTATCTCAGCTATTTTAATGT CTACAGTGATACTTTCTGCTGCAG G6Pi GGATCCATGCCGGCTAAAGTGGTGGATAAATTGAATCATCCCCAAGAACTGGAATAAGAT AAAATTGTAGTGCTTTCAGGCTTTACCAGCCATCTTTTGAAAAAATTAATTTCTTTCAAA AGTGCGTGTGACAGGTGATCAACTAGATTAAATGGGGAGGGTATCCCAGTAAATATTAGG TTAAATCGGATAGGCTTAACCAAATTAAGTAATTTTATTGTATAATGGTACAGATAAAGA ATTTTAAACAAAAGGGGTAGTTATTAATGAAAAAAAAGATTATCTCAGCTATTTTAATGT CTACAGTGATACTTTCTGCTGCAG L-LDH GGATCCTCATTTTCATGTTATTTTTCCACCCTCAACACGCAAAAACGGCTGAAAGAGCAA AAACCCCTCAGCTGTCCACGTTTATTTTCATGTAATATTACCATATTATTGACCCCAAGC GGGTCTTTTAACCTCTAACTTATCAATCACTTTACTAACTATACCCGAACTTCATAAAAT TTTTACTCAACTTTCTTTTATGAAAATGCTATACTTAGTATTGTTTGATAAATTCAAATA TTATATGAAAAAAGGGGATTGATCTTATGAAAAAAAAGATTATCTCAGCTATTTTAATGT CTACAGTGATACTTTCTGCTGCAG
[0046] The gene construct includes a promoter which, when introduced into microbial cells, promotes the expression of a heterologous nucleic acid encoding a biologically active foreign protein. Of the promoters of SEQ ID NOs: 1 to SEQ ID NO: 5, four (Chos promoter, PK promoter, GK, and G6Pi promoter) were selected from the glycolysis metabolic pathway, and one (L-LDH promoter) was selected from the secondary metabolite lactate production pathway. These promoters are strong promoters that induce high-level expression of a heterologous nucleic acid in lactic acid bacteria (e.g., Pediococcus pentosaceus). These promoters enable the microorganism of the present invention to function as a drug delivery system and to produce and secrete a sufficient amount of a cystatin.
[0047] The gene construct may increase not only the expression level of a heterologous nucleic acid but also the secretion of the heterologous nucleic acid. As used herein, the expression protein is secreted means that the protein is transported extracellularly from microbial cells, and this expression includes the case in which the entire protein molecule is substantially present in medium in a completely released form, and also includes the case in which the entire protein molecule is present in the cell surface layer, and the case in which a portion of the protein molecule is present in medium while the remaining portion of the molecule is present in the cell surface layer.
[0048] The gene construct includes a secretion signal peptide in order to direct the exogenous protein, expressed by the microorganism, into the secretion pathway of the microbial cells. The secretion signal peptide sequence is usually located at the 5 end of the DNA sequence encoding the exogenous protein.
[0049] The gene construct may also include a replication origin replicable in microbial cells. The reason for this is that manipulation of the vector is more efficient in lactic acid bacteria strain, and preferred examples of the replication origin include ColE1, Ori, oriT, and the like.
[0050] The gene construct may include a secretion signal peptide sequence suitable for allowing the therapeutic peptide to be secreted or released from a microbial drug delivery system (e.g., a Pediococcus pentosaceus system). To allow secretion of the therapeutic peptide, a fragment encoding a secretion signal peptide suitable for use in Pediococcus pentosaceus may be added to the 5 end or 3 end of the heterologous nucleic acid sequence.
[0051] The secretion signal peptide may include a secretion signal peptide that directs strong protein secretion, such as a USP45 secretion signal, Usp45 N4 in which lysine at position 4 of a wild-type Usp45 secretion signal is substituted with asparagine, or a Lactobacillus brevis S-layer protein signal peptide. This secretion signal peptide is able to provide secretion of the exogenous protein of interest. In addition, this secretion signal peptide sequence can additionally control the production and secretion of the therapeutic polypeptide of interest.
[0052] In another embodiment of the present invention, the gene construct may further include, downstream of the promoter, a second promoter other than the above-described promoter of any one of SEQ ID NOs: 1 to 5, a second secretion signal peptide, and a second nucleic acid sequence encoding a biologically active polypeptide.
[0053] In another embodiment of the present invention, the gene construct may necessarily have a first promoter upstream of the heterologous nucleic acid to be expressed, and may also include a second promoter downstream of the heterologous nucleic acid to be expressed. The first promoter and the second promoter may be the same as or different from each other. It is possible to use not only a non-specific promoter capable of promoting the expression of a foreign gene in most cells or tissues, but also a specific or selective promoter, such as a tissue- or organ-specific promoter, a tumor-specific promoter, a development- or differentiation-specific promoter or the like. For example, a specific promoter may be used as the first promoter, and a non-specific promoter may be used as the second promoter. A microorganism transformed with a gene construct including these two promoters is capable of expressing a desired heterologous polypeptide or protein in a very high yield.
[0054] The microbial strain may be a strain belonging to the genus Lactobacillus, Latococcus, Leuconostoc, Pediococcus, or Bifidobacterium. Specific examples of the strain include, but are not necessarily limited to, Lactobacillus rhamnosus, Lactobacillus acidophilus, Lactobacillus paracasei, Lactobacillus plantarum, Pediococcus pentosaceus, or Lactobacillus brevis strains.
[0055] Preferably, the strain may be a Pediococcus pentosaceus strain. Pediococcus pentosaceus can survive during passage through the gastrointestinal tract due to its excellent acid resistance and bile juice resistance, and reach and adhere well to the intestinal mucosal layer in a living form, indicating that it can continuously function as a drug delivery system.
[0056] The strain that is used as a drug delivery system preferably Pediococcus PP CysA deposited under accession number KCCM12180P, but any strains for delivering a drug for treatment of gastrointestinal disease, which expresses and secretes the cystatin protein of the present invention, are all included in the scope of the present invention.
[0057] The microorganism of the present invention is obtained by transfecting a microbial strain with an expression vector including the gene construct, and thus a heterologous nucleic acid encoding a desired therapeutic peptide can be expressed by the microbial strain at a predetermined location in the gastrointestinal tract, thereby producing the therapeutic peptide.
[0058] Another aspect of the present invention is directed to a pharmaceutical composition for prevention or treatment of gastrointestinal disease, which includes the above-described microbial strain that produces and secretes a cystatin or an active fragment of the cystatin.
[0059] Still another aspect of the present invention is directed to a pharmaceutical composition for prevention or treatment of gastrointestinal disease, including a Pediococcus pentosaceus strain, wherein the Pediococcus pentosaceus strain includes a heterogeneous nucleic acid encoding a therapeutic peptide having a therapeutic effect against at least one gastrointestinal disease, wherein the heterogeneous nucleic acid includes: at least one promoter operably linked to the heterogeneous nucleic acid and selected from SEQ ID NOs: 1 to 5 and combinations thereof, derived from Pediococcus pentosaceus; and a gene encoding a secretion signal peptide.
[0060] The heterologous nucleic acid may preferably encode a therapeutic peptide or a disease-related polypeptide. In addition, the heterologous nucleic acid may encode an antigenic polypeptide for use as a vaccine. In the present invention, the heterologous nucleic acid may be a gene encoding a hormone, a cytokine, an enzyme, a coagulation factor, a transporter protein, a receptor, a regulatory protein, a structural protein, a transcription factor, an antigen, an antibody or the like. Specific examples thereof include, but are not limited to, genes encoding thrombopoietin, growth hormones, growth hormone-releasing hormones, growth hormone-releasing peptides, interferons, interferon receptors, colony-stimulating factors, glucagon-like peptides, G-protein coupled receptors, interleukins, interleukin receptors, enzymes, interleukin binding proteins, cytokine binding proteins, macrophage activators, macrophage peptides, B-cell factors, T-cell factors, protein A, allergy inhibitors, necrosis glycoproteins, immunotoxins, lymphotoxins, tumor necrosis factors, tumor suppressors, transforming growth factors, -1 anti-trypsin, albumin, -lactalbumin, apolipoprotein-E, erythropoietin, highly glycosylated erythropoietin, angiopoietin, hemoglobin, thrombin, thrombin receptor activating peptides, thrombomodulin, blood factors VII, VIIa, VIII, IX and XIII, plasminogen activators, fibrin-binding peptides, urokinases, streptokinases, hirudin, protein C, C-reactive proteins, superoxide dismutase, leptin, platelet-derived growth factors, epithelial growth factors, epidermal growth factors, angiostatin, angiotensin, bone growth factors, bone stimulating proteins, calcitonin, insulin, atriopeptin, cartilage inducing factors, elcatonin, connective tissue activating factors, follicle stimulating hormones, luteinizing hormones, luteinizing hormone releasing hormones, nerve growth factors, parathyroid hormones, relaxin, secretin, somatomedin, insulin-like growth factors, adrenocortical hormones, glucagon, cholecystokinin, pancreatic polypeptides, gastrin releasing peptides, corticotropin releasing factors, thyroid stimulating hormones, autotaxin, lactoferrin, myostatin, receptors, receptor antagonists, cell surface antigens, virus derived vaccine antigens, monoclonal antibodies, polyclonal antibodies, antibody fragments, and the like.
[0061] Gastrointestinal diseases suitable for treatment with the pharmaceutical composition of the present invention includes diseases and disorders that affect organs, such as the mouth, esophagus, stomach, small intestine, large intestine, rectum, pancreas, liver and gallbladder. For examples, the diseases include dry mouth, oral ulcer, gingival diseases, gastroesophageal reflux diseases, gastric ulcer, inflammatory bowel diseases, inflammatory colitis, Crohn's disease, mycositis, gastric cancer, and colorectal cancer. In particular, the pharmaceutical composition may advantageously be used for treatment of colorectal cancer, colitis, irritable bowel syndrome, and Crohn's disease.
[0062] The Pediococcus pentosaceus strain can survive during passage through the gastrointestinal tract due to its excellent acid resistance and bile juice resistance, and reach and adhere well to the intestinal mucosal layer in a living form, indicating that it can continuously function as a drug delivery system.
[0063] Still another aspect of the present invention is directed to a pharmaceutical composition for prevention or treatment of gastrointestinal disease, which includes the strain of the present invention, that is, a microorganism which has been transformed with a gene construct, including a polynucleotide encoding a cystatin or active fragment of the cystatin operably linked to an exogenous promoter and a gene encoding a secretion signal peptide, and which expresses and secretes the cystatin in the gastrointestinal tract.
[0064] The pharmaceutical composition of the present invention may further include a pharmaceutically acceptable carrier or pharmaceutically acceptable salt. Meanwhile, the pharmaceutical composition may further include a chemotherapeutic compound.
[0065] The composition of the present invention is preferably administered by a route that is most effective for treatment. The composition may be administered orally or by parenteral routes, such as intraoral, tracheobronchial, intrarectal, subcutaneous, intramuscular and intravenous routes. Dosage forms include sprays, capsules, tablets, granules, syrups, emulsions, suppositories, injections, ointments, tapes and the like.
[0066] For oral administration, gastroresistant oral dosage forms may be formulated, which may also include compounds providing controlled release of the host cells and thereby provide controlled release of the desired therapeutic peptide encoded therein. For example, the oral dosage form (including tablets, pellets, granulates, powders) may be coated with a thin layer of excipient (usually polymers, cellulosic derivatives and/or lipophilic materials) that resists dissolution or disruption in the stomach, but not in the intestine, thereby allowing transit through the stomach in favor of disintegration, dissolution and absorption in the intestine.
[0067] The oral dosage form may be designed to allow slow release of the host cells and of the recombinant protein thereof, for instance as controlled release, sustained release, prolonged release, sustained action tablets or capsules. These dosage forms usually contain conventional and well known excipients, such as lipophilic, polymeric, cellulosic, insoluble, swellable excipients. Controlled release formulations may also be used for any other delivery sites including intestinal, colon, bioadhesion or sublingual delivery (i.e., dental mucosal delivery) and bronchial delivery. Each of the aforementioned formulations are well known in the art.
[0068] Preparations suitable for oral administration include emulsions, syrups, capsules, tablets, powders, granules and the like. Liquid preparations such as emulsions or syrups may be prepared using, as additives, water, sugars such as sucrose, sorbitol and fructose, glycols such as polyethylene glycol and propylene glycol, oils such as sesame oil, olive oil and soybean oil, antiseptics such as p-hydroxybenzoates, flavors such as strawberry flavor and peppermint, and the like. Capsules, tablets, powders, granules, and the like may be prepared using, as additives, excipients such as lactose, glucose, sucrose and mannitol, disintegrating agents such as starch and sodium alginate, lubricants such as magnesium stearate and talc, binders such as polyvinyl alcohol, hydroxypropyl cellulose and gelatin, surfactants such as fatty acid esters, plasticizers such as glycerin, and the like.
[0069] Preparations suitable for parenteral administration include injections, suppositories, sprays and the like. Injections are prepared using carriers including a salt solution, a glucose solution, or a mixture thereof. Alternatively, powdery injections may also be prepared by freeze-drying the strain according to a conventional method and adding sodium chloride thereto. Suppositories are prepared using carriers such as cacao butter, hydrogenated fat or carboxylic acid. In addition, sprays are prepared using the compound itself and carriers which do not stimulate the oral and airway mucous membranes of a recipient and which disperse the compound into fine particles which are easily absorbed.
[0070] Specific examples of carriers include lactose, glycerin and the like. It is also possible to prepare aerosols, dry powders, and the like depending on the properties of the compound and the carriers used. For these parenteral preparations, the additive components described with respect to the oral preparations may also be added.
[0071] The dose of the therapeutic peptide-producing strain which is the active ingredient of the pharmaceutical composition according to the present invention may vary depending on the patient's age, sex, body weight and disease. However, the strain may be administered once or several times at a dose of 0.001 to 100 mg/kg, preferably 0.01 to 10 mg/kg.
[0072] In addition, the dose of the strain according to the present invention may be increased or decreased depending on the route of administration, the severity of the disease, the patient's sex, body weight, age and the like. Accordingly, the dose is not intended to limit the scope of the present invention in any way.
[0073] The present invention will be described in more detail below with reference to examples. However, these examples are for illustrative purposes only, and the scope of the present invention is not limited by these examples.
Examples
Example 1. Construction of System for Overexpression and Secretion of Lactic Acid Bacteria-Derived Protein
Example 1-1. Selection of Promoters for Induction of Overexpression
[0074] Five strong promoters (ChoS, L-carnitine, choline ABC transporter, permease protein; PK, pyruvate kinase; GK, glucokinase; G6Pi, glucose 6-phosphoate isomerase; and L-LDH, L-lactate dehydrogenase) for expression of a target protein (cystatin A) in lactic acid bacteria were selected from the glycolysis metabolic pathway. A host for expression of the target protein was Pediococcus pentosaceus SL4 (accession number: KCTC 10297BP). A previous experiment demonstrated that the glucose consumption rate of the host was very high, and HPLC analysis indicated that nearly 100% of the consumed glucose was converted to the secondary metabolite L-lactate. For this reason, of the promoters, four were selected from the glycolysis metabolic pathway, and one was selected from the secondary metabolite lactate production pathway.
Example 1-2. Construction of System for Overexpression and Secretion of Target Protein
[0075] The plasmid pCBT24-2 (SEQ ID NO: 6) (KCCM12182P) was used for cloning of cystatin. The promoters selected in Example 1-1 were cloned with the DNA sequence encoding the usp45 secretion signal peptide [N-MKKKIISAILMSTVILSAAAPLSGVYA-C] derived from Lactococcus lactis, thereby constructing DNA plasmids in the form of promoter-secretion signal peptide-cystatin A (CysA). BamHI/Pstl restriction enzyme sites were inserted into each promoter ligated with the secretion signal peptide. The constructed plasmids were as follows:
[0076] pCBT24-2-ChoS-usp45-CysA,
[0077] pCBT24-2-PK-usp45-CysA,
[0078] pCBT24-2-GK-usp45-CysA,
[0079] pCBT24-2-G6Pi-usp45-CysA, and
[0080] pCBT24-2-L-LDH-usp45-CysA.
[0081] Each of the plasmids was transformed into Pediococcus pentosaceus SL4 (accession number: KCTC 10297BP). The level of expression/secretion induced by each of the promoters was measured, and then promoters showing high activities were combined with each other, thereby constructing an expression vector (pCBT24-2-G6Pi-usp45-CysA-usp45-G6Pi-CysA), as shown in
[0082] The expression vector shown in
Example 1-3. Culture of Pediococcus pentosaceus SL4 Transformant
[0083] The transformant grown on MRS solid medium (agar plate) was inoculated into 10 ml of MRS liquid medium (containing 10 mg/ml of erythromycin) and statically cultured at 37 C. for 15 hours (overnight incubation). 1 ml of the culture was inoculated into 10 ml of M9 minimal medium (containing 10 mg/ml of erythromycin), and then statically cultured at 37 C. for 48 hours. 5 ml of the culture was centrifuged, and the supernatant was collected. 5 ml of the supernatant was concentrated by TCA precipitation to isolate total protein. Using the total protein, the expression and secretion levels of cystatin A protein were comparatively analyzed by Western blotting. The microbial cells were diluted with buffer and lysed using a sonicator, and then the cell extract was analyzed by Western blotting, thereby determining the amount of cystatin A protein that was not secreted after expression.
Example 1-4. Isolation and Detection of Cystatin A Protein
[0084] The lactic acid bacteria transformant was cultured, and then 100% TCA (Trichloro Acetic Acid) was added to 5 ml of the culture supernatant to a final concentration of 20%. After mixing, the solution was incubated on ice for 30 minutes, and centrifuged at 15,000 rpm and 4 C. for 30 minutes to induce the precipitation of all proteins. After centrifugation, the supernatant was removed, and 200 l of acetone was added to the precipitate which was then centrifuged at 15,000 rpm and 4 C., and the precipitated protein was washed. After the remaining acetone was completely removed by drying at room temperature, the secretion level of the target protein present in the culture supernatant was measured. The secretion level was measured by Western blotting, and the results of the measurement indicated that when the novel promoter was used, the expression/secretion levels significantly increased (see
Example 2. Evaluation of Anticancer Effect of Cystatin Protein by Use of In Vivo Lactic Acid Bacteria Expression/Secretion System
Example 2-1. Tumor Cell Transplantation and Tumor Transplantation
[0085] The colorectal cancer cell line DLD-1 obtained from the Korean Cell Line Bank (Seoul, Korea) was subcultured at 37 C. in a 5% CO.sub.2 incubator with RPMI 1640 medium (Sigma, MO, USA) containing 10% fetal bovine serum (FBS; Invitrogen, NY, USA), penicillin (0.02 UI/ml; Sigma, MO, USA), streptomycin (0.02 g/ml; Sigma, MO, USA), glutamine (2 mM: Sigma, MO, USA) and non-essential amino acid (1%; Sigma, MO, USA). The cultured DLD-1 cells were suspended, and the tumor cell suspension were transplanted subcutaneously into the back of male nude mice (BALB/cAnN.Cg-Foxnlnu/CrlNarl; 5 weeks old) in an amount of 0.2 ml (210.sup.6 cells/mouse), thereby forming solid tumors. To dissect tumor tissue formed from the subcultured group, the animals were sacrificed and the tumor lumps were dissected. The blood vessels and fat layer distributed on the surface were removed, and then only fresh tumor tissue was selected and transplanted subcutaneously into untreated animals by a troca needle.
Example 2-2. Division into Experimental Groups and Substance Administration
[0086] When the volumes of individual tumors reached 100-150 mm.sup.3 after transplantation of the tumor lumps, the body weights and the tumor sizes were measured, and the animals were randomly grouped. The experimental animals were divided into a total of seven groups as shown in Table 3 below, and each group consisted of 10 animals: a negative control group (tumor-transplanted control group: G1); a positive control group (a group administered with 5-Fu anticancer agent, 40 mg/Kg 5-Fu; 5-fluorouracil, Siyma, MO, USA: G2), and experimental groups {a group administered with 110.sup.9 CFU/head after tumor cell transplantation (a group administered with wild-type P. pentosaceus), G3; a group administered with 110.sup.9 CFU/head (a group administered with drug delivery system (DDS) P. pentosaceus (empty vector)): G4; a group administered with 110.sup.8 CFU/head (a group administered with a low concentration of DDS P. pentosaceus (G6Pi-usp45-CysA): G5; a group administered with 110.sup.9 CFU/head (a group administered with a middle concentration of DDS P. pentosaceus (G6Pi-usp45-CysA): G6; and a group administered with 110.sup.10 CFU/head (a group administered with a high concentration of DDS P. pentosaceus (G6Pi-usp45-CysA): G7}. Each of the groups was administered orally with the indicated substance once a day for 7 weeks. Here, the transformant was cultured in MRS medium and suspended to a concentration of 10.sup.10/200 l, and the suspension was administered orally once a day for a total of 6 weeks.
TABLE-US-00003 TABLE 3 Experimental groups and treatment items Number of Group Treatment animals G1 (NC1) Treated with PBS 100 l/head 10 G2 (PC1) 5-fluorouracil (5-Fu) 400 g/head 10 G3 (T1) Wild-type 1 10.sup.9 CFU/head 10 G4 (T2) Empty vector 1 10.sup.9 CFU/head 10 G5 (T3) DDS PP (PK-usp45-CysA) low 1 10.sup.8 CFU/head 10 concentration G6 (T4) DDS PP (PK-usp45-CysA) middle 1 10.sup.9 CFU/head 10 concentration G7 (T5) DDS PP (PK-usp45-CysA) high 1 10.sup.10 CFU/head 10 concentration Total number of animals 70
Example 2-3. Measurement of Change in Volume of Solid Cancer
[0087] The growth of tumors in the seven nude mouse groups (10 animals per group) transplanted with the colorectal cancer cell line DLD-1 was confirmed, and the tumor lumps transplanted subcutaneously into the right sides manifested as subcutaneous nodules 5 days after transplantation.
[0088] After tumor tissue transplantation, the animals were grouped as shown in Table 3 above, and were treated according to the dosage schedule. During the period from the 0th day before administration after tumor transplantation to 49th day after administration, the sizes of the tumor tissues were measured once a week with Vernier calipers. On the 49th day of the experiment, the xenograft models (solid cancer models) were sacrificed, and tissue samples were obtained, after which tumor metastasis was observed. The tumor volume was calculated using the following equation: width.sup.2length/2 (mm.sup.3). The measured tumor sizes are graphically shown in
[0089] Referring to
[0090] Although the preferred embodiments of the present invention have been described in detail, the present invention is not limited to the above-described embodiments. Those skilled in the art to which the present invention pertains will appreciate that various modifications and alterations may be easily made based on the above-described embodiments. Therefore, the true scope of protection of the present invention should be defined based on the appended claims and their equivalents.