Methods for Producing Recombinant Proteins
20240141403 ยท 2024-05-02
Assignee
Inventors
Cpc classification
C12N15/74
CHEMISTRY; METALLURGY
C12P21/02
CHEMISTRY; METALLURGY
International classification
C12P21/02
CHEMISTRY; METALLURGY
C12N9/00
CHEMISTRY; METALLURGY
C12N9/12
CHEMISTRY; METALLURGY
Abstract
Recombinant proteins comprising a non-canonical amino acid with high yield and high fidelity are made by expressing the protein in an engineered Vibrio natriegens strain containing an orthogonal translation system comprising an orthogonal aminoacyl tRNA synthetase that charges the non-canonical amino acid onto the orthogonal cognate tRNA.
Claims
1. A method of producing a recombinant protein comprising a non-canonical amino acid (ncAA) with high yield and high fidelity, the method comprising: expressing the protein in an engineered Vibrio natriegens strain comprising an orthogonal translation system (OTS) comprising an orthogonal aminoacyl tRNA synthetase (aaRS) that charges the non-canonical amino acid onto a cognate, orthogonal tRNA.
2. The method of claim 1, wherein the strain is genomically recoded to contain fewer endogenous stop codons.
3. The method of claim 1 wherein the strain is genomically recoded to contain reduced or no active release factor 1 (RF1).
4. The method of claim 1, with a yield at least 10-fold higher than using genomically recoded E. coli strains that lack endogenous UAG stop codons and have been optimized for improved fitness and growth temperature.
5. The method of claim 1, wherein the strain has a doubling time of 10-14 min and provides a three-day workflow for protein expression, as opposed to a traditional 4-day workflow for protein expression using E. coli strains that lack endogenous UAG stop codons and have been optimized for improved fitness and growth temperature.
6. The method of claim 1, wherein the strain expresses the protein with lower levels of mis-incorporated natural a-amino acids at the UAG-programmed position than E. coli strains that lack endogenous UAG stop codons and have been optimized for improved fitness and growth temperature.
7. The method of claim 1, with a yield at least 10-fold higher than using genomically recoded E. coli strains that lack endogenous UAG stop codons and have been optimized for improved fitness and growth temperature, wherein the strain has a doubling time of 10-14 min and provides a three-day workflow for protein expression, as opposed to a traditional 4-day workflow for protein expression using E. coli strains that lack endogenous UAG stop codons and have been optimized for improved fitness and growth temperature, and wherein the strain expresses the protein with lower levels of mis-incorporated natural a-amino acids at the UAG-programmed position than E. coli strains that lack endogenous UAG stop codons and have been optimized for improved fitness and growth temperature.
8. The method of claim 1, wherein the ncAA is a non-natural ?-amino acid.
9. The method of claim 1, wherein the ncAA is a monomer providing a non-natural backbone, such as beta- and gamma-amino acids, aramids, thioesters, etc.
10. The method of claim 1, wherein the fidelity of the non-canonical amino acid charge is greater than 90%.
11. The method of claim 1, wherein the yield of the protein is greater than 100 mg/L or in a range of 100-500 mg/L.
12. The method of claim 1, wherein the Vibrio natriegens strain is an engineered Vibrio natriegens strain containing a major extracellular nuclease knockout and insertion of an IPTG-inducible T7 RNA polymerase cassette for expression of genes under a tightly controlled, inducible T7 promoter, capable of high transformation efficiency of over 1?10.sup.7 CFU/ng DNA.
13. The method of claim 1, wherein the fidelity of the non-canonical amino acid charge is greater than 90%; and the yield of the protein is greater than 100 mg/L or in a range of 100-500 mg/L.
14. The method of claim 1, wherein the protein comprises a plurality of non-canonical amino acids, each with high yield and high fidelity, and the strain comprise a plurality of orthogonal translation systems comprising engineered aminoacyl tRNA synthetases that charge the non-canonical amino acids onto a cognate tRNAs.
15. The method of claim 1, wherein the protein comprises a plurality of non-canonical amino acids, each with high yield and high fidelity, and the strain comprise a plurality of orthogonal translation systems comprising engineered aminoacyl tRNA synthetases that charge the non-canonical amino acids onto a cognate tRNAs, wherein the plurality is 3, 4 or 5.
16. The method of claim 1, wherein the fidelity of the non-canonical amino acid charge is greater than 90%; and the yield of the protein is greater than 100 mg/L or in a range of 100-500 mg/L, and wherein the protein comprises a plurality of non-canonical amino acids, each with high yield and high fidelity, and the strain comprise a plurality of orthogonal translation systems comprising engineered aminoacyl tRNA synthetases that charge the non-canonical amino acids onto a cognate tRNAs. wherein the plurality is 3, 4 or 5.
17. The method of claim 1, wherein the fidelity of the non-canonical amino acid charge is greater than 90%; and the yield of the protein is greater than 100 mg/L or in a range of 100-500 mg/L, wherein the Vibrio natriegens strain is an engineered Vibrio natriegens strain containing a major extracellular nuclease knockout and insertion of an IPTG-inducible T7 RNA polymerase cassette for expression of genes under a tightly controlled, inducible T7 promoter, capable of high transformation efficiency of over 1?10.sup.7 CFU/ng DNA.
18. The method of claim 1, wherein the protein comprises a plurality of non-canonical amino acids, each with high yield and high fidelity, and the strain comprise a plurality of orthogonal translation systems comprising engineered aminoacyl tRNA synthetases that charge the non-canonical amino acids onto a cognate tRNAs, wherein the Vibrio natriegens strain is an engineered Vibrio natriegens strain containing a major extracellular nuclease knockout and insertion of an IPTG-inducible T7 RNA polymerase cassette for expression of genes under a tightly controlled, inducible T7 promoter, capable of high transformation efficiency of over 1?10.sup.7 CFU/ng DNA.
19. The method of claim 1, wherein the protein comprises a plurality of non-canonical amino acids, each with high yield and high fidelity, and the strain comprise a plurality of orthogonal translation systems comprising engineered aminoacyl tRNA synthetases that charge the non-canonical amino acids onto a cognate tRNAs, wherein the plurality is 3, 4 or 5, wherein the Vibrio natriegens strain is an engineered Vibrio natriegens strain containing a major extracellular nuclease knockout and insertion of an IPTG-inducible T7 RNA polymerase cassette for expression of genes under a tightly controlled, inducible T7 promoter, capable of high transformation efficiency of over 1?10.sup.7 CFU/ng DNA.
20. The method of claim 1, wherein the fidelity of the non-canonical amino acid charge is greater than 90%; and the yield of the protein is greater than 100 mg/L or in a range of 100-500 mg/L, and wherein the protein comprises a plurality of non-canonical amino acids, each with high yield and high fidelity, and the strain comprise a plurality of orthogonal translation systems comprising engineered aminoacyl tRNA synthetases that charge the non-canonical amino acids onto a cognate tRNAs. wherein the plurality is 3, 4 or 5, wherein the Vibrio natriegens strain is an engineered Vibrio natriegens strain containing a major extracellular nuclease knockout and insertion of an IPTG-inducible T7 RNA polymerase cassette for expression of genes under a tightly controlled, inducible T7 promoter, capable of high transformation efficiency of over 1?10.sup.7 CFU/ng DNA.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
DESCRIPTION OF PARTICULAR EMBODIMENTS OF THE INVENTION
[0036] Unless contraindicated or noted otherwise, in these descriptions and throughout this specification, the terms a and an mean one or more, the term or means and/or. It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein, including citations therein, are hereby incorporated by reference in their entirety for all purposes.
Example
[0037] In this example we demonstrate that the recently introduced commercial strain of V. natriegens Vmax? X2, Codex DNA, San Diego, CA) supports robust unnatural amino acid mutagenesis, generating exceptional yields of soluble protein containing up to 5 ncAAs. 59 Yields are especially high when ncAA are introduced using the M. jannaschii tyrosyl aminoacyl-tRNA synthetase (TyrRS)/tRNA.sup.Tyr variant pCNFRS..sup.20,21 The isolated yields of ncAA-containing superfolder green fluorescent protein (sfGFP) expressed in Vmax X2 are up to 25-fold higher than those achieved using commercial expression strains (Top10 and BL21) and more than 10-fold higher than those achieved using two different genomically recoded E. coli strains that lack endogenous UAG stop codons and have been optimized for improved fitness and preferred growth temperature (C321.4A.opt and C321.4A.exp, Addgene strains #87359 and #49018)..sup.39,40 The rapid doubling time of Vmax X2 (?10-14 min) 52 also translates into a highly convenient three-day workflow for protein expression, as opposed to the traditional 4-day workflow for protein expression using traditional E. coli strains. In addition to high yields, Vmax X2 cells also generate proteins with significantly lower levels of mis-incorporated natural ?-amino acids at the UAG-programmed position, especially in cases where the ncAA is an imperfect substrate for the chosen orthogonal aminoacyl tRNA synthetase (aaRS). Thus, use of Vmax X2 can obviate the need for time-consuming directed evolution experiments to improve the specific activity of highly desirable but imperfect aaRS substrates.
[0038] To evaluate Vmax X2 as a host organism for unnatural amino acid mutagenesis, we first asked if it would support the incorporation of a single ncAA into sfGFP using two orthogonal translation systems (OTS) that are used commonly in E. coli. The first is the p-cyano-L-phenylalanyl aminoacyl-tRNA synthetase (pCNFRS)-tRNA.sub.CUA.sup.Tyr pair.sup.20,21 derived from M. jannaschii, while the second is the pyrrolysyl-tRNA synthetase (PylRS)-tRNA.sub.CUA.sup.Pyl pair.sup.15 derived from M. mazei. Both of these aaRS/tRNA pairs support the incorporation of chemically diverse ncAA into proteins in E. coli but only the activity of the PylRS)-tRNA.sub.CUA.sup.Pyl pair.sup.15 has been tested in Vibrio natriegens. 59 Specifically, we asked whether either of these aaRS/tRNA pairs would support the incorporation of p-azido-L-phenylalanine (using pCNFRS) or Boc-L-Lysine (using PylRS) at position 2 of sfGFP (
[0039] The 2TAG sfGFP variants expressed in Vmax X2 during a 4-hour incubation were isolated using immobilized metal affinity chromatography (IMAC) and their purity and identity assessed using SDS-PAGE and mass spectrometry (
[0040] Next, we set out to evaluate how the yield of ncAA-containing sfGFP produced in Vmax X2 cells compared to those obtained in several E. coli strains used for protein expression and genetic code expansion. The strains evaluated included Top10 (a broad utility strain related to DH10B?), BL21 (optimized for protein expression from T7 promoters), as well as two genomically recoded strains, C321.?A.exp.sup.39 and C321.?A.opt,.sup.40 in which the 321 endogenous UAG stop codons are replaced by the alternative stop codon UAA. Both GROs are derived from the original C321.4A; the former has been engineered to lower the rate of spontaneous mutagenesis and can be grown at 37? C.; the latter carries additional mutations that improve doubling time. Because C321 strains lack T7 RNA polymerase,.sup.39 sfGFP expression in these strains is under control of the commonly used pBAD promoter. All strains were grown under their own optimized conditions and in the presence of 0.5 mM pAzF; both OD.sub.600 and fluorescence at 528 nm (2 max for sfGFP) were monitored as a function of time (
[0041] As expected, the Vmax X2 cultures grew faster than all others and reached saturation at an OD.sub.600 of 1.5 approximately 4 hours after induction. All other strains required more than 24 h to reach an OD.sub.600 of 1.0. As judged by the emission value at 528 nm, sfGFP expression in Vmax X2 reached a maximal value after 6 hours of expression and then decreased slightly. In the case of all other strains, the signal at 528 nm increased linearly over time over the entire course of the experiment (24 h). The greatest difference in OD.sub.600 and fluorescence occurred at the 4h time point (
[0042] Examination of the OD.sub.600 and emission at 528 nm after 4 h incubation in the presence of three different pCNFRS substrates (pAzF, pBrF, and pCNF) reveals several trends (
[0043] Although fluorescence emission at 528 nm is often taken as a measure of sfGFP expression, for most applications it is the isolated, purified protein yield that matters more, and isolated yields can be affected negatively if aggregation occurs at high protein concentration. 63 To evaluate whether the isolated yields would parallel fluorescence at 528 nm, we isolated sfGFP from each strain after a 4 h growth (
[0044] One strain-dependent complication of GCE is mis-incorporation of an endogenous ?-amino acid in place of the desired ncAA..sup.42-44 Many factors can influence the mis-incorporation rate, including inefficient transport of the ncAA into cells, imperfect specificity of the aaRS enzyme for the ncAA over natural ?-amino acids, differences in EF-Tu-mediated delivery of the mis-acylated tRNA to the ribosome, and slower rates of accommodation, elongation, or translocation of mis-acylated tRNAs..sup.43,64,65 Mis-incorporation at an amber stop codon can also arise from near-cognate suppression, in which natural (and correctly acylated) tRNAs pair imperfectly with a UAG codon and direct the incorporation of one or more natural ?-amino acids in place of the ncAA. The frequency of near-cognate suppression events depends on many factors, including the concentration of charged suppressor tRNA relative to near-cognate tRNAs and the presence of RF1, with higher occurrence of near-cognate suppression when the level of charged tRNA is low and RF1 is absent..sup.42 It has been found that G/U mismatch as well as the 3.sup.rd-base wobble mismatch are the most common errors during codon recognition, followed by some other single-base mismatches (A/C, U/U and U/C)..sup.66,67 It follows that the aminoacyl-tRNA of tyrosine (both codons), glutamine (CAG codon), tryptophan, lysine (AAG codon), and glutamic acid (GAG codon) are likely near-cognate suppressors of UAG, in agreement with observations here and elsewhere..sup.68 Additionally, phenylalanine and tyrosine mis-incorporations are also expected due to tRNA mischarging for their structural similarities to the ncAAs (pAzF, pBrF, and pCNF).
[0045] We used high-resolution LC-MS/MS to evaluate and compare the strain-dependent fidelity of ncAA incorporation at position 2 of sfGFP using pCNFRS (
[0046] The LC-MS/MS data revealed that the yield of sfGFP containing the desired ncAA at position 2 was both strain and ncAA dependent (
[0047] We note that in the previous experiments, the plasmids used to express the aaRS/tRNA pair and sfGFP in Vmax X2 cells were identical to the plasmids used in BL21, but those used in C321 and Top10 cells were different. In the case of Vmax X2 and BL21, the aaRS/tRNA pair was under the control of an arabinose-dependent promoter and sfGFP expression was under control of the T7 promoter. However, as C321 and Top10 cells lack T7 RNA polymerase, in this case, aaRS/tRNA expression was under control of a tac promoter and sfGFP was under control of an arabinose promoter. We wondered about the extent to which these differences in promoter/inducer identity affected the relative yield of sfGFP in each cell line (
[0048] For many ncAA applications relating to fundamental research or the preparation of homogeneous antibody-drug conjugates (ADCs), one ncAA per polypeptide chain is generally sufficient. For others, such as the design of sequence-defined protein materials, multiple copies of one (or more) ncAA may be desired..sup.69 These applications push the limits of genetic code expansion, as the isolated yields of such materials from standard E. coli strains can be low due to the increased frequency of RF1-mediated termination events..sup.45 Strains that lack RF1, such as B95 and C321 derivatives, have been reported to support greatly improved yields of model proteins containing multiple copies of a single ncAA such as pAzF..sup.39,41,45 Likewise, cell-free expression systems derived from these strains have been utilized..sup.55,70,71 These systems are able to produce appreciable amounts of material containing up to 40 non-canonical amino acids,.sup.70 but fidelity is evaluated only rarely.
[0049] We wondered whether Vmax X2 would also provide advantages in yield or purity for expression of proteins whose coding sequences contained multiple UAG codons. Thus, we examined the strain-dependent yield and purity of sfGFP containing pBrF at five positions with sfGFP (S2, D36, K101, E132, and D190). All of these positions have been shown previously to accept one of more ncAAs..sup.71,72 As before, all strains were grown under their own optimized conditions and in the presence of 0.5 mM pBrF; both OD.sub.600 and fluorescence at 528 nm were monitored as a function of time (
[0050] In summary, here we show that Vmax X2 is capable of producing exceptional yields of soluble protein containing up to 5 ncAAs. The yields realized with Vmax X2 are up to 25-fold higher than those achieved using commercial expression strains (Top10 and BL21) and more than 10-fold higher than those achieved using two different genomically recoded E. coli strains that lack endogenous UAG stop codons and have been optimized for improved fitness and preferred growth temperature (C321.4A.opt and C321.4A.exp, Addgene strains #87359 and #49018)..sup.39,40 In addition to high yields, Vmax X2 cells also generate proteins with significantly lower levels of mis-incorporated natural ?-amino acids at the UAG-programmed position, especially in cases in which the ncAA is only a moderate substrate for the chosen aaRS. Thus, use of Vmax X2 can obviate the need for time-consuming directed evolution experiments to improve specific activity of highly desirable substrates.
REFERENCES
[0051] (1) Chin, J. W. Expanding and Reprogramming the Genetic Code. Nature 2017, 550 (7674), 53-60. https://doi.org/10.1038/nature24031 10.1038/nature24031. [0052] (2) Young, D. D.; Schultz, P. G. Playing with the Molecules of Life. ACS Chem Biol 2018, 13 (4), 854-870. https://doi.org/10.1021/acschembio.7b00974 10.1021/acschembio.7b00974. Epub 2018 Mar. 2. [0053] (3) Mukai, T.; Lajoie, M. J.; Englert, M.; Soll, D. Rewriting the Genetic Code. Annu Rev Microbiol 2017, 71, 557-577. https://doi.org/10.1146/annurev-micro-090816-093247 10.1146/annurev-micro-090816-093247. Epub 2017 Jul. 11. [0054] (4) Liu, D. R.; Magliery, T. J.; Pastrnak, M.; Schultz, P. G. Engineering a TRNA and Aminoacyl-TRNA Synthetase for the Site-Specific Incorporation of Unnatural Amino Acids into Proteins in Vivo. Proc. Natl. Acad. Sci. 1997, 94 (19), 10092-10097. https://doi.org/10.1073/pnas.94.19.10092. [0055] (5) Wang, L.; Magliery, T. J.; Liu, D. R.; Schultz, P. G. A New Functional Suppressor TRNA/Aminoacyl-tRNA Synthetase Pair for the in Vivo Incorporation of Unnatural Amino Acids into Proteins. J. Am. Chem. Soc. 2000, 122 (20), 5010-5011. https://doi.org/10.1021/ja000595y. [0056] (6) Chin, J. W. Expanding and Reprogramming the Genetic Code of Cells and Animals. Annu. Rev. Biochem. 2014, 83 (1), 379-408. https://doi.org/10.1146/annurev-biochem-060713-035737. [0057] (7) Gan, Q.; Lehman, B. P.; Bobik, T. A.; Fan, C. Expanding the Genetic Code of Salmonella with Non-Canonical Amino Acids. Sci Rep 2016, 6, 39920. https://doi.org/10.1038/srep39920 10.1038/srep39920. [0058] (8) Lopatniuk, M.; Myronovskyi, M.; Luzhetskyy, A. Streptomyces Albus: A New Cell Factory for Non-Canonical Amino Acids Incorporation into Ribosomally Synthesized Natural Products. ACS Chem Biol 2017, 12 (9), 2362-2370. https://doi.org/10.1021/acschembio.7b00359 10.1021/acschembio.7b00359. Epub 2017 Aug. 16. [0059] (9) Hancock, S. M.; Uprety, R.; Deiters, A.; Chin, J. W. Expanding the Genetic Code of Yeast for Incorporation of Diverse Unnatural Amino Acids via a Pyrrolysyl-TRNA Synthetase/TRNA Pair. J Am Chem Soc 2010, 132 (42), 14819-14824. https://doi.org/10.1021/ja104609m 10.1021/ja104609m. [0060] (10) Brown, K. A.; Deiters, A. Genetic Code Expansion of Mammalian Cells with Unnatural Amino Acids. Curr Protoc Chem Biol 2015, 7 (3), 187-199. https://doi.org/10.1002/9780470559277.ch150038 10.1002/9780470559277.ch150038. [0061] (11) Beranek, V.; Reinkemeier, C. D.; Zhang, M. S.; Liang, A. D.; Kym, G.; Chin, J. W. Genetically Encoded Protein Phosphorylation in Mammalian Cells. Cell Chem Biol 2018, 25 (9), 1067-1074 e5. https://doi.org/10.1016/j.chembio1.2018.05.013 10.1016/j.chembio1.2018.05.013. Epub 2018 Jun. 21. [0062] (12) Greiss, S.; Chin, J. W. Expanding the Genetic Code of an Animal. J Am Chem Soc 2011, 133 (36), 14196-14199. https://doi.org/10.1021/ja2054034 10.1021/ja2054034. Epub 2011 Aug. 22. [0063] (13) Ernst, R. J.; Krogager, T. P.; Maywood, E. S.; Zanchi, R.; Beranek, V.; Elliott, T. S.; Barry, N. P.; Hastings, M. H.; Chin, J. W. Genetic Code Expansion in the Mouse Brain. Nat Chem Biol 2016, 12 (10), 776-778. https://doi.org/10.1038/nchembio.2160. [0064] (14) Brown, W.; Liu, J.; Deiters, A. Genetic Code Expansion in Animals. ACS Chem Biol 2018, 13 (9), 2375-2386. https://doi.org/10.1021/a cschembio.8b00520. [0065] (15) Wan, W.; Tharp, J. M.; Liu, W. R. Pyrrolysyl-TRNA Synthetase: An Ordinary Enzyme but an Outstanding Genetic Code Expansion Tool. Biochim Biophys Acta 2014, 1844 (6), 1059-1070. https://doi.org/10.1016/j.bbapap.2014.03.002. [0066] (16) Srinivasan, G.; James, C. M.; Krzycki, J. A. Pyrrolysine Encoded by UAG in Archaea: Charging of a UAG-Decoding Specialized TRNA. Science 2002, 296 (5572), 1459-1462. https://doi.org/10.1126/science.1069588. [0067] (17) Willis, J. C. W.; Chin, J. W. Mutually Orthogonal Pyrrolysyl-TRNA Synthetase/TRNA Pairs. Nat Chem 2018, 10 (8), 831-837. https://doi.org/10.1038/s41557-018-0052-5. [0068] (18) Suzuki, T.; Miller, C.; Guo, L.-T.; Ho, J. M. L.; Bryson, D. I.; Wang, Y.-S.; Liu, D. R.; Soll, D. Crystal Structures Reveal an Elusive Functional Domain of Pyrrolysyl-TRNA Synthetase. Nat. Chem. Biol. 2017, 13 (12), 1261-1266. https://doi.org/10.1038/nchembio.2497. [0069] (19) Neumann, H.; Peak-Chew, S. Y.; Chin, J. W. Genetically Encoding NE-Acetyllysine in Recombinant Proteins. Nat. Chem. Biol. 2008, 4 (4), 232-234. https://doi.org/10.1038/nchembio.73. [0070] (20) Wang, L.; Brock, A.; Herberich, B.; Schultz, P. G. Expanding the Genetic Code of Escherichia coli. Science 2001, 292 (5516), 498-500. https://doi.org/10.1126/science.1060077. [0071] (21) Young, D. D.; Young, T. S.; Jahnz, M.; Ahmad, I.; Spraggon, G.; Schultz, P. G. An Evolved Aminoacyl-TRNA Synthetase with Atypical Polysubstrate Specificity. Biochemistry 2011, 50 (11), 1894-1900. https://doi.org/10.1021/bi101929e. [0072] (22) Krahn, N.; Tharp, J. M.; Crnkovie, A.; Soll, D. Engineering Aminoacyl-TRNA Synthetases for Use in Synthetic Biology. In The Enzymes; Elsevier, 2020; Vol. 48, pp 351-395. https://doi.org/10.1016/bs.enz.2020.06.004. [0073] (23) Stokes, A. L.; Miyake-Stoner, S. J.; Peeler, J. C.; Nguyen, D. P.; Hammer, R. P.; Mehl, R. A Enhancing the Utility of Unnatural Amino Acid Synthetases by Manipulating Broad Substrate Specificity. Mol. Biosyst. 2009, 5 (9), 1032. https://doi.org/10.1039/b904032c. [0074] (24) Cervettini, D.; Tang, S.; Fried, S. D.; Willis, J. C. W.; Funke, L. F. H.; Colwell, L. J.; Chin, J. W. Rapid Discovery and Evolution of Orthogonal Aminoacyl-TRNA Synthetase-TRNA Pairs. Nat. Biotechnol. 2020, 38 (8), 989-999. https://doi.org/10.1038/s41587-020-0479-2. [0075] (25) Chatterjee, A.; Xiao, H.; Yang, P.-Y.; Soundararajan, G.; Schultz, P. G. A Tryptophanyl-TRNA Synthetase/TRNA Pair for Unnatural Amino Acid Mutagenesis in E. coli. Angew. Chem. Int. Ed. 2013, 52 (19), 5106-5109. https://doi.org/10.1002/anie.201301094. [0076] (26) Italia, J. S.; Addy, P. S.; Wrobel, C. J. J.; Crawford, L. A.; Lajoie, M. J.; Zheng, Y.; Chatterjee, A. An Orthogonalized Platform for Genetic Code Expansion in Both Bacteria and Eukaryotes. Nat. Chem. Biol. 2017, 13 (4), 446-450. https://doi.org/10.1038/nchembio.2312. [0077] (27) Axup, J. Y.; Bajjuri, K. M.; Ritland, M.; Hutchins, B. M.; Kim, C. H.; Kazane, S. A.; Halder, R.; Forsyth, J. S.; Santidrian, A. F.; Stafin, K.; Lu, Y.; Tran, H.; Seller, A. J.; Biroc, S. L.; Szydlik, A.; Pinkstaff, J. K.; Tian, F.; Sinha, S. C.; Felding-Habermann, B.; Smider, V. V.; Schultz, P. G. Synthesis of Site-Specific Antibody-Drug Conjugates Using Unnatural Amino Acids. Proc. Natl. Acad. Sci. 2012, 109 (40), 16101-16106. https://doi.org/10.1073/pnas.1211023109. [0078] (28) Hallam, T. J.; Wold, E.; Wahl, A.; Smider, V. V. Antibody Conjugates with Unnatural Amino Acids. Mol. Pharm. 2015, 12 (6), 1848-1862. https://doi.org/10.1021/acs.molpharmaceut.5b00082. [0079] (29) Beck, A.; Goetsch, L.; Dumontet, C.; Corvaia, N. Strategies and Challenges for the next Generation of Antibody-Drug Conjugates. Nat. Rev. Drug Discov. 2017, 16 (5), 315-337. https://doi.org/10.1038/nrd.2016.268. [0080] (30) Cho, H.; Daniel, T.; Buechler, Y. J.; Litzinger, D. C.; Maio, Z.; Putnam, A.-M. H.; Kraynov, V. S.; Sim, B.-C.; Bussell, S.; Javahishvili, T.; Kaphle, S.; Viramontes, G.; Ong, M.; Chu, S.; Gc, B.; Lieu, R.; Knudsen, N.; Castiglioni, P.; Norman, T. C.; Axelrod, D. W.; Hoffman, A. R.; Schultz, P. G.; DiMarchi, R. D.; Kimmel, B. E. Optimized Clinical Performance of Growth Hormone with an Expanded Genetic Code. Proc. Natl. Acad. Sci. 2011, 108 (22), 9060-9065. https://doi.org/10.1073/pnas.1100387108. [0081] (31) Lieblich, S. A.; Fang, K. Y.; Cahn, J. K. B.; Rawson, J.; LeBon, J.; Ku, H. T.; Tirrell, D. A. 4 S-Hydroxylation of Insulin at ProB28 Accelerates Hexamer Dissociation and Delays Fibrillation. J. Am. Chem. Soc. 2017, 139 (25), 8384-8387. https://doi.org/10.1021/jacs.7b00794. [0082] (32) Rezhdo, A.; Islam, M.; Huang, M.; Van Deventer, J. A. Future Prospects for Noncanonical Amino Acids in Biological Therapeutics. Curr. Opin. Biotechnol. 2019, 60, 168-178. https://doi.org/10.1016/j.copbio.2019.02.020. [0083] (33) Katoh, T.; Sengoku, T.; Hirata, K.; Ogata, K.; Suga, H. Ribosomal Synthesis and de Novo Discovery of Bioactive Foldamer Peptides Containing Cyclic (3-Amino Acids. Nat. Chem. 2020, 12 (11), 1081-1088. https://doi.org/10.1038/541557-020-0525-1. [0084] (34) Zambaldo, C.; Luo, X.; Mehta, A. P.; Schultz, P. G. Recombinant Macrocyclic Lanthipeptides Incorporating Non-Canonical Amino Acids. J. Am. Chem. Soc. 2017, 139 (34), 11646-11649. https://doi.org/10.1021/jacs.7b04159. [0085] (35) Frost, J. R.; Jacob, N. T.; Papa, L. J.; Owens, A. E.; Fasan, R. Ribosomal Synthesis of Macrocyclic Peptides in Vitro and in Vivo Mediated by Genetically Encoded Aminothiol Unnatural Amino Acids. ACS Chem. Biol. 2015, 10 (8), 1805-1816. https://doi.org/10.1021/acschembio.5b00119. [0086] (36) Huang, Y.; Liu, T. Therapeutic Applications of Genetic Code Expansion. Synth. Syst. Biotechnol. 2018, 3 (3), 150-158. https://doi.org/10.1016/j.synbio.2018.09.003. [0087] (37) Zhou, J.; Korostelev, A.; Lancaster, L.; Noller, H. F. Crystal Structures of 70S Ribosomes Bound to Release Factors RF1, RF2 and RF3. Curr. Opin. Struct. Biol. 2012, 22 (6), 733-742. https://doi.org/10.1016/j.sbi.2012.08.004. [0088] (38) Capecchi, M. R. Polypeptide Chain Termination in Vitro: Isolation of a Release Factor. Proc. Natl. Acad. Sci. 1967, 58 (3), 1144-1151. https://doi.org/10.1073/pnas.58.3.1144. [0089] (39) Lajoie, M. J.; Rovner, A. J.; Goodman, D. B.; Aerni, H. R.; Haimovich, A. D.; Kuznetsov, G.; Mercer, J. A.; Wang, H. H.; Carr, P. A.; Mosberg, J. A.; Rohland, N.; Schultz, P. G.; Jacobson, J. M.; Rinehart, J.; Church, G. M.; Isaacs, F. J. Genomically Recoded Organisms Expand Biological Functions. Science 2013, 342 (6156), 357-360. https://doi.org/10.1126/science.1241459. [0090] (40) Kuznetsov, G.; Goodman, D. B.; Filsinger, G. T.; Landon, M.; Rohland, N.; Aach, J.; Lajoie, M. J.; Church, G. M. Optimizing Complex Phenotypes through Model-Guided Multiplex Genome Engineering. Genome Biol. 2017, 18 (1), 100. https://doi.org/10.1186/s13059-017-1217-z. [0091] (41) Mukai, T.; Hoshi, H.; Ohtake, K.; Takahashi, M.; Yamaguchi, A.; Hayashi, A.; Yokoyama, S.; Sakamoto, K. Highly Reproductive Escherichia coli Cells with No Specific Assignment to the UAG Codon. Sci. Rep. 2015, 5 (1), 9699. https://doi.org/10.1038/srep09699. [0092] (42) Beyer, J. N.; Hosseinzadeh, P.; Gottfried-Lee, I.; Van Fossen, E. M.; Zhu, P.; Bednar, R. M.; Karplus, P. A.; Mehl, R. A.; Cooley, R. B. Overcoming Near-Cognate Suppression in a Release Factor 1-Deficient Host with an Improved Nitro-Tyrosine TRNA Synthetase. J. Mol. Biol. 2020, 432 (16), 4690-4704. https://doi.org/10.1016/j.jmb.2020.06.014. [0093] (43) Aerni, H. R.; Shifman, M. A.; Rogulina, S.; O'Donoghue, P.; Rinehart, J. Revealing the Amino Acid Composition of Proteins within an Expanded Genetic Code. Nucleic Acids Res 2015, 43 (2), e8. https://doi.org/10.1093/nar/gku1087. [0094] (44) George, S.; Aguirre, J. D.; Spratt, D. E.; Bi, Y.; Jeffery, M.; Shaw, G. S.; O'Donoghue, P. Generation of Phospho-Ubiquitin Variants by Orthogonal Translation Reveals Codon Skipping. FEBS Lett. 2016, 590 (10), 1530-1542. https://doi.org/10.1002/1873-3468.12182. [0095] (45) Zheng, Y.; Lajoie, M. J.; Italia, J. S.; Chin, M. A.; Church, G. M.; Chatterjee, A. Performance of Optimized Noncanonical Amino Acid Mutagenesis Systems in the Absence of Release Factor 1. Mol. Biosyst. 2016, 12 (6), 1746-1749. https://doi.org/10.1039/C6MB00070C. [0096] (46) Gan, Q.; Fan, C. Increasing the Fidelity of Noncanonical Amino Acid Incorporation in Cell-Free Protein Synthesis. Biochim Biophys Acta Gen Subj 2017, 1861 (11 Pt B), 3047-3052. https://doi.org/10.1016/j.bbagen.2016.12.002. [0097] (47) Claassens, N. J.; Burgener, S.; Vogeli, B.; Erb, T. J.; Bar-Even, A. A Critical Comparison of Cellular and Cell-Free Bioproduction Systems. Curr. Opin. Biotechnol. 2019, 60, 221-229. https://doi.org/10.1016/j.copbio.2019.05.003. [0098] (48) Vieille, C.; Zeikus, G. J. Hyperthermophilic Enzymes: Sources, Uses, and Molecular Mechanisms for Thermostability. Microbiol Mol Biol Rev 2001, 65 (1), 1-43. https://doi.org/10.1128/MMBR.65.1.1-43.2001. [0099] (49) Hu, L.; Qin, X.; Huang, Y.; Cao, W.; Wang, C.; Wang, Y.; Ling, X.; Chen, H.; Wu, D.; Lin, Y.; Liu, T. Thermophilic Pyrrolysyl-TRNA Synthetase Mutants for Enhanced Mammalian Genetic Code Expansion. ACS Synth. Biol. 2020, 9 (10), 2723-2736. https://doi.org/10.1021/acssynbio.0c00257. [0100] (50) Vmax? X2 Chemically Competent Cells; SGI-DNA: La Jolla, C A, 2020. [0101] (51) Lee, H. H.; Ostrov, N.; Wong, B. G.; Gold, M. A.; Khalil, A. S.; Church, G. M. Functional Genomics of the Rapidly Replicating Bacterium Vibrio natriegens by CRISPRi. Nat Microbiol 2019, 4 (7), 1105-1113. https://doi.org/10.1038/s41564-019-0423-8. [0102] (52) Weinstock, M. T.; Hesek, E. D.; Wilson, C. M.; Gibson, D. G. Vibrio natriegens as a Fast-Growing Host for Molecular Biology. Nat Methods 2016, 13 (10), 849-851. https://doi.org/10.1038/nmeth.3970. [0103] (53) Becker, W.; Wimberger, F.; Zangger, K. Vibrio natriegens: An Alternative Expression System for the High-Yield Production of Isotopically Labeled Proteins. Biochemistry 2019, 58 [0104] (25), 2799-2803. https://doi.org/10.1021/acs.biochem.9b00403. [0105] (54) Schleicher, L.; Muras, V.; Claussen, B.; Pfannstiel, J.; Blombach, B.; Dibrov, P.; Fritz, G.; Steuber, J. Vibrio natriegens as Host for Expression of Multisubunit Membrane Protein Complexes. Front. Microbiol. 2018, 9, 2537. https://doi.org/10.3389/fmicb.2018.02537. [0106] (55) Des Soye, B. J.; Davidson, S. R.; Weinstock, M. T.; Gibson, D. G.; Jewett, M. C. Establishing a High-Yielding Cell-Free Protein Synthesis Platform Derived from Vibrio natriegens. ACS Synth. Biol. 2018, 7 (9), 2245-2255. https://doi.org/10.1021/acssynbio.8b00252. [0107] (56) Wiegand, D. J.; Lee, H. H.; Ostrov, N.; Church, G. M. Establishing a Cell-Free Vibrio natriegens Expression System. ACS Synth. Biol. 2018, 7 (10), 2475-2479. https://doi.org/10.1021/acssynbio.8b00222. [0108] (57) Tschirhart, T.; Shukla, V.; Kelly, E. E.; Schultzhaus, Z.; NewRingeisen, E.; Erickson, J. S.; Wang, Z.; Garcia, W.; Curl, E.; Egbert, R. G.; Yeung, E.; Vora, G. J. Synthetic Biology Tools for the Fast-Growing Marine Bacterium. ACS Synth Biol 2019, 8 (9), 2069-2079. https://doi.org/10.1021/acssynbio.9b00176. [0109] (58) Mamat, U.; Woodard, R. W.; Wilke, K.; Souvignier, C.; Mead, D.; Steinmetz, E.; Terry, K.; Kovacich, C.; Zegers, A.; Knox, C. Endotoxin-Free Protein ProductionClearColi? Technology. Nat. Methods 2013, 10 (9), 916-916. https://doi.org/10.1038/nmeth.f.367. [0110] (59) Ozer, E.; Alfonta, L. Genetic Code Expansion of Vibrio natriegens. Front. Bioeng. Biotechnol. 2021, 9, 95. https://doi.org/10.3389/fbioe.2021.594429. [0111] (60) Young, T. S.; Ahmad, I.; Yin, J. A.; Schultz, P. G. An Enhanced System for Unnatural Amino Acid Mutagenesis in E. coli. J Mol Biol 2010, 395 (2), 361-374. https://doi.org/10.1016/j.jmb.2009.10.030. [0112] (61) Kwok, H. S.; Vargas-Rodriguez, O.; Melnikov, S. V.; Soll, D. Engineered Aminoacyl-TRNA Synthetases with Improved Selectivity toward Noncanonical Amino Acids. ACS Chem. Biol. 2019, 14 (4), 603-612. https://doi.org/10.1021/a cschembio.9b00088. [0113] (62) Dunkelmann, D. L.; Willis, J. C. W.; Beattie, A. T.; Chin, J. W. Engineered Triply Orthogonal Pyrrolysyl-TRNA Synthetase/TRNA Pairs Enable the Genetic Encoding of Three Distinct Non-Canonical Amino Acids. Nat. Chem. 2020, 12 (6), 535-544. https://doi.org/10.1038/s41557-020-0472-x. [0114] (63) Lebendiker, M.; Danieli, T. Production of Prone-to-Aggregate Proteins. FEBS Lett. 2014, 588 (2), 236-246. https://doi.org/10.1016/j.febslet.2013.10.044. [0115] (64) Haruna, K.; Alkazemi, M. H.; Liu, Y.; Soll, D.; Englert, M. Engineering the Elongation Factor Tu for Efficient Selenoprotein Synthesis. Nucleic Acids Res. 2014, 42 (15), 9976-9983. https://doi.org/10.1093/nar/gku691. [0116] (65) Antonczak, A. K.; Morris, J.; Tippmann, E. M. Advances in the Mechanism and Understanding of Site-Selective Noncanonical Amino Acid Incorporation. Curr. Opin. Struct. Biol. 2011, 21 (4), 481-487. https://doi.org/10.1016/j.sbi.2011.04.004. [0117] (66) Zhang, Z.; Shah, B.; Bondarenko, P. V. G/U and Certain Wobble Position Mismatches as Possible Main Causes of Amino Acid Misincorporations. Biochemistry 2013, 52 (45), 8165-8176. https://doi.org/10.1021/bi401002c. [0118] (67) Wong, H. E.; Huang, C.-J.; Zhang, Z Amino Acid Misincorporation Propensities Revealed through Systematic Amino Acid Starvation. Biochemistry 2018, 57 (49), 6767-6779. https://doi.org/10.1021/acs.biochem.8600976. [0119] (68) Roy, B.; Leszyk, J. D.; Mangus, D. A.; Jacobson, A. Nonsense Suppression by Near-Cognate TRNAs Employs Alternative Base Pairing at Codon Positions 1 and 3. Proc. Natl. Acad. Sci. 2015, 112 (10), 3038-3043. https://doi.org/10.1073/pnas.1424127112. [0120] (69) Israeli, B.; Vaserman, L.; Amiram, M. Multi-Site Incorporation of Nonstandard Amino Acids into Protein-Based Biomaterials. Isr. J. Chem. 2020, 60 (12), 1118-1128. https://doi.org/10.1002/ijch.201900043. [0121] (70) Des Soye, B. J.; Gerbasi, V. R.; Thomas, P. M.; Kelleher, N. L.; Jewett, M. C. A Highly Productive, One-Pot Cell-Free Protein Synthesis Platform Based on Genomically Recoded Escherichia coli. Cell Chem. Biol. 2019, 26 (12), 1743-1754.e9. https://doi.org/10.1016/j.chembio1.2019.10.008. [0122] (71) Hong, S. H.; Ntai, I.; Haimovich, A. D.; Kelleher, N. L.; Isaacs, F. J.; Jewett, M. C. Cell-Free Protein Synthesis from a Release Factor 1 Deficient Escherichia coli Activates Efficient and Multiple Site-Specific Nonstandard Amino Acid Incorporation. ACS Synth. Biol. 2014, 3 (6), 398-409. https://doi.org/10.1021/s6400140t. [0123] (72) Johnson, D. B. F.; Xu, J.; Shen, Z.; Takimoto, J. K.; Schultz, M. D.; Schmitz, R. J.; Xiang, Z.; Ecker, J. R.; Briggs, S. P.; Wang, L. RF1 Knockout Allows Ribosomal Incorporation of Unnatural Amino Acids at Multiple Sites. Nat. Chem. Biol. 2011, 7 (11), 779-786. https://doi.org/10.1038/nchembio.657.
TABLE-US-00002 TABLE 1 Isolated yields (mg/L) of ncAA-containing sfGFP isolated from Vmax X2, BL21, Top10, C321.?A.exp, and C321.?A.opt cells after 4 h incubation. VMax X2 and BL21 cells expressed sfGFP and pCNFRS under the control of T7 and arabinose promoters, respectively. Top10, C321.?A.exp, and C321.?A.opt cells expressed sfGFP and pCNFRS under the control of arabinose and tac promoters, respectively. strain/ VMax X2 Promoter ncAA (ratio) BL21 C321.?A.exp C321.?A.opt Top10 (sfGFP/aaRS) pAzF 355 66 T7/Arabinose (5-25 fold) 42 62 18 14 Arabinose/Tac pBrF 226 107 T7/Arabinose (2-12 fold) 25 18 18 Arabinose/Tac 92 99 122 T5/Arabinose pCNF 115 9 T7/Arabinose (8-13 fold) 19 14 9 Arabinose/Tac
TABLE-US-00003 TABLE 2 Plasmids used in this study ORF 1 ORF 2 Plasmid Name Resistance Ori Promoter Gene Promoter Gene pET-S2TAG-sfGFP Carb pBR322 T7 S2TAG-sfGFP pBAD-S2TAG-sfGFP Carb pBR322 P.sub.BAD S2TAG-sfGFP pET22b-T5-151TAG-sfGFP Carb pBR322 T5 151TAG-sfGFP pET22b-T5/7-151TAG-sfGFP Carb pBR322 T5/T7 151TAG pET22b-T7-151TAG-sfGFP Carb pBR322 T7 151TAG pET-5xTAG-sfGFP Carb pBR322 T7 5xTAG-sfGFP pBAD-5xTAG-sfGFP Carb pBR322 P.sub.BAD sfGFP pULTRA-CNF Spec CloDF13 tac pCNFRS pEVOL-CNF Cm p15A P.sub.BAD pCNFRS glnS pCNFRS
[0124] Supplementary Methods
[0125] Bacterial Strains. Vmax X2, BL21 (DE3), and Top10 cells were purchased from Codex DNA, NEB (Catalog #C2527), and ThermoFisher (Catalog #C404010) respectively. C321.4A.Opt and C321.4A.Exp were gifts from George Church (Addgene plasmids #87359 and #49018).
[0126] Amino Acids. pAzF, pBrF, and pCNF were purchased from Chem-Impex International (Catalog #06162, 04086, and 04110). BocK was purchased from Sigma-Aldrich (SKU 349661).
[0127] General Methods. The following antibiotic concentrations were used: carbenicillin, 100 ?g/mL (E. coli) or 12.5 ?g/mL (VMax X2); chloramphenicol 25 ?g/mL; spectinomycin 50 ?g/mL. Additionally, C321.4A.opt and C321.4A.exp starter cultures were grown in the presence of 15 ?g/mL gentamicin or 25 ?g/mL Zeocin? (ThermoFisher) respectively.
[0128] Transformation protocols. Vmax X2 and E. coli (BL21, C321, Top10) cells were transformed in accordance with manufacturer protocols with some modifications as follows. Frozen stocks were thawed on ice. Upon thawing, 1 ?L of plasmid (see below) encoding sfGFP and the orthogonal synthetase was added. After a 30 mM incubation on ice, cells were heat shocked for 45 (Vmax X2) or 90 s (BL21, C321, Top10) and put back on ice for 2 minutes. 550 ?L of Vmax recovery media (Vmax X2) or SOB media was added and cells were recovered at 34? C. (C321.4A.opt) or 37? C. for one (E. coli) or four hours (Vmax X2) before plating. For 2TAG-sfGFP expression, Vmax X2 and BL21 cells were transformed with pEVOL-CNF and pET-S2TAG-sfGFP, while C321 and Top10 cells were transformed with pULTRA-CNF and pBAD-S2TAG-sfGFP. pEVOL-mmPyl was used in place of pEVOL-CNF for expression of sfGFP containing BocK at the 2 nd position. For 5XTAG-sfGFP expression Vmax X2 and BL21 cells were transformed with pEVOL-CNF and pET-5XTAG-sfGFP, C321 and Top10 cells were transformed with pULTRA-CNF and pBAD-5XTAG-sfGFP. For 151TAG-sfGFP expression, all strains were transformed with pEVOL-CNF and pET22b-151TAG-sfGFP.
[0129] Expression of sfGFP variants. Starter cultures were grown for 3 hours (Vmax X2) or overnight (E. coli) in 25 mL of BHI (Teknova, Catalog #B9505)+v2salts (204 mM NaCl, 23.2 mM MgCl.sub.2, 4.2 mM KCl) or 10 mL of LB Miller (AmericanBio, Catalog #AB01201) supplemented with antibiotics at 34? C. (C321.A.opt) or 37? C. To maximize aeration growth rate, starter cultures for Vmax X2 cells were grown in a baffled flask. Following the initial incubation period, starter cultures were diluted 1:100 into 25 mL BHI+v2 salts or LB supplemented with 0.5 mM (pAzF, pBrF, pCNF) or 10 mM (BocK) ncAA. Once cultures reached an OD of 0.5, protein expression was induced by addition of 1 mM IPTG and 0.2% arabinose.
[0130] Purification of sfGFP variants. Cultures were centrifuged for 15 minutes at 10,000?g and 4? C. Pellets were resuspended in 15 mL of lysis buffer (50 mM sodium phosphate (pH 8), 300 mM NaCl, 20 mM imidazole,) supplemented with 1 tablet cOmplete, mini EDTA-free protease inhibitor cocktail (Sigma-Aldrich, St. Louis, MO) and sonicated for 5 minutes total (30 s on, 30 s off) at 30% duty cycle. Following sonication, the soluble fraction was isolated by centrifugation of the lysate for 25 minutes at 10,000?g and 4? C. The supernatant was isolated and incubated with 500 ?L of Ni-NTA (Qiagen, Catalog #30230) resin for an hour at 4? C. Slurry was poured onto a gravity flow column and the resin was washed with 15 mL of lysis buffer following drainage of the flowthrough. Bound protein was then eluted by the addition of 3.5 mL of elution buffer (50 mM sodium phosphate (pH 8), 250 mM imidazole). For quantification and MS analysis, the eluent was buffer exchanged into 50 mM sodium phosphate utilizing a PD-10 column.
[0131] Intact Protein Mass Spectometry Analysis. LC/MS analysis was performed on an Agilent 1290 Infinity II HPLC connected to an Agilent 6530B QTOF AJS-ESI. 1 ?g of protein was injected onto a Poroshell 300SB-C8 column (2.1?75 mm, 5-Micron, room temperature, Agilent) using a linear gradient from 5 to 75% acetonitrile over 9.5 minutes with 0.1% formic acid as the aqueous phase after an initial hold at 5% acetonitrile for 0.5 mM (0.4 mL/min). The following parameters were used during acquisition: Fragmentor voltage 175 V, gas temperature 300? C., gas flow 12 L/min, sheath gas temperature 350? C., sheath gas flow 12 L/min, nebulizer pressure 35 psi, skimmer voltage 65 V, Vcap 5000 V, 3 spectra/s. Intact protein masses were obtained via deconvolution using the Maximum Entropy algorithm in Mass Hunter Bioconfirm (V10, Agilent).
[0132] Monitoring of cell growth and sfGFP expression over time. 25 mL cultures were grown in 250 mL baffled flask and expression sfGFP variants and pCNFRS was induced as described previously. At each timepoint, 100 uL aliquots of each culture were transferred onto a black, clear bottom, 96-well plate. The OD.sub.600 and emission at 528 nm (?.sub.ex=485 nm) was measured in BioTek Synergy H1 microplate reader.
[0133] Fidelity of ncAA incorporation by LC-MS/MS. To determine the fidelity of amino acid incorporation at position 2 of sfGFP, isolated sfGFP (13 to 72 ?g, most at ?25 ?g) was denatured with 6 M guanidine in a 0.15 M Tris buffer at pH 7.5, followed by disulfide reduction with 8 mM dithiothreitol (DTT) at 37? C. for 30 mM. The reduced sfGFP was alkylated in the presence of 14 mM iodoacetamide at 25? C. for 25 mM, and then quenched using 6 mM DTT. The reduced/alkylated protein was exchanged into ?50 ?L of 0.1 M Tris buffer at pH 7.5 using a Microcon 10-KDa membrane, followed by addition of 2.5 to 7.0 ?g endoproteinase Glu-C (in a 0.5 ?g/?L solution) directly to the membrane to achieve an enzyme-to-substrate ratio of at least 1:10. After 3 hours at 37? C., the digestion was quenched with an equal volume of 0.25 M acetate buffer (pH 4.8) containing 6 M guanidine. Peptide fragments were collected by spinning down through the membrane and subjected to LC-MS/MS analysis.
[0134] To determine the fidelity amino acid incorporation at the remaining 4 positions, isolated sfGFP was also digested by trypsin, with the same procedure as described above, except trypsin was used in place of Glu-C, and digested was allowed to proceed for 1 hour instead of 3 hours.
[0135] LC-MS/MS analysis was performed on an Agilent 1290-11 HPLC directly connected to a Thermo Fisher Q Exactive high-resolution mass spectrometer. Peptides were separated on a Waters HSS T3 reversed-phase column (2.1?150 mm) at 50? C. with a 70-min acetonitrile gradient (0.5% to 35%) containing 0.1% formic acid in the mobile phase, and a total flow rate of 0.25 mL/min. The MS data were collected at 70,000 resolution, followed by data-dependent higher-energy collision dissociation (HCD) MS/MS at a normalized collision energy of 25%. Proteolytic peptides were identified and quantified on MassAnalyzer, an in-house developed program (available in Biopharma Finder from Thermo Fisher). The program performs feature extraction, peptide identification, retention time alignment, and relative quantitation in an automated fashion.
TABLE-US-00004 Sequences*Denotesastopcodon 2TAG-sfGFP: (SEQIDNO:2) M*KGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTT GKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISF KDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNV YITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHY LSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKGSHHHHHH 5XTAG-sfGFP: (SEQIDNO:3) M*KGEELFTGVVPILVELDGDVNGHKFSVRGEGEG*ATNGKLTLKFICTT GKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISF *DDGTYKTRAEVKFEGDTLVNRIELKGIDFK*DGNILGHKLEYNFNSHNV YITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIG*GPVLLPDNHY LSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKGSHHHHHH 151TAG-sfGFP: (SEQIDNO:4) MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTT GKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISF KDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNV *ITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHY LSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKGSHHHHHH pCNFRS: (SEQIDNO:5) MDEFEMIKRNTSEIISEEELREVLKKDEKSALIGFEPSGKIHLGHYLQIK KMIDLQNAGFDIIIVLADLHAYLNQKGELDEIRKIGDYNKKVFEAMGLKA KYVYGSEWMLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVI YPIMQVNGAHYLGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLD GEGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLE YPLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILE PIRKRL mmPyIRS (SEQIDNO:6) MDKKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNN SRSSRTARALRHHKYRKTCKRCRVSDEDLNKFLTKANEDQTSVKVKVVSA PTRTKKAMPKSVARAPKPLENTEAAQAQPSGSKFSPAIPVSTQESVSVPA SVSTSISSISTGATASALVKGNTNPITSMSAPVQASAPALTKSQTDRLEV LLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREI TRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPM LAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQM GSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSA VVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGI STNL
SUPPLEMENTAL REFERENCES
[0136] (1) Kwok, H. S.; Vargas-Rodriguez, O.; Melnikov, S. V.; Soll, D. Engineered Aminoacyl-TRNA Synthetases with Improved Selectivity toward Noncanonical Amino Acids. ACS Chem. Biol. 2019, 14 (4), 603-612. https://doi.org/10.1021/a cschembio.9b00088. [0137] (2) Wang, Y. S.; Fang, X.; Wallace, A. L.; Wu, B.; Liu, W. R. A Rationally Designed Pyrrolysyl-TRNA Synthetase Mutant with a Broad Substrate Spectrum. J Am Chem Soc 2012, 134 (6), 2950-2953. https://doi.org/10.1021/ja211972x. [0138] (3) Young, D. D.; Young, T. S.; Jahnz, M.; Ahmad, I.; Spraggon, G.; Schultz, P. G. An Evolved Aminoacyl-TRNA Synthetase with Atypical Polysubstrate Specificity. Biochemistry 2011, 50 (11), 1894-1900. https://doi.org/10.1021/bi101929e.